Alex Ade Yuqin Liu Alexander Diehl Allen Xiang Asiyah Yu Lin Caty Chung Daniel Cooper Helen Parkinson Hiroshi Masuya Hongjie Pan James Malone Jiangan Xie Jie Zheng Matthew Brush Sirarat Sarntivijai Stefanie Seltmann Stephan Schurer Uma Vempati Xiaolin Yang Yongqun "Oliver" He (YH) Yue Liu 2023-03-28 The Cell Line Ontology (CLO) is a community-based ontology of cell lines. The CLO is developed to unify publicly available cell line entry data from multiple sources to a standardized logically defined format based on consensus design patterns. OWL-DL An ontology for the domain of cell lines and cell line cells CLO: Cell Line Ontology Citation: Sarntivijai S, Lin Y, Xiang Z, Meehan TF, Diehl AD, Vempati UD, Schürer TC, Pang C, Malone J, Parkinson H, Liu Y, Takatsuki T, Saijo K, Masuya H, Nakamura Y, Brush MH, Haendel MA, Zheng J, Stoeckert CJ, Peters B, Mungall CJ, Carey TE, States DJ, Athey BD, He Y. CLO: The Cell Line Ontology. Journal of Biomedical Semantics. 2014, 5:37. doi:10.1186/2041-1480-5-37. PMID: 25852852. PMCID: PMC4387853. 2.1.188 BFO OWL specification label Relates an entity in the ontology to the name of the variable that is used to represent it in the code that generates the BFO OWL file from the lispy specification. Really of interest to developers only BFO OWL specification label BFO OWL specification label BFO CLIF specification label Relates an entity in the ontology to the term that is used to represent it in the the CLIF specification of BFO2 Person:Alan Ruttenberg Really of interest to developers only BFO CLIF specification label BFO CLIF specification label An annotation property that represents an ID used in the NIH LINCS project. Oliver He, Jiangan Xie, Jie Zheng LINCS ID An annotation property that specifies an STR profile of a cell line cell. Yongqun He STR profile An annotation property that represents a PubMed BioAssay Identifier accession number. Oliver He https://pubchem.ncbi.nlm.nih.gov/help.html PubChem AID An annotation property that describes the information of a problematic cell line. Yongqun He problematic cell line annotation An annotation property that describes the origin of a cell line. Oliver He cell line cell origin An annotation property that describes the features of a cell line and cell line cell. Oliver He cell line cell feature An annotation property that describes known mutation(s) about a cell. Oliver He Known mutation annotation Cell culture condition editor preferred label editor preferred term The concise, meaningful, and human-friendly name for a class or property preferred by the ontology developers. (US-English) PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> editor preferred label editor preferred label editor preferred term editor preferred term editor preferred term~editor preferred label example example of usage A phrase describing how a class name should be used. May also include other kinds of examples that facilitate immediate understanding of a class semantics, such as widely known prototypical subclasses or instances of the class. Although essential for high level terms, examples for low level terms (e.g., Affymetrix HU133 array) are not PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> IAO:0000112 uberon example_of_usage true example_of_usage example of usage example of usage in branch An annotation property indicating which module the terms belong to. This is currently experimental and not implemented yet. GROUP:OBI OBI_0000277 in branch in branch has curation status PERSON:Alan Ruttenberg PERSON:Bill Bug PERSON:Melanie Courtot OBI_0000281 has curation status has curation status definition The official OBI definition, explaining the meaning of a class or property. Shall be Aristotelian, formalized and normalized. Can be augmented with colloquial definitions. The official definition, explaining the meaning of a class or property. Shall be Aristotelian, formalized and normalized. Can be augmented with colloquial definitions. The official definition. 2012-04-05: Barry Smith The official OBI definition, explaining the meaning of a class or property: 'Shall be Aristotelian, formalized and normalized. Can be augmented with colloquial definitions' is terrible. Can you fix to something like: A statement of necessary and sufficient conditions explaining the meaning of an expression referring to a class or property. Alan Ruttenberg Your proposed definition is a reasonable candidate, except that it is very common that necessary and sufficient conditions are not given. Mostly they are necessary, occasionally they are necessary and sufficient or just sufficient. Often they use terms that are not themselves defined and so they effectively can't be evaluated by those criteria. On the specifics of the proposed definition: We don't have definitions of 'meaning' or 'expression' or 'property'. For 'reference' in the intended sense I think we use the term 'denotation'. For 'expression', I think we you mean symbol, or identifier. For 'meaning' it differs for class and property. For class we want documentation that let's the intended reader determine whether an entity is instance of the class, or not. For property we want documentation that let's the intended reader determine, given a pair of potential relata, whether the assertion that the relation holds is true. The 'intended reader' part suggests that we also specify who, we expect, would be able to understand the definition, and also generalizes over human and computer reader to include textual and logical definition. Personally, I am more comfortable weakening definition to documentation, with instructions as to what is desirable. We also have the outstanding issue of how to aim different definitions to different audiences. A clinical audience reading chebi wants a different sort of definition documentation/definition from a chemistry trained audience, and similarly there is a need for a definition that is adequate for an ontologist to work with. PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> definition definition textual definition editor note An administrative note intended for its editor. It may not be included in the publication version of the ontology, so it should contain nothing necessary for end users to understand the ontology. PERSON:Daniel Schober GROUP:OBI:<http://purl.obfoundry.org/obo/obi> IAO:0000116 uberon editor_note true editor_note editor note editor note term editor Name of editor entering the term in the file. The term editor is a point of contact for information regarding the term. The term editor may be, but is not always, the author of the definition, which may have been worked upon by several people 20110707, MC: label update to term editor and definition modified accordingly. See http://code.google.com/p/information-artifact-ontology/issues/detail?id=115. PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> term editor term editor alternative term An alternative name for a class or property which means the same thing as the preferred name (semantically equivalent) PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> alternative term alternative term definition source formal citation, e.g. identifier in external database to indicate / attribute source(s) for the definition. Free text indicate / attribute source(s) for the definition. EXAMPLE: Author Name, URI, MeSH Term C04, PUBMED ID, Wiki uri on 31.01.2007 PERSON:Daniel Schober GROUP:OBI:<http://purl.obolibrary.org/obo/obi> Discussion on obo-discuss mailing-list, see http://bit.ly/hgm99w definition source definition source curator note An administrative note of use for a curator but of no use for a user PERSON:Alan Ruttenberg IAO:0000232 uberon curator_notes true curator_notes curator note curator note curator notes imported from For external terms/classes, the ontology from which the term was imported PERSON:Alan Ruttenberg PERSON:Melanie Courtot GROUP:OBI:<http://purl.obolibrary.org/obo/obi> imported from imported from expand expression to expand expression to expand assertion to expand assertion to OBO foundry unique label elucidation person:Alan Ruttenberg Person:Barry Smith Primitive terms in a highest-level ontology such as BFO are terms which are so basic to our understanding of reality that there is no way of defining them in a non-circular fashion. For these, therefore, we can provide only elucidations, supplemented by examples and by axioms elucidation elucidation has associated axiom(nl) Person:Alan Ruttenberg Person:Alan Ruttenberg An axiom associated with a term expressed using natural language has associated axiom(nl) has associated axiom(nl) has associated axiom(fol) Person:Alan Ruttenberg Person:Alan Ruttenberg An axiom expressed in first order logic using CLIF syntax has associated axiom(fol) has associated axiom(fol) preferred_root term replaced by An alternative term used by the IEDB. IEDB alternative term temporal interpretation An assertion that holds between an OWL Object Property and a temporal interpretation that elucidates how OWL Class Axioms that use this property are to be interpreted in a temporal context. temporal interpretation temporal interpretation https://oborel.github.io/obo-relations/temporal-semantics/ https://code.google.com/p/obo-relations/wiki/ROAndTime https://github.com/oborel/obo-relations/wiki/ROAndTime tooth SubClassOf 'never in taxon' value 'Aves' S never_in_taxon T iff: S SubClassOf in_taxon only not T. x never in taxon T if and only if T is a class, and x does not instantiate the class expression "in taxon some T". Note that this is a shortcut relation, and should be used as a hasValue restriction in OWL. Chris Mungall Chris Mungall ?X DisjointWith RO_0002162 some ?Y Class: <http://www.w3.org/2002/07/owl#Nothing> EquivalentTo: ?X and (RO_0002162 some ?Y) Class: ?X DisjointWith: RO_0002162 some ?Y RO:0002161 uberon never_in_taxon true true never_in_taxon never in taxon never_in_taxon A is mutually_spatially_disjoint_with B if both A and B are classes, and there exists no p such that p is part_of some A and p is part_of some B. non-overlapping with shares no parts with Class: <http://www.w3.org/2002/07/owl#Nothing> EquivalentTo: (BFO_0000050 some ?X) and (BFO_0000050 some ?Y) mutually spatially disjoint with https://github.com/obophenotype/uberon/wiki/Part-disjointness-Design-Pattern S dubious_for_taxon T if it is probably the case that no instances of S can be found in any instance of T. RO:0002174 uberon dubious_for_taxon true true dubious_for_taxon this relation lacks a strong logical interpretation, but can be used in place of never_in_taxon where it is desirable to state that the definition of the class is too strict for the taxon under consideration, but placing a never_in_taxon link would result in a chain of inconsistencies that will take time to resolve. Example: metencephalon in teleost dubious_for_taxon S present_in_taxon T if some instance of T has some S. This does not means that all instances of T have an S - it may only be certain life stages or sexes that have S S present_in_taxon T if some instance of T has some S. This does not means that all instances of T have an S - it may only be certain life stages or sexes that have S. https://orcid.org/0000-0002-6601-2165 RO:0002175 applicable for taxon uberon present_in_taxon true true present_in_taxon present in taxon present in taxon present_in_taxon An assertion that involves at least one OWL object that is intended to be expanded into one or more logical axioms. The logical expansion can yield axioms expressed using any formal logical system, including, but not limited to OWL2-DL. logical macro assertion http://purl.obolibrary.org/obo/ro/docs/shortcut-relations/ A logical macro assertion whose domain is an IRI for a class The domain for this class can be considered to be owl:Class, but we cannot assert this in OWL2-DL logical macro assertion on a class A logical macro assertion whose domain is an IRI for a property logical macro assertion on a property Used to annotate object properties to describe a logical meta-property or characteristic of the object property. logical macro assertion on an object property logical macro assertion on an annotation property relation p is the direct form of relation q iff p is a subPropertyOf q, p does not have the Transitive characteristic, q does have the Transitive characteristic, and for all x, y: x q y -> exists z1, z2, ..., zn such that x p z1 ... z2n y The general property hierarchy is: "directly P" SubPropertyOf "P" Transitive(P) Where we have an annotation assertion "directly P" "is direct form of" "P" If we have the annotation P is-direct-form-of Q, and we have inverses P' and Q', then it follows that P' is-direct-form-of Q' Chris Mungall is direct form of A shortcut relationship that holds between two entities based on their identity criteria logical macro assertion involving identity A shortcut relationship between two entities x and y1, such that the intent is that the relationship is functional and inverse function, but there is no guarantee that this property holds. in approximate one to one relationship with 'anterior end of organism' is-opposite-of 'posterior end of organism' 'increase in temperature' is-opposite-of 'decrease in temperature' x is the opposite of y if there exists some distance metric M, and there exists no z such as M(x,z) <= M(x,y) or M(y,z) <= M(y,x). is opposite of true if the two properties are disjoint, according to OWL semantics. This should only be used if using a logical axiom introduces a non-simple property violation. cjm nominally disjoint with Used to annotate object properties representing a causal relationship where the value indicates a direction. Should be "+", "-" or "0" cjm 2018-03-13T23:59:29Z is directional form of cjm 2018-03-14T00:03:16Z is positive form of cjm 2018-03-14T00:03:24Z is negative form of part-of is homeomorphic for independent continuants. R is homemorphic for C iff (1) there exists some x,y such that x R y, and x and y instantiate C and (2) for all x, if x is an instance of C, and there exists some y some such that x R y, then it follows that y is an instance of C. cjm 2018-10-21T19:46:34Z R homeomorphic-for C expands to: C SubClassOf R only C. Additionally, for any class D that is disjoint with C, we can also expand to C DisjointWith R some D, D DisjointWith R some C. is homeomorphic for An alternate textual definition for a class taken unmodified from an external source. This definition may have been used to derive a generalized definition for the new class. UBPROP:0000001 uberon external_definition true external_definition This annotation property may be replaced with an annotation property from an external ontology such as IAO external_definition A textual description of an axiom loss in this ontology compared to an external ontology. UBPROP:0000002 uberon axiom_lost_from_external_ontology true axiom_lost_from_external_ontology This annotation property may be replaced with an annotation property from an external ontology such as IAO axiom_lost_from_external_ontology Notes on the homology status of this class. UBPROP:0000003 uberon homology_notes true homology_notes This annotation property may be replaced with an annotation property from an external ontology such as IAO homology_notes UBPROP:0000004 uberon provenance_notes true provenance_notes provenance_notes An alternate comment for a class taken unmodified from an external source. Note that obo format only allows a single comment for a class, and does not provide a structured means of adding provenance info. UBPROP:0000005 uberon external_comment true external_comment This annotation property may be replaced with an annotation property from an external ontology such as IAO external_comment UBPROP:0000006 uberon implements_design_pattern true implements_design_pattern implements_design_pattern Used to connect a class to an adjectival form of its label. For example, a class with label 'intestine' may have a relational adjective 'intestinal'. UBPROP:0000007 uberon has_relational_adjective true has_relational_adjective has_relational_adjective Notes on the how instances of this class vary across species. UBPROP:0000008 uberon taxon_notes true taxon_notes taxon_notes Notes on the evolved function of instances of this class. This annotation property may be replaced with an annotation property from an external ontology such as IAO UBPROP:0000009 uberon function_notes true function_notes function_notes Notes on the structure, composition or histology of instances of this class. This annotation property may be replaced with an annotation property from an external ontology such as IAO UBPROP:0000010 uberon structure_notes true structure_notes structure_notes Notes on the ontogenic development of instances of this class. This annotation property may be replaced with an annotation property from an external ontology such as IAO UBPROP:0000011 uberon development_notes true development_notes development_notes Notes on how similar or equivalent classes are represented in other ontologies. This annotation property may be replaced with an annotation property from an external ontology such as IAO UBPROP:0000012 uberon external_ontology_notes true external_ontology_notes external_ontology_notes Notes on how lexical conventions regarding this class, in particular any issues that may arise due to homonyny or synonymy. This annotation property may be replaced with an annotation property from an external ontology such as IAO UBPROP:0000013 uberon terminology_notes true terminology_notes terminology_notes FMA has terms like 'set of X'. In general we do not include set-of terms in uberon, but provide a mapping between the singular form and the FMA set term UBPROP:0000202 uberon fma_set_term true fma_set_term fma_set_term Examples of a Contributor include a person, an organisation, or a service. Typically, the name of a Contributor should be used to indicate the entity. http://purl.org/dc/elements/1.1/contributor uberon dc-contributor true dc-contributor An entity responsible for making contributions to the content of the resource. Contributor Contributor contributor Examples of a Creator include a person, an organisation, or a service. Typically, the name of a Creator should be used to indicate the entity. http://purl.org/dc/elements/1.1/creator uberon dc-creator true dc-creator An entity primarily responsible for making the content of the resource. Creator Creator creator Typically, Date will be associated with the creation or availability of the resource. Recommended best practice for encoding the date value is defined in a profile of ISO 8601 [W3CDTF] and follows the YYYY-MM-DD format. A date associated with an event in the life cycle of the resource. Date Date Description may include but is not limited to: an abstract, table of contents, reference to a graphical representation of content or a free-text account of the content. http://purl.org/dc/elements/1.1/description uberon dc-description true dc-description An account of the content of the resource. Description Description description Typically, Format may include the media-type or dimensions of the resource. Format may be used to determine the software, hardware or other equipment needed to display or operate the resource. Examples of dimensions include size and duration. Recommended best practice is to select a value from a controlled vocabulary (for example, the list of Internet Media Types [MIME] defining computer media formats). The physical or digital manifestation of the resource. Format Format The present resource may be derived from the Source resource in whole or in part. Recommended best practice is to reference the resource by means of a string or number conforming to a formal identification system. A reference to a resource from which the present resource is derived. Source Source Typically, a Subject will be expressed as keywords, key phrases or classification codes that describe a topic of the resource. Recommended best practice is to select a value from a controlled vocabulary or formal classification scheme. The topic of the content of the resource. Subject and Keywords Subject and Keywords Typically, a Title will be a name by which the resource is formally known. http://purl.org/dc/elements/1.1/title uberon dc-title true dc-title A name given to the resource. Title Title title uberon dc-contributor true dc-contributor contributor http://purl.org/dc/terms/license uberon dcterms-license true dcterms-license license consider Author of the class. created_by Date class was created. creation_date ID of merged class. has_alternative_id has_broad_synonym Reference database or publication source. database_cross_reference Exact synonym. has_exact_synonym has exact synonym has_narrow_synonym Name space of the ontology. disease_ontology has_obo_namespace Has related synonym. has_related_synonym An identifier for an individual entity. An identifier is an information content entity that is the outcome of a dubbing process and is used to refer to one instance of entity shared by a group of people to refer to that individual entity. id In subset. in_subset shorthand Comment. comment Is defined by. rdfs:isDefinedBy A human readable name for this class. label label seeAlso http://www.w3.org/2000/01/rdf-schema#seeAlso uberon seeAlso true seeAlso see also OWL deprecated. owl:deprecated A skos concept mapping used to link two concepts, indicating a high degree of confidence that the concepts can be used interchangeably. has exact match http://xmlns.com/foaf/0.1/depicted_by uberon depicted_by true depicted_by depicted by is part of my brain is part of my body (continuant parthood, two material entities) my stomach cavity is part of my stomach (continuant parthood, immaterial entity is part of material entity) this day is part of this year (occurrent parthood) a core relation that holds between a part and its whole Everything is part of itself. Any part of any part of a thing is itself part of that thing. Two distinct things cannot be part of each other. Occurrents are not subject to change and so parthood between occurrents holds for all the times that the part exists. Many continuants are subject to change, so parthood between continuants will only hold at certain times, but this is difficult to specify in OWL. See http://purl.obolibrary.org/obo/ro/docs/temporal-semantics/ Parthood requires the part and the whole to have compatible classes: only an occurrent can be part of an occurrent; only a process can be part of a process; only a continuant can be part of a continuant; only an independent continuant can be part of an independent continuant; only an immaterial entity can be part of an immaterial entity; only a specifically dependent continuant can be part of a specifically dependent continuant; only a generically dependent continuant can be part of a generically dependent continuant. (This list is not exhaustive.) A continuant cannot be part of an occurrent: use 'participates in'. An occurrent cannot be part of a continuant: use 'has participant'. A material entity cannot be part of an immaterial entity: use 'has location'. A specifically dependent continuant cannot be part of an independent continuant: use 'inheres in'. An independent continuant cannot be part of a specifically dependent continuant: use 'bearer of'. part_of BFO:0000050 external quality uberon part_of part_of part of part of part_of http://www.obofoundry.org/ro/#OBO_REL:part_of has part my body has part my brain (continuant parthood, two material entities) my stomach has part my stomach cavity (continuant parthood, material entity has part immaterial entity) this year has part this day (occurrent parthood) a core relation that holds between a whole and its part Everything has itself as a part. Any part of any part of a thing is itself part of that thing. Two distinct things cannot have each other as a part. Occurrents are not subject to change and so parthood between occurrents holds for all the times that the part exists. Many continuants are subject to change, so parthood between continuants will only hold at certain times, but this is difficult to specify in OWL. See http://purl.obolibrary.org/obo/ro/docs/temporal-semantics/ Occurrents are not subject to change and so parthood between occurrents holds for all the times that the part exists. Many continuants are subject to change, so parthood between continuants will only hold at certain times, but this is difficult to specify in OWL. See https://code.google.com/p/obo-relations/wiki/ROAndTime Parthood requires the part and the whole to have compatible classes: only an occurrent have an occurrent as part; only a process can have a process as part; only a continuant can have a continuant as part; only an independent continuant can have an independent continuant as part; only a specifically dependent continuant can have a specifically dependent continuant as part; only a generically dependent continuant can have a generically dependent continuant as part. (This list is not exhaustive.) A continuant cannot have an occurrent as part: use 'participates in'. An occurrent cannot have a continuant as part: use 'has participant'. An immaterial entity cannot have a material entity as part: use 'location of'. An independent continuant cannot have a specifically dependent continuant as part: use 'bearer of'. A specifically dependent continuant cannot have an independent continuant as part: use 'inheres in'. has_part BFO:0000051 external quality uberon has_part has_part has part has part has_part realized in this disease is realized in this disease course this fragility is realized in this shattering this investigator role is realized in this investigation is realized by realized_in [copied from inverse property 'realizes'] to say that b realizes c at t is to assert that there is some material entity d & b is a process which has participant d at t & c is a disposition or role of which d is bearer_of at t& the type instantiated by b is correlated with the type instantiated by c. (axiom label in BFO2 Reference: [059-003]) Paraphrase of elucidation: a relation between a realizable entity and a process, where there is some material entity that is bearer of the realizable entity and participates in the process, and the realizable entity comes to be realized in the course of the process realized in realizes this disease course realizes this disease this investigation realizes this investigator role this shattering realizes this fragility to say that b realizes c at t is to assert that there is some material entity d & b is a process which has participant d at t & c is a disposition or role of which d is bearer_of at t& the type instantiated by b is correlated with the type instantiated by c. (axiom label in BFO2 Reference: [059-003]) Paraphrase of elucidation: a relation between a process and a realizable entity, where there is some material entity that is bearer of the realizable entity and participates in the process, and the realizable entity comes to be realized in the course of the process realizes participates_in preceded by X preceded_by Y iff: end(Y) before_or_simultaneous_with start(X). x is preceded by y if and only if the time point at which y ends is before or equivalent to the time point at which x starts. Formally: x preceded by y iff ω(y) <= α(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. An example is: translation preceded_by transcription; aging preceded_by development (not however death preceded_by aging). Where derives_from links classes of continuants, preceded_by links classes of processes. Clearly, however, these two relations are not independent of each other. Thus if cells of type C1 derive_from cells of type C, then any cell division involving an instance of C1 in a given lineage is preceded_by cellular processes involving an instance of C. The assertion P preceded_by P1 tells us something about Ps in general: that is, it tells us something about what happened earlier, given what we know about what happened later. Thus it does not provide information pointing in the opposite direction, concerning instances of P1 in general; that is, that each is such as to be succeeded by some instance of P. Note that an assertion to the effect that P preceded_by P1 is rather weak; it tells us little about the relations between the underlying instances in virtue of which the preceded_by relation obtains. Typically we will be interested in stronger relations, for example in the relation immediately_preceded_by, or in relations which combine preceded_by with a condition to the effect that the corresponding instances of P and P1 share participants, or that their participants are connected by relations of derivation, or (as a first step along the road to a treatment of causality) that the one process in some way affects (for example, initiates or regulates) the other. is preceded by preceded_by http://www.obofoundry.org/ro/#OBO_REL:preceded_by BFO:0000062 is preceded by takes place after external uberon preceded_by preceded_by preceded by preceded by preceded_by precedes x precedes y if and only if the time point at which x ends is before or equivalent to the time point at which y starts. Formally: x precedes y iff ω(x) <= α(y), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. BFO:0000063 external uberon precedes precedes precedes precedes occurs in b occurs_in c =def b is a process and c is a material entity or immaterial entity& there exists a spatiotemporal region r and b occupies_spatiotemporal_region r.& forall(t) if b exists_at t then c exists_at t & there exist spatial regions s and s’ where & b spatially_projects_onto s at t& c is occupies_spatial_region s’ at t& s is a proper_continuant_part_of s’ at t occurs_in unfolds in unfolds_in BFO:0000066 external occurs_in occurs_in Paraphrase of definition: a relation between a process and an independent continuant, in which the process takes place entirely within the independent continuant occurs in occurs in site of [copied from inverse property 'occurs in'] b occurs_in c =def b is a process and c is a material entity or immaterial entity& there exists a spatiotemporal region r and b occupies_spatiotemporal_region r.& forall(t) if b exists_at t then c exists_at t & there exist spatial regions s and s’ where & b spatially_projects_onto s at t& c is occupies_spatial_region s’ at t& s is a proper_continuant_part_of s’ at t BFO:0000067 uberon contains_process contains_process Paraphrase of definition: a relation between an independent continuant and a process, in which the process takes place entirely within the independent continuant contains process contains process located_in http://www.ebi.ac.uk/efo/has_quality has_quality x anterior_to y iff x is further along the antero-posterior axis than y, towards the head. An antero-posterior axis is an axis that bisects an organism from head end to opposite end of body or tail: bearer. cjm 2009-07-31T02:15:46Z BSPO:0000096 uberon anterior_to anterior_to anterior_to x distal_to y iff x is further along the proximo-distal axis than y, towards the appendage tip. A proximo-distal axis extends from tip of an appendage (distal) to where it joins the body (proximal). BSPO:0000097 uberon distal_to distal_to distal_to x dorsal_to y iff x is further along the dorso-ventral axis than y, towards the back. A dorso-ventral axis is an axis that bisects an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:0000098 uberon dorsal_to dorsal_to dorsal_to x posterior_to y iff x is further along the antero-posterior axis than y, towards the body/tail. An antero-posterior axis is an axis that bisects an organism from head end to opposite end of body or tail. BSPO:0000099 caudal_to uberon posterior_to posterior_to posterior_to x ventral_to y iff x is further along the dorso-ventral axis than y, towards the front. A dorso-ventral axis is an axis that bisects an organism from back (e.g. spinal column) to front (e.g. belly). BSPO:0000102 uberon ventral_to ventral_to ventral_to BSPO:0000107 uberon deep_to deep_to deep_to BSPO:0000108 uberon superficial_to superficial_to superficial_to X in_left_side_of Y <=> if Y is subdivided into left and right portions, X is part_of the left portion. BSPO:0000120 uberon in_left_side_of in_left_side_of in_left_side_of https://github.com/obophenotype/uberon/wiki/Modeling-paired-structures-Design-Pattern X in_right_side_of Y <=> if Y is subdivided into left and right portions, X is part_of the right portion. BSPO:0000121 uberon in_right_side_of in_right_side_of in_right_side_of https://github.com/obophenotype/uberon/wiki/Modeling-paired-structures-Design-Pattern X posterior_side_of Y <=> if Y is subdivided into two anterior and posterior portions, X is part_of the posterior portion. BSPO:0000122 uberon in_posterior_side_of in_posterior_side_of in_posterior_side_of X anterior_side_of Y <=> if Y is subdivided into two anterior and posterior portions, X is part_of the anterior portion. BSPO:0000123 uberon in_anterior_side_of in_anterior_side_of in_anterior_side_of X proximal_side_of Y <=> if Y is subdivided into distal and proximal portions, X is part_of the proximal portion. BSPO:0000124 uberon in_proximal_side_of in_proximal_side_of in_proximal_side_of X distal_side_of Y <=> if Y is subdivided into distal and proximal portions, X is part_of the distal portion. BSPO:0000125 uberon in_distal_side_of in_distal_side_of in_distal_side_of X in_lateral_side_of Y <=> if X is in_left_side_of Y or X is in_right_side_of Y. X is often, but not always a paired structure. BSPO:0000126 uberon in_lateral_side_of in_lateral_side_of in_lateral_side_of https://github.com/obophenotype/uberon/wiki/Modeling-paired-structures-Design-Pattern X proximalmost_part_of Y <=> X is part_of Y and X is adjacent_to the proximal boundary of Y. BSPO:0001106 uberon proximalmost_part_of proximalmost_part_of proximalmost_part_of This relation holds when both the deep_to and ajdacent_to relationship similarly hold. BSPO:0001107 uberon immediately_deep_to immediately_deep_to immediately_deep_to X distalmost_part_of Y <=> X is part_of Y and X is adjacent_to the distal boundary of Y. BSPO:0001108 uberon distalmost_part_of distalmost_part_of distalmost_part_of a 'derives from' object property between an entity (in CLO case, cell line) and a disease in a patient where the entity is derived from some cell in the patient who has the disease. This is a short cut relation that represents: 'derived from' some (cell and ('part of' some 'organism' and ('has disease' some disease))) Yongqun He In most cases, the patient in the relation is used to refer human patient. However, an animal patient (or veterinary patient) can also be referred. derives from patient having disease a disease disposition has been realized by a bearer. Jie Zheng, Yongqun He, Yu Lin, Allen Xiang This is a shortcut relation. It is equivalent to: participates_in some 'disease couse' and realizes some disease has disease an object property that specifies a cell line repository for a specifc cell line. SS, YH, UV, SS is in cell line repository an object property that represents a relation between a cell line cell and a disease. Asiyah Yu Lin, Yongqun He This object property is largely equivalent to the previous term 'is model for' (http://www.ebi.ac.uk/cellline#is_model_for). is disease model for HeLa ICRP cell is transfected to express a Initiator caspase reporter protein (IC-RP) an object property that represents a relation between a cell line cell and a protein where the cell line cell is genetically transfected to stably express a foreign protein in the cell line cell. Oliver He, Asiyah Yu Lin transfected to express a 'cell line cell derives from' object property between an entity (e.g., cell line cell in CLO) and an organism where the cell line cell is derived from some cell from the organism. In CLO, this is a short cut relation that represents: 'derived from' some (cell and ('part of' some organism)) derived from organism a 'derives from' object property between an entity (i.e., cell line cell in CLO) and an anatomic part from an organism where the cell line cell is derived from some cell in the anatomic part (e.g., tissue or organ). The anatomic part is typically defined by UBERON in CLO. in CLO, this is a short cut relation that represents: 'derived from' some (cell and ('part of' some 'anatomic part')) derived from anatomic part derived from cell derived from cell line a 'derived from' object property that specifies the domain of the property is a cell line cell. Oliver He cell line cell derived from a 'cell line cell derives from' object property between a cell line cell and an anatomic part from an organism where the cell line cell is derived from some cell in the tissue. The anatomic part is typically defined by UBERON in CLO. This is a short cut relation that represents: 'derived from' some (cell and ('part of' some 'anatomic part')) Oliver He cell line cell derived from anatomical part a 'cell line cell derives from' object property between a cell line cell and an organism where the cell line cell is derived from some cell from the organism. This is a short cut relation that represents: 'derived from' some (cell and ('part of' some organism)) Oliver He cell line cell derived from organism induced by cell culture reagent BIHi005-A-4 stem cell line cell is derived from BIHi005-A cell by knocking out the gene SORT1 from the BIHi005-A cell. A 'derives from' object property that represents the relation between a cell line cell and a gene where the gene is not present in the cell line cell from a knockout process. Stefanie Seltmann, Oliver He derived from cell with knockout gene Stem cell line cell BIONi010-C-6 is derived from BIONi010-C where gene APOE has been modified from an isogenic modification. A 'derives from' object property that represents the relation between a cell line cell and a gene where the gene is modified in the cell line cell via an isogenic modification process. An isogenic cell line is a cell line that has been engineered from a parental line through the introduction of a targeted gene mutation. Stefanie Seltmann, Oliver He derived from cell with isogenic modification of gene derived from cell with knockin gene derived from cell with transgenic modification GOREL:0002004 external results_in_fission_of results_in_fission_of results_in_fission_of is about This document is about information artifacts and their representations is_about is a (currently) primitive relation that relates an information artifact to an entity. 7/6/2009 Alan Ruttenberg. Following discussion with Jonathan Rees, and introduction of "mentions" relation. Weaken the is_about relationship to be primitive. We will try to build it back up by elaborating the various subproperties that are more precisely defined. Some currently missing phenomena that should be considered "about" are predications - "The only person who knows the answer is sitting beside me" , Allegory, Satire, and other literary forms that can be topical without explicitly mentioning the topic. person:Alan Ruttenberg Smith, Ceusters, Ruttenberg, 2000 years of philosophy is about An information artifact IA mentions an entity E exactly when it has a component/part that denotes E 7/6/2009 Alan Ruttenberg. P4 RC1 munges our GCI so remove it for now: mentions some entity equivalentTo has_part some ('generically denotes' some entity) 7/6/2009 Alan Ruttenberg: Add this relation following conversation with Jonathan Rees that N&S GCI for is_about was too strong. Really it was simply sufficient. To effect this change we introduce this relation, which is subproperty of is_about, and have previous GCI use this relation "mentions" in it's (logical) definition PERSON: Jonathan Rees Person: Alan Ruttenberg mentions has_specified_input see is_input_of example_of_usage A relation between a planned process and a continuant participating in that process that is not created during the process. The presence of the continuant during the process is explicitly specified in the plan specification which the process realizes the concretization of. 8/17/09: specified inputs of one process are not necessarily specified inputs of a larger process that it is part of. This is in contrast to how 'has participant' works. PERSON: Alan Ruttenberg PERSON: Bjoern Peters PERSON: Larry Hunter PERSON: Melanie Coutot has_specified_input is_specified_input_of some Autologous EBV(Epstein-Barr virus)-transformed B-LCL (B lymphocyte cell line) is_input_for instance of Chromum Release Assay described at https://wiki.cbil.upenn.edu/obiwiki/index.php/Chromium_Release_assay A relation between a planned process and a continuant participating in that process that is not created during the process. The presence of the continuant during the process is explicitly specified in the plan specification which the process realizes the concretization of. Alan Ruttenberg PERSON:Bjoern Peters is_specified_input_of has_specified_output A relation between a planned process and a continuant participating in that process. The presence of the continuant at the end of the process is explicitly specified in the objective specification which the process realizes the concretization of. PERSON: Alan Ruttenberg PERSON: Bjoern Peters PERSON: Larry Hunter PERSON: Melanie Courtot has_specified_output is_manufactured_by http://www.affymetrix.com/products/arrays/specific/hgu133.affx is_manufactered_by http://www.affymetrix.com/ (if we decide to use these URIs for the actual entities) c is_manufactured_by o means that there was a process p in which c was built in which a person, or set of people or machines did the work(bore the "Manufacturer Role", and those people/and or machines were members or of directed by the organization to do this. Alan Ruttenberg Liju Fan has_make has_manufacturer is_manufactured_by is_specified_output_of A relation between a planned process and a continuant participating in that process. The presence of the continuant at the end of the process is explicitly specified in the objective specification which the process realizes the concretization of. Alan Ruttenberg PERSON:Bjoern Peters is_specified_output_of achieves_planned_objective A cell sorting process achieves the objective specification 'material separation objective' This relation obtains between a planned process and a objective specification when the criteria specified in the objective specification are met at the end of the planned process. BP, AR, PPPB branch PPPB branch derived modified according to email thread from 1/23/09 in accordince with DT and PPPB branch achieves_planned_objective has grain the relation of the cells in the finger of the skin to the finger, in which an indeterminate number of grains are parts of the whole by virtue of being grains in a collective that is part of the whole, and in which removing one granular part does not nec- essarily damage or diminish the whole. Ontological Whether there is a fixed, or nearly fixed number of parts - e.g. fingers of the hand, chambers of the heart, or wheels of a car - such that there can be a notion of a single one being missing, or whether, by contrast, the number of parts is indeterminate - e.g., cells in the skin of the hand, red cells in blood, or rubber molecules in the tread of the tire of the wheel of the car. Discussion in Karslruhe with, among others, Alan Rector, Stefan Schulz, Marijke Keet, Melanie Courtot, and Alan Ruttenberg. Definition take from the definition of granular parthood in the cited paper. Needs work to put into standard form PERSON: Alan Ruttenberg PAPER: Granularity, scale and collectivity: When size does and does not matter, Alan Rector, Jeremy Rogers, Thomas Bittner, Journal of Biomedical Informatics 39 (2006) 333-349 has grain objective_achieved_by This relation obtains between a a objective specification and a planned process when the criteria specified in the objective specification are met at the end of the planned process. OBI OBI objective_achieved_by inheres in this fragility inheres in this vase this fragility is a characteristic of this vase this red color inheres in this apple this red color is a characteristic of this apple a relation between a specifically dependent continuant (the characteristic) and any other entity (the bearer), in which the characteristic depends on the bearer for its existence. a relation between a specifically dependent continuant (the dependent) and an independent continuant (the bearer), in which the dependent specifically depends on the bearer for its existence A dependent inheres in its bearer at all times for which the dependent exists. inheres_in Note that this relation was previously called "inheres in", but was changed to be called "characteristic of" because BFO2 uses "inheres in" in a more restricted fashion. This relation differs from BFO2:inheres_in in two respects: (1) it does not impose a range constraint, and thus it allows qualities of processes, as well as of information entities, whereas BFO2 restricts inheres_in to only apply to independent continuants (2) it is declared functional, i.e. something can only be a characteristic of one thing. characteristic of inheres in bearer of this apple is bearer of this red color this vase is bearer of this fragility Inverse of characteristic_of a relation between an independent continuant (the bearer) and a specifically dependent continuant (the dependent), in which the dependent specifically depends on the bearer for its existence A bearer can have many dependents, and its dependents can exist for different periods of time, but none of its dependents can exist when the bearer does not exist. bearer_of is bearer of RO:0000053 external uberon bearer_of bearer_of bearer of bearer of has characteristic participates in this blood clot participates in this blood coagulation this input material (or this output material) participates in this process this investigator participates in this investigation a relation between a continuant and a process, in which the continuant is somehow involved in the process participates_in RO:0000056 external uberon participates_in participates_in participates in participates in participates_in has participant this blood coagulation has participant this blood clot this investigation has participant this investigator this process has participant this input material (or this output material) a relation between a process and a continuant, in which the continuant is somehow involved in the process Has_participant is a primitive instance-level relation between a process, a continuant, and a time at which the continuant participates in some way in the process. The relation obtains, for example, when this particular process of oxygen exchange across this particular alveolar membrane has_participant this particular sample of hemoglobin at this particular time. has_participant http://www.obofoundry.org/ro/#OBO_REL:has_participant RO:0000057 external has_participant has_participant has participant has participant concretizes A journal article is an information artifact that inheres in some number of printed journals. For each copy of the printed journal there is some quality that carries the journal article, such as a pattern of ink. The quality (a specifically dependent continuant) concretizes the journal article (a generically dependent continuant), and both depend on that copy of the printed journal (an independent continuant). An investigator reads a protocol and forms a plan to carry out an assay. The plan is a realizable entity (a specifically dependent continuant) that concretizes the protocol (a generically dependent continuant), and both depend on the investigator (an independent continuant). The plan is then realized by the assay (a process). A relationship between a specifically dependent continuant and a generically dependent continuant, in which the generically dependent continuant depends on some independent continuant in virtue of the fact that the specifically dependent continuant also depends on that same independent continuant. Multiple specifically dependent continuants can concretize the same generically dependent continuant. concretizes has function this enzyme has function this catalysis function (more colloquially: this enzyme has this catalysis function) a relation between an independent continuant (the bearer) and a function, in which the function specifically depends on the bearer for its existence A bearer can have many functions, and its functions can exist for different periods of time, but none of its functions can exist when the bearer does not exist. A function need not be realized at all the times that the function exists. has_function has function this apple has quality this red color a relation between an independent continuant (the bearer) and a quality, in which the quality specifically depends on the bearer for its existence A bearer can have many qualities, and its qualities can exist for different periods of time, but none of its qualities can exist when the bearer does not exist. has_quality RO:0000086 uberon has_quality has_quality has quality has quality has role this person has role this investigator role (more colloquially: this person has this role of investigator) a relation between an independent continuant (the bearer) and a role, in which the role specifically depends on the bearer for its existence A bearer can have many roles, and its roles can exist for different periods of time, but none of its roles can exist when the bearer does not exist. A role need not be realized at all the times that the role exists. has_role has role has role derives from this cell derives from this parent cell (cell division) this nucleus derives from this parent nucleus (nuclear division) a relation between two distinct material entities, the new entity and the old entity, in which the new entity begins to exist when the old entity ceases to exist, and the new entity inherits the significant portion of the matter of the old entity This is a very general relation. More specific relations are preferred when applicable, such as 'directly develops from'. derives_from derives from derives_from derives into this parent cell derives into this cell (cell division) this parent nucleus derives into this nucleus (nuclear division) a relation between two distinct material entities, the old entity and the new entity, in which the new entity begins to exist when the old entity ceases to exist, and the new entity inherits the significant portion of the matter of the old entity This is a very general relation. More specific relations are preferred when applicable, such as 'directly develops into'. To avoid making statements about a future that may not come to pass, it is often better to use the backward-looking 'derives from' rather than the forward-looking 'derives into'. derives_into derives into is location of my head is the location of my brain this cage is the location of this rat a relation between two independent continuants, the location and the target, in which the target is entirely within the location Most location relations will only hold at certain times, but this is difficult to specify in OWL. See http://purl.obolibrary.org/obo/ro/docs/temporal-semantics/ location_of RO:0001015 uberon location_of location_of location of location_of located in my brain is located in my head this rat is located in this cage a relation between two independent continuants, the target and the location, in which the target is entirely within the location Location as a relation between instances: The primitive instance-level relation c located_in r at t reflects the fact that each continuant is at any given time associated with exactly one spatial region, namely its exact location. Following we can use this relation to define a further instance-level location relation - not between a continuant and the region which it exactly occupies, but rather between one continuant and another. c is located in c1, in this sense, whenever the spatial region occupied by c is part_of the spatial region occupied by c1. Note that this relation comprehends both the relation of exact location between one continuant and another which obtains when r and r1 are identical (for example, when a portion of fluid exactly fills a cavity), as well as those sorts of inexact location relations which obtain, for example, between brain and head or between ovum and uterus Most location relations will only hold at certain times, but this is difficult to specify in OWL. See http://purl.obolibrary.org/obo/ro/docs/temporal-semantics/ located_in http://www.obofoundry.org/ro/#OBO_REL:located_in RO:0001025 uberon located_in located_in located in located_in my body has 2D boundary the surface of my skin a relation between a material entity and a 2D immaterial entity (the boundary), in which the boundary delimits the material entity A 2D boundary may have holes and gaps, but it must be a single connected entity, not an aggregate of several disconnected parts. Although the boundary is two-dimensional, it exists in three-dimensional space and thus has a 3D shape. David Osumi-Sutherland has boundary has_2D_boundary RO:0002002 uberon has_boundary has_boundary has 2D boundary has boundary David Osumi-Sutherland http://www.ncbi.nlm.nih.gov/pubmed/22402613 RO:0002005 nerve supply uberon innervated_by innervated_by http://code.google.com/p/obo-relations/issues/detail?id=6 innervated_by innervated_by X outer_layer_of Y iff: . X :continuant that bearer_of some PATO:laminar . X part_of Y . exists Z :surface . X has_boundary Z . Z boundary_of Y has_boundary: http://purl.obolibrary.org/obo/RO_0002002 boundary_of: http://purl.obolibrary.org/obo/RO_0002000 David Osumi-Sutherland RO:0002007 external uberon bounding_layer_of bounding_layer_of A relationship that applies between a continuant and its outer, bounding layer. Examples include the relationship between a multicellular organism and its integument, between an animal cell and its plasma membrane, and between a membrane bound organelle and its outer/bounding membrane. A relationship that applies between a continuant and its outer, bounding layer. Examples include the relationship between a multicellular organism and its integument, between an animal cell and its plasma membrane, and between a membrane bound organelle and its outer/bounding membrane. bounding layer of bounding layer of dos 2017-05-24T09:44:33Z A 'has component activity' B if A is A and B are molecular functions (GO_0003674) and A has_component B. has component activity w 'has process component' p if p and w are processes, w 'has part' p and w is such that it can be directly disassembled into into n parts p, p2, p3, ..., pn, where these parts are of similar type. dos 2017-05-24T09:49:21Z has component process A relationship between a process and a barrier, where the process occurs in a region spanning the barrier. For cellular processes the barrier is typically a membrane. Examples include transport across a membrane and membrane depolarization. dos 2017-07-20T17:19:37Z occurs across A 'has effector activity' B if A and B are GO molecular functions (GO_0003674), A 'has component activity' B and B is the effector (output function) of B. Each compound function has only one effector activity. dos 2017-09-22T14:14:36Z This relation is designed for constructing compound molecular functions, typically in combination with one or more regulatory component activity relations. has effector activity David Osumi-Sutherland <= Primitive instance level timing relation between events before or simultaneous with Relation between occurrents, shares start and end boundaries. David Osumi-Sutherland RO:0002082 coincides_with is_equal_to uberon simultaneous_with simultaneous_with t1 simultaneous_with t2 iff:= t1 before_or_simultaneous_with t2 and not (t1 before t2) simultaneous with simultaneous_with David Osumi-Sutherland X ends_after Y iff: end(Y) before_or_simultaneous_with end(X) ends after X immediately_preceded_by Y iff: end(X) simultaneous_with start(Y). David Osumi-Sutherland starts_at_end_of A non-transitive temporal relation in which one process immediately precedes another process, such that there is no interval of time between the two processes[SIO:000251]. RO:0002087 directly preceded by is directly preceded by is immediately preceded by starts_at_end_of external uberon immediately_preceded_by immediately_preceded_by X immediately_preceded_by Y iff: end(X) simultaneous_with start(Y) immediately preceded by immediately_preceded_by David Osumi-Sutherland ends_at_start_of meets RO:0002090 external immediately_precedes immediately_precedes X immediately_precedes_Y iff: end(X) simultaneous_with start(Y) immediately precedes immediately_precedes David Osumi-Sutherland io X starts_during Y iff: (start(Y) before_or_simultaneous_with start(X)) AND (start(X) before_or_simultaneous_with end(Y)) starts during David Osumi-Sutherland d during X happens_during Y iff: (start(Y) before_or_simultaneous_with start(X)) AND (end(X) before_or_simultaneous_with end(Y)) happens during David Osumi-Sutherland o overlaps X ends_during Y iff: ((start(Y) before_or_simultaneous_with end(X)) AND end(X) before_or_simultaneous_with end(Y). ends during Relation between a neuron and an anatomical structure that its soma is part of. David Osumi-Sutherland <http://purl.obolibrary.org/obo/BFO_0000051> some ( <http://purl.obolibrary.org/obo/GO_0043025> and <http://purl.obolibrary.org/obo/BFO_0000050> some ?Y) has soma location Every B cell[CL_0000236] has plasma membrane part some immunoglobulin complex[GO_0019814] Holds between a cell c and a protein complex or protein p if and only if that cell has as part a plasma_membrane[GO:0005886], and that plasma membrane has p as part. Alexander Diehl Chris Mungall Lindsay Cowell <http://purl.obolibrary.org/obo/BFO_0000051> some (<http://purl.obolibrary.org/obo/GO_0005886> and <http://purl.obolibrary.org/obo/BFO_0000051> some ?Y) has plasma membrane part x overlaps y if and only if there exists some z such that x has part z and z part of y BFO_0000051 some (BFO_0000050 some ?Y) http://purl.obolibrary.org/obo/BFO_0000051 some (http://purl.obolibrary.org/obo/BFO_0000050 some ?Y) RO:0002131 external uberon overlaps overlaps overlaps overlaps Relation between a 'neuron projection bundle' and a region in which one or more of its component neuron projections either synapses to targets or receives synaptic input. T innervates some R Expands_to: T has_fasciculating_neuron_projection that synapse_in some R. David Osumi-Sutherland <http://purl.obolibrary.org/obo/RO_0002132> some (<http://purl.obolibrary.org/obo/GO_0043005> that (<http://purl.obolibrary.org/obo/RO_0002131> some (<http://purl.obolibrary.org/obo/GO_0045202> that <http://purl.obolibrary.org/obo/BFO_0000050> some Y?))) RO:0002134 uberon innervates innervates http://code.google.com/p/obo-relations/issues/detail?id=6 innervates innervates X continuous_with Y if and only if X and Y share a fiat boundary. David Osumi-Sutherland connected to The label for this relation was previously connected to. I relabeled this to "continuous with". The standard notion of connectedness does not imply shared boundaries - e.g. Glasgow connected_to Edinburgh via M8; my patella connected_to my femur (via patellar-femoral joint) RO:0002150 uberon continuous_with continuous_with continuous with continuous_with FMA:85972 two individual entities d1 and d2 stand in a shares_ancestor_with relation if and only if there exists some a such that d1 derived_by_descent_from a and d2 derived_by_descent_from a. Consider obsoleting and merging with child relation, 'in homology relationship with' RO:0002158 uberon homologous_to homologous_to VBO calls this homologous_to homologous_to shares ancestor with lactation SubClassOf 'only in taxon' some 'Mammalia' S only_in_taxon T iff: S SubClassOf in_taxon only T. x only in taxon y if and only if x is in taxon y, and there is no other organism z such that y!=z a and x is in taxon z. The original intent was to treat this as a macro that expands to 'in taxon' only ?Y - however, this is not necessary if we instead have supplemental axioms that state that each pair of sibling tax have a disjointness axiom using the 'in taxon' property - e.g. 'in taxon' some Eukaryota DisjointWith 'in taxon' some Eubacteria Chris Mungall RO:0002160 uberon only_in_taxon only_in_taxon only in taxon only_in_taxon x is in taxon y if an only if y is an organism, and the relationship between x and y is one of: part of (reflexive), developmentally preceded by, derives from, secreted by, expressed. Chris Mungall Jennifer Deegan RO:0002162 uberon in_taxon in_taxon Connects a biological entity to its taxon of origin. in taxon A is spatially_disjoint_from B if and only if they have no parts in common There are two ways to encode this as a shortcut relation. The other possibility to use an annotation assertion between two classes, and expand this to a disjointness axiom. Chris Mungall Note that it would be possible to use the relation to label the relationship between a near infinite number of structures - between the rings of saturn and my left earlobe. The intent is that this is used for parsiomoniously for disambiguation purposes - for example, between siblings in a jointly exhaustive pairwise disjointness hierarchy BFO_0000051 exactly 0 (BFO_0000050 some ?Y) spatially disjoint from https://github.com/obophenotype/uberon/wiki/Part-disjointness-Design-Pattern a 'toe distal phalanx bone' that is connected to a 'toe medial phalanx bone' (an interphalangeal joint *connects* these two bones). Binary relationship: x connected_to y if and only if there exists some z such that z connects x and y in a ternary connected_to(x,y,z) relationship. a is connected to b if and only if a and b are discrete structure, and there exists some connecting structure c, such that c connects a and b RO:0002170 uberon connected_to connected_to Connection does not imply overlaps. connected to connected to https://github.com/obophenotype/uberon/wiki/Connectivity-Design-Pattern https://github.com/obophenotype/uberon/wiki/Modeling-articulations-Design-Pattern The M8 connects Glasgow and Edinburgh a 'toe distal phalanx bone' that is connected to a 'toe medial phalanx bone' (an interphalangeal joint *connects* these two bones). Binary relationship: z connects x if and only if there exists some y such that z connects x and y in a ternary connected_to(x,y,z) relationship. c connects a if and only if there exist some b such that a and b are similar parts of the same system, and c connects b, specifically, c connects a with b. When one structure connects two others it unites some aspect of the function or role they play within the system. this is currently used for both structural relationships (such as between a valve and the chamber it connects) and abstract relationships (anatomical lines and the entities they connect) RO:0002176 uberon connects connects connects connects https://github.com/obophenotype/uberon/wiki/Connectivity-Design-Pattern https://github.com/obophenotype/uberon/wiki/Modeling-articulations-Design-Pattern a is attached to part of b if a is attached to b, or a is attached to some p, where p is part of b. attached to part of (anatomical structure to anatomical structure) RO:0002177 uberon attaches_to_part_of attaches_to_part_of attached to part of attaches_to_part_of Relation between an arterial structure and another structure, where the arterial structure acts as a conduit channeling fluid, substance or energy. relation between an artery and the structure is supplies with blood. Individual ontologies should provide their own constraints on this abstract relation. For example, in the realm of anatomy this should hold between an artery and an anatomical structure RO:0002178 arterial supply of uberon supplies supplies source: FMA supplies supplies Relation between an collecting structure and another structure, where the collecting structure acts as a conduit channeling fluid, substance or energy away from the other structure. Individual ontologies should provide their own constraints on this abstract relation. For example, in the realm of anatomy this should hold between a vein and an anatomical structure RO:0002179 drains blood from drains from uberon drains drains source: Wikipedia drains drains w 'has component' p if w 'has part' p and w is such that it can be directly disassembled into into n parts p, p2, p3, ..., pn, where these parts are of similar type. The definition of 'has component' is still under discussion. The challenge is in providing a definition that does not imply transitivity. For use in recording has_part with a cardinality constraint, because OWL does not permit cardinality constraints to be used in combination with transitive object properties. In situations where you would want to say something like 'has part exactly 5 digit, you would instead use has_component exactly 5 digit. RO:0002180 external uberon has_component has_component has component has component x develops from y if and only if either (a) x directly develops from y or (b) there exists some z such that x directly develops from z and z develops from y Chris Mungall David Osumi-Sutherland Melissa Haendel Terry Meehan RO:0002202 uberon develops_from develops_from This is the transitive form of the develops from relation develops from develops_from inverse of develops from Chris Mungall David Osumi-Sutherland Terry Meehan RO:0002203 uberon develops_into develops_into develops into develops_into 'neural crest cell' SubClassOf expresses some 'Wnt1 gene' x expressed in y if and only if there is a gene expression process (GO:0010467) that occurs in y, and one of the following holds: (i) x is a gene, and x is transcribed into a transcript as part of the gene expression process (ii) x is a transcript, and the transcription of x is part of the gene expression process (iii) x is a mature gene product such as a protein, and x was translated or otherwise processes from a transcript that was transcribed as part of this gene expression process Chris Mungall expressed in Candidate definition: x directly_develops from y if and only if there exists some developmental process (GO:0032502) p such that x and y both participate in p, and x is the output of p and y is the input of p, and a substantial portion of the matter of x comes from y, and the start of x is coincident with or after the end of y. Chris Mungall David Osumi-Sutherland has developmental precursor FBbt RO:0002207 uberon directly_develops_from directly_develops_from TODO - add child relations from DOS directly develops from directly_develops_from inverse of directly develops from developmental precursor of directly develops into process(P1) regulates process(P2) iff: P1 results in the initiation or termination of P2 OR affects the frequency of its initiation or termination OR affects the magnitude or rate of output of P2. We use 'regulates' here to specifically imply control. However, many colloquial usages of the term correctly correspond to the weaker relation of 'causally upstream of or within' (aka influences). Consider relabeling to make things more explicit Chris Mungall David Hill Tanya Berardini GO Regulation precludes parthood; the regulatory process may not be within the regulated process. regulates (processual) false RO:0002211 external regulates regulates regulates regulates Process(P1) negatively regulates process(P2) iff: P1 terminates P2, or P1 descreases the the frequency of initiation of P2 or the magnitude or rate of output of P2. Chris Mungall negatively regulates (process to process) RO:0002212 external negatively_regulates negatively_regulates negatively regulates negatively regulates Process(P1) postively regulates process(P2) iff: P1 initiates P2, or P1 increases the the frequency of initiation of P2 or the magnitude or rate of output of P2. Chris Mungall positively regulates (process to process) RO:0002213 external positively_regulates positively_regulates positively regulates positively regulates 'human p53 protein' SubClassOf some ('has prototype' some ('participates in' some 'DNA repair')) heart SubClassOf 'has prototype' some ('participates in' some 'blood circulation') x has prototype y if and only if x is an instance of C and y is a prototypical instance of C. For example, every instance of heart, both normal and abnormal is related by the has prototype relation to some instance of a "canonical" heart, which participates in blood circulation. Experimental. In future there may be a formalization in which this relation is treated as a shortcut to some modal logic axiom. We may decide to obsolete this and adopt a more specific evolutionary relationship (e.g. evolved from) TODO: add homeomorphy axiom This property can be used to make weaker forms of certain relations by chaining an additional property. For example, we may say: retina SubClassOf has_prototype some 'detection of light'. i.e. every retina is related to a prototypical retina instance which is detecting some light. Note that this is very similar to 'capable of', but this relation affords a wider flexibility. E.g. we can make a relation between continuants. Chris Mungall has prototype mechanosensory neuron capable of detection of mechanical stimulus involved in sensory perception (GO:0050974) osteoclast SubClassOf 'capable of' some 'bone resorption' A relation between a material entity (such as a cell) and a process, in which the material entity has the ability to carry out the process. Chris Mungall has function realized in For compatibility with BFO, this relation has a shortcut definition in which the expression "capable of some P" expands to "bearer_of (some realized_by only P)". RO:0002215 external uberon capable_of capable_of capable of capable of c stands in this relationship to p if and only if there exists some p' such that c is capable_of p', and p' is part_of p. Chris Mungall has function in RO:0002216 external uberon capable_of_part_of capable_of_part_of capable of part of capable of part of x surrounded_by y if and only if (1) x is adjacent to y and for every region r that is adjacent to x, r overlaps y (2) the shared boundary between x and y occupies the majority of the outermost boundary of x x surrounded_by y iff: x is adjacent to y and for every region r adjacent to x, r overlaps y. Chris Mungall RO:0002219 uberon surrounded_by surrounded_by surrounded by surrounded_by A caterpillar walking on the surface of a leaf is adjacent_to the leaf, if one of the caterpillar appendages is touching the leaf. In contrast, a butterfly flying close to a flower is not considered adjacent, unless there are any touching parts. The epidermis layer of a vertebrate is adjacent to the dermis. The plasma membrane of a cell is adjacent to the cytoplasm, and also to the cell lumen which the cytoplasm occupies. The skin of the forelimb is adjacent to the skin of the torso if these are considered anatomical subdivisions with a defined border. Otherwise a relation such as continuous_with would be used. x adjacent to y if and only if x and y share a boundary. x adjacent_to y iff: x and y share a boundary. This relation acts as a join point with BSPO Chris Mungall RO:0002220 external uberon adjacent_to adjacent_to adjacent to adjacent to adjacent_to inverse of surrounded by inverse of surrounded_by. Chris Mungall RO:0002221 uberon surrounds surrounds surrounds surrounds Chris Mungall Do not use this relation directly. It is ended as a grouping for relations between occurrents involving the relative timing of their starts and ends. https://docs.google.com/document/d/1kBv1ep_9g3sTR-SD3jqzFqhuwo9TPNF-l-9fUDbO6rM/edit?pli=1 A relation that holds between two occurrents. This is a grouping relation that collects together all the Allen relations. temporally related to Relation between occurrents, shares a start boundary with. inverse of starts with Chris Mungall Allen RO:0002223 uberon starts starts starts starts Every insulin receptor signaling pathway starts with the binding of a ligand to the insulin receptor x starts with y if and only if x has part y and the time point at which x starts is equivalent to the time point at which y starts. Formally: α(y) = α(x) ∧ ω(y) < ω(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. Chris Mungall started by RO:0002224 external uberon starts_with starts_with starts with starts with x develops from part of y if and only if there exists some z such that x develops from z and z is part of y Chris Mungall RO:0002225 uberon develops_from_part_of develops_from_part_of develops from part of develops_from_part_of Relation between occurrents, shares an end boundary with. inverse of ends with Chris Mungall RO:0002229 finishes uberon ends ends ends ends x ends with y if and only if x has part y and the time point at which x ends is equivalent to the time point at which y ends. Formally: α(y) > α(x) ∧ ω(y) = ω(x), where α is a function that maps a process to a start point, and ω is a function that maps a process to an end point. Chris Mungall finished by RO:0002230 external uberon ends_with ends_with ends with ends with x 'has starts location' y if and only if there exists some process z such that x 'starts with' z and z 'occurs in' y Chris Mungall starts with process that occurs in RO:0002231 external has_start_location has_start_location has start location has start location x 'has end location' y if and only if there exists some process z such that x 'ends with' z and z 'occurs in' y Chris Mungall ends with process that occurs in RO:0002232 external has_end_location has_end_location has end location has end location p has input c iff: p is a process, c is a material entity, c is a participant in p, c is present at the start of p, and the state of c is modified during p. Chris Mungall consumes RO:0002233 external has_input has_input has input has input p has output c iff c is a participant in p, c is present at the end of p, and c is not present in the same state at the beginning of p. Chris Mungall produces RO:0002234 external has_output has_output has output has output Mammalian thymus has developmental contribution from some pharyngeal pouch 3; Mammalian thymus has developmental contribution from some pharyngeal pouch 4 [Kardong] x has developmental contribution from y iff x has some part z such that z develops from y Chris Mungall RO:0002254 uberon has_developmental_contribution_from has_developmental_contribution_from has developmental contribution from has developmental contribution from inverse of has developmental contribution from Chris Mungall RO:0002255 uberon developmentally_contributes_to developmentally_contributes_to developmentally contributes to developmentally_contributes_to t1 developmentally_induced_by t2 if there is a process of organ induction (GO:0001759) with t1 and t2 as interacting participants. t2 causes t1 to change its fate from a precursor tissue type T to T', where T' develops_from T. t1 induced_by t2 if there is a process of developmental induction (GO:0031128) with t1 and t2 as interacting participants. t2 causes t1 to change its fate from a precursor anatomical structure type T to T', where T' develops_from T Chris Mungall David Osumi-Sutherland Melissa Haendel induced by Developmental Biology, Gilbert, 8th edition, figure 6.5(F) GO:0001759 We place this under 'developmentally preceded by'. This placement should be examined in the context of reciprocal inductions[cjm] RO:0002256 uberon developmentally_induced_by developmentally_induced_by sources for developmentally_induced_by relationships in Uberon: Developmental Biology, Gilbert, 8th edition, figure 6.5(F) developmentally induced by developmentally_induced_by Inverse of developmentally induced by Chris Mungall developmentally induces Candidate definition: x developmentally related to y if and only if there exists some developmental process (GO:0032502) p such that x and y both participates in p, and x is the output of p and y is the input of p false Chris Mungall In general you should not use this relation to make assertions - use one of the more specific relations below this one RO:0002258 uberon developmentally_preceded_by developmentally_preceded_by This relation groups together various other developmental relations. It is fairly generic, encompassing induction, developmental contribution and direct and transitive develops from developmentally preceded by developmentally preceded by x developmentally replaces y if and only if there is some developmental process that causes x to move or to cease to exist, and for the site that was occupied by x to become occupied by y, where y either comes into existence in this site or moves to this site from somewhere else This relation is intended for cases such as when we have a bone element replacing its cartilage element precursor. Currently most AOs represent this using 'develops from'. We need to decide whether 'develops from' will be generic and encompass replacement, or whether we need a new name for a generic relation that encompasses replacement and development-via-cell-lineage Chris Mungall replaces RO:0002285 uberon developmentally_replaces developmentally_replaces developmentally replaces developmentally_replaces Inverse of developmentally preceded by Chris Mungall developmentally succeeded by Inverse of 'expressed in' Chris Mungall expresses p results in the developmental progression of s iff p is a developmental process and s is an anatomical structure and p causes s to undergo a change in state at some point along its natural developmental cycle (this cycle starts with its formation, through the mature structure, and ends with its loss). This property and its subproperties are being used primarily for the definition of GO developmental processes. The property hierarchy mirrors the core GO hierarchy. In future we may be able to make do with a more minimal set of properties, but due to the way GO is currently structured we require highly specific relations to avoid incorrect entailments. To avoid this, the corresponding genus terms in GO should be declared mutually disjoint. Chris Mungall RO:0002295 external results_in_developmental_progression_of results_in_developmental_progression_of results in developmental progression of results in developmental progression of every flower development (GO:0009908) results in development of some flower (PO:0009046) p 'results in development of' c if and only if p is a developmental process and p results in the state of c changing from its initial state as a primordium or anlage through its mature state and to its final state. Chris Mungall http://www.geneontology.org/GO.doc.development.shtml RO:0002296 external results_in_development_of results_in_development_of results in development of results in development of an annotation of gene X to anatomical structure formation with results_in_formation_of UBERON:0000007 (pituitary gland) means that at the beginning of the process a pituitary gland does not exist and at the end of the process a pituitary gland exists. every "endocardial cushion formation" (GO:0003272) results_in_formation_of some "endocardial cushion" (UBERON:0002062) Chris Mungall GOC:mtg_berkeley_2013 RO:0002297 external results_in_formation_of results_in_formation_of results in formation of results in formation of an annotation of gene X to cell morphogenesis with results_in_morphogenesis_of CL:0000540 (neuron) means that at the end of the process an input neuron has attained its shape. tongue morphogenesis (GO:0043587) results in morphogenesis of tongue (UBERON:0001723) The relationship that links an entity with the process that results in the formation and shaping of that entity over time from an immature to a mature state. Chris Mungall GOC:mtg_berkeley_2013 RO:0002298 external results_in_morphogenesis_of results_in_morphogenesis_of results in morphogenesis of results in morphogenesis of cjm RO:0002304 external causally_upstream_of,_positive_effect causally_upstream_of,_positive_effect holds between x and y if and only if x is causally upstream of y and the progression of x increases the frequency, rate or extent of y causally upstream of, positive effect cjm RO:0002305 external causally_upstream_of,_negative_effect causally_upstream_of,_negative_effect holds between x and y if and only if x is causally upstream of y and the progression of x decreases the frequency, rate or extent of y causally upstream of, negative effect Holds between p and c when p is a localization process (localization covers maintenance of localization as well as its establishment) and the outcome of this process is to regulate the localization of c. Chris Mungall regulates localization of RO:0002313 external transports_or_maintains_localization_of transports_or_maintains_localization_of transports or maintains localization of transports or maintains localization of q characteristic of part of w if and only if there exists some p such that q inheres in p and p part of w. Because part_of is transitive, inheres in is a sub-relation of characteristic of part of Chris Mungall inheres in part of characteristic of part of an annotation of gene X to cell differentiation with results_in_maturation_of CL:0000057 (fibroblast) means that at the end of the process the input cell that did not have features of a fibroblast, now has the features of a fibroblast. The relationship that links a specified entity with the process that results in an unspecified entity acquiring the features and characteristics of the specified entity Chris Mungall GOC:mtg_berkeley_2013 RO:0002315 external results_in_acquisition_of_features_of results_in_acquisition_of_features_of results in acquisition of features of results in acquisition of features of A relationship that holds via some environmental process Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, all involving the process of evolution. evolutionarily related to A mereological relationship or a topological relationship Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, all involving parthood or connectivity relationships mereotopologically related to A relationship that holds between entities participating in some developmental process (GO:0032502) Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, all involving organismal development developmentally related to A grouping relationship for any relationship directly involving a function, or that holds because of a function of one of the related entities. Chris Mungall This is a grouping relation that collects relations used for the purpose of connecting structure and function RO:0002328 uberon functionally_related_to functionally_related_to functionally related to functionally related to holds between two entities when some genome-level process such as gene expression is involved. This includes transcriptional, spliceosomal events. These relations can be used between either macromolecule entities (such as regions of nucleic acid) or between their abstract informational counterparts. Chris Mungall Do not use this relation directly. It is intended as a grouping for a diverse set of relations, all involving the genome of an organism genomically related to inverse of regulates Chris Mungall regulated by (processual) RO:0002334 external regulated_by regulated_by regulated by regulated by inverse of negatively regulates Chris Mungall RO:0002335 external negatively_regulated_by negatively_regulated_by negatively regulated by negatively regulated by inverse of positively regulates Chris Mungall RO:0002336 external positively_regulated_by positively_regulated_by positively regulated by positively regulated by A relationship that holds via some process of localization Chris Mungall Do not use this relation directly. It is a grouping relation. related via localization to This relationship holds between p and l when p is a transport or localization process in which the outcome is to move some cargo c from some initial location l to some destination. Chris Mungall RO:0002338 external has_target_start_location has_target_start_location has target start location has target start location This relationship holds between p and l when p is a transport or localization process in which the outcome is to move some cargo c from a an initial location to some destination l. Chris Mungall RO:0002339 external has_target_end_location has_target_end_location has target end location has target end location Holds between p and l when p is a transportation or localization process and the outcome of this process is to move c from one location to another, and the route taken by c follows a path that is aligned_with l Chris Mungall RO:0002341 external results_in_transport_along results_in_transport_along results in transport along results in transport along Holds between p and m when p is a transportation or localization process and the outcome of this process is to move c from one location to another, and the route taken by c follows a path that crosses m. Chris Mungall RO:0002342 external results_in_transport_across results_in_transport_across results in transport across results in transport across 'mitochondrial transport' results_in_transport_to_from_or_in some mitochondrion (GO:0005739) Chris Mungall RO:0002344 external results_in_transport_to_from_or_in results_in_transport_to_from_or_in results in transport to from or in results in transport to from or in has member is a mereological relation between a collection and an item. SIO RO:0002351 uberon has_member has_member has member has member inverse of has input Chris Mungall RO:0002352 uberon input_of input_of input of input of inverse of has output Chris Mungall RO:0002353 external uberon output_of output_of output of output of Chris Mungall formed as result of a is attached to b if and only if a and b are discrete objects or object parts, and there are physical connections between a and b such that a force pulling a will move b, or a force pulling b will move a Chris Mungall attached to (anatomical structure to anatomical structure) RO:0002371 uberon attaches_to attaches_to attached to attaches_to A relationship that holds between two material entities in a system of connected structures, where the branching relationship holds based on properties of the connecting network. Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, all involving branching relationships This relation can be used for geographic features (e.g. rivers) as well as anatomical structures (plant branches and roots, leaf veins, animal veins, arteries, nerves) in branching relationship with https://github.com/obophenotype/uberon/issues/170 In the tree T depicted in https://oborel.github.io/obo-relations/branching_part_of.png, B1 is a (direct) branching part of T. B1-1, B1-2, and B1-3 are also branching parts of T, but these are considered indirect branching parts as they do not directly connect to the main stem S x is a branching part of y if and only if x is part of y and x is connected directly or indirectly to the main stem of y we need to check if FMA branch_of implies part_of. the relation we intend to use here should - for example, see vestibulocochlear nerve Chris Mungall RO:0002380 uberon branching_part_of branching_part_of branching part of branching_part_of FMA:85994 x has developmental potential involving y iff x is capable of a developmental process with output y. y may be the successor of x, or may be a different structure in the vicinity (as for example in the case of developmental induction). Chris Mungall has developmental potential involving x has potential to developmentrally contribute to y iff x developmentally contributes to y or x is capable of developmentally contributing to y x has potential to developmentrally contribute to y iff x developmentally contributes to y or x is capable of developmentally contributing to y. Chris Mungall RO:0002385 uberon has_potential_to_developmentally_contribute_to has_potential_to_developmentally_contribute_to has potential to developmentally contribute to has potential to developmentally contribute to x has potential to developmentally induce y iff x developmentally induces y or x is capable of developmentally inducing y Chris Mungall has potential to developmentally induce x has the potential to develop into y iff x develops into y or if x is capable of developing into y x has the potential to develop into y iff x develops into y or if x is capable of developing into y. Chris Mungall RO:0002387 uberon has_potential_to_develop_into has_potential_to_develop_into has potential to develop into has potential to develop into x has potential to directly develop into y iff x directly develops into y or x is capable of directly developing into y x has potential to directly develop into y iff x directly develops into y or x is capable of directly developing into y. Chris Mungall RO:0002388 uberon has_potential_to_directly_develop_into has_potential_to_directly_develop_into has potential to directly develop into has potential to directly develop into This relation groups causal relations between material entities and causal relations between processes This branch of the ontology deals with causal relations between entities. It is divided into two branches: causal relations between occurrents/processes, and causal relations between material entities. We take an 'activity flow-centric approach', with the former as primary, and define causal relations between material entities in terms of causal relations between occurrents. To define causal relations in an activity-flow type network, we make use of 3 primitives: * Temporal: how do the intervals of the two occurrents relate? * Is the causal relation regulatory? * Is the influence positive or negative The first of these can be formalized in terms of the Allen Interval Algebra. Informally, the 3 bins we care about are 'direct', 'indirect' or overlapping. Note that all causal relations should be classified under a RO temporal relation (see the branch under 'temporally related to'). Note that all causal relations are temporal, but not all temporal relations are causal. Two occurrents can be related in time without being causally connected. We take causal influence to be primitive, elucidated as being such that has the upstream changed, some qualities of the donwstream would necessarily be modified. For the second, we consider a relationship to be regulatory if the system in which the activities occur is capable of altering the relationship to achieve some objective. This could include changing the rate of production of a molecule. For the third, we consider the effect of the upstream process on the output(s) of the downstream process. If the level of output is increased, or the rate of production of the output is increased, then the direction is increased. Direction can be positive, negative or neutral or capable of either direction. Two positives in succession yield a positive, two negatives in succession yield a positive, otherwise the default assumption is that the net effect is canceled and the influence is neutral. Each of these 3 primitives can be composed to yield a cross-product of different relation types. Chris Mungall Do not use this relation directly. It is intended as a grouping for a diverse set of relations, all involving cause and effect. causally related to p is causally upstream of q if and only if p precedes q and p and q are linked in a causal chain Chris Mungall RO:0002411 external causally_upstream_of causally_upstream_of causally upstream of causally upstream of p is immediately causally upstream of q iff both (a) p immediately precedes q and (b) p is causally upstream of q. In addition, the output of p must be an input of q. Chris Mungall RO:0002412 external immediately_causally_upstream_of immediately_causally_upstream_of immediately causally upstream of immediately causally upstream of p 'causally upstream or within' q iff (1) the end of p is before the end of q and (2) the execution of p exerts some causal influence over the outputs of q; i.e. if p was abolished or the outputs of p were to be modified, this would necessarily affect q. We would like to make this disjoint with 'preceded by', but this is prohibited in OWL2 Chris Mungall influences (processual) RO:0002418 external affects causally_upstream_of_or_within causally_upstream_of_or_within causally upstream of or within inverse of causally upstream of or within Chris Mungall RO:0002427 external causally_downstream_of_or_within causally_downstream_of_or_within causally downstream of or within p contributes to morphology of w if and only if a change in the morphology of p entails a change in the morphology of w. Examples: every skull contributes to morphology of the head which it is a part of. Counter-example: nuclei do not generally contribute to the morphology of the cell they are part of, as they are buffered by cytoplasm. Chris Mungall RO:0002433 uberon contributes_to_morphology_of contributes_to_morphology_of contributes to morphology of 'otolith organ' SubClassOf 'composed primarily of' some 'calcium carbonate' x composed_primarily_of y if and only if more than half of the mass of x is made from y or units of the same type as y. x composed_primarily_of y iff: more than half of the mass of x is made from parts of y. Chris Mungall RO:0002473 uberon composed_primarily_of composed_primarily_of composed primarily of p has part that occurs in c if and only if there exists some p1, such that p has_part p1, and p1 occurs in c. Chris Mungall has part that occurs in Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, typically connecting an anatomical entity to a biological process or developmental stage. relation between physical entity and a process or stage Relation between continuant c and occurrent s, such that every instance of c comes into existing during some s. x existence starts during y if and only if the time point at which x starts is after or equivalent to the time point at which y starts and before or equivalent to the time point at which y ends. Formally: x existence starts during y iff α(x) >= α(y) & α(x) <= ω(y). Chris Mungall RO:0002488 begins_to_exist_during uberon existence_starts_during existence_starts_during existence starts during Relation between continuant and occurrent, such that c comes into existence at the start of p. x starts ends with y if and only if the time point at which x starts is equivalent to the time point at which y starts. Formally: x existence starts with y iff α(x) = α(y). Chris Mungall RO:0002489 uberon existence_starts_with existence_starts_with existence starts with x existence overlaps y if and only if either (a) the start of x is part of y or (b) the end of x is part of y. Formally: x existence starts and ends during y iff (α(x) >= α(y) & α(x) <= ω(y)) OR (ω(x) <= ω(y) & ω(x) >= α(y)) Chris Mungall The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence overlaps x exists during y if and only if: 1) the time point at which x begins to exist is after or equal to the time point at which y begins and 2) the time point at which x ceases to exist is before or equal to the point at which y ends. Formally: x existence starts and ends during y iff α(x) >= α(y) & α(x) <= ω(y) & ω(x) <= ω(y) & ω(x) >= α(y) Chris Mungall RO:0002491 exists during uberon existence_starts_and_ends_during existence_starts_and_ends_during The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence starts and ends during Relation between continuant c and occurrent s, such that every instance of c ceases to exist during some s, if it does not die prematurely. x existence ends during y if and only if the time point at which x ends is before or equivalent to the time point at which y ends and after or equivalent to the point at which y starts. Formally: x existence ends during y iff ω(x) <= ω(y) and ω(x) >= α(y). Chris Mungall RO:0002492 ceases_to_exist_during uberon existence_ends_during existence_ends_during The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends during Relation between continuant and occurrent, such that c ceases to exist at the end of p. x existence ends with y if and only if the time point at which x ends is equivalent to the time point at which y ends. Formally: x existence ends with y iff ω(x) = ω(y). Chris Mungall RO:0002493 uberon existence_ends_with existence_ends_with The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends with x transformation of y if x is the immediate transformation of y, or is linked to y through a chain of transformation relationships Chris Mungall RO:0002494 transforms from uberon transformation_of transformation_of transformation of x immediate transformation of y iff x immediately succeeds y temporally at a time boundary t, and all of the matter present in x at t is present in y at t, and all the matter in y at t is present in x at t Chris Mungall RO:0002495 direct_transformation_of immediately transforms from uberon immediate_transformation_of immediate_transformation_of immediate transformation of x existence starts during or after y if and only if the time point at which x starts is after or equivalent to the time point at which y starts. Formally: x existence starts during or after y iff α (x) >= α (y). Chris Mungall RO:0002496 uberon existence_starts_during_or_after existence_starts_during_or_after The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence starts during or after x existence ends during or before y if and only if the time point at which x ends is before or equivalent to the time point at which y ends. Chris Mungall RO:0002497 uberon existence_ends_during_or_before existence_ends_during_or_before The relations here were created based on work originally by Fabian Neuhaus and David Osumi-Sutherland. The work has not yet been vetted and errors in definitions may have occurred during transcription. existence ends during or before A relationship between a material entity and a process where the material entity has some causal role that influences the process causal agent in process p is causally related to q if and only if p or any part of p and q or any part of q are linked by a chain of events where each event pair is one of direct activation or direct inhibition. p may be upstream, downstream, part of or a container of q. Chris Mungall Do not use this relation directly. It is intended as a grouping for a diverse set of relations, all involving cause and effect. causal relation between processes Chris Mungall depends on Forelimb SubClassOf has_skeleton some 'Forelimb skeleton' A relation between a segment or subdivision of an organism and the maximal subdivision of material entities that provides structural support for that segment or subdivision. A relation between a subdivision of an organism and the single subdivision of skeleton that provides structural support for that subdivision. Chris Mungall has supporting framework The skeleton of a structure may be a true skeleton (for example, the bony skeleton of a hand) or any kind of support framework (the hydrostatic skeleton of a sea star, the exoskeleton of an insect, the cytoskeleton of a cell). RO:0002551 uberon has sekeletal support has supporting framework has_skeleton has_skeleton has skeleton Holds between p and c when p is locomotion process and the outcome of this process is the change of location of c Chris Mungall RO:0002565 external results_in_movement_of results_in_movement_of results in movement of A relation that holds between elements of a musculoskeletal system or its analogs. Chris Mungall Do not use this relation directly. It is ended as a grouping for a diverse set of relations, all involving the biomechanical processes. biomechanically related to inverse of branching part of Chris Mungall RO:0002569 uberon has_branching_part has_branching_part has branching part x lumen_of y iff x is the space or substance that is part of y and does not cross any of the inner membranes or boundaries of y that is maximal with respect to the volume of the convex hull. Chris Mungall GOC:cjm RO:0002571 uberon lumen_of lumen_of lumen of s is luminal space of x iff s is lumen_of x and s is an immaterial entity Chris Mungall RO:0002572 uberon luminal_space_of luminal_space_of luminal space of inverse of has skeleton Chris Mungall RO:0002576 uberon skeleton_of skeleton_of skeleton of Process(P1) directly regulates process(P2) iff: P1 regulates P2 via direct physical interaction between an agent executing P1 (or some part of P1) and an agent executing P2 (or some part of P2). For example, if protein A has protein binding activity(P1) that targets protein B and this binding regulates the kinase activity (P2) of protein B then P1 directly regulates P2. Chris Mungall directly regulates (processual) directly regulates p results in breakdown of c if and only if the execution of p leads to c no longer being present at the end of p results in breakdown of RO:0002588 external results_in_assembly_of results_in_assembly_of results in assembly of results_in_assembly_of RO:0002590 external results_in_disassembly_of results_in_disassembly_of results in disassembly of results_in_disassembly_of p results in organization of c iff p results in the assembly, arrangement of constituent parts, or disassembly of c RO:0002592 external results_in_organization_of results_in_organization_of results in organization of A relationship that holds between a material entity and a process in which causality is involved, with either the material entity or some part of the material entity exerting some influence over the process, or the process influencing some aspect of the material entity. Do not use this relation directly. It is intended as a grouping for a diverse set of relations, all involving cause and effect. Chris Mungall causal relation between material entity and a process Inverse of 'causal agent in process' RO:0002608 external process_has_causal_agent process_has_causal_agent process has causal agent a produces b if some process that occurs_in a has_output b, where a and b are material entities. Examples: hybridoma cell line produces monoclonal antibody reagent; chondroblast produces avascular GAG-rich matrix. Melissa Haendel RO:0003000 external uberon produces produces Note that this definition doesn't quite distinguish the output of a transformation process from a production process, which is related to the identity/granularity issue. produces produces a produced_by b iff some process that occurs_in b has_output a. Melissa Haendel RO:0003001 external uberon produced_by produced_by produced by produced by produced_by p 'has primary input ot output' c iff either (a) p 'has primary input' c or (b) p 'has primary output' c. cjm 2018-12-13T11:26:17Z RO:0004007 external has_primary_input_or_output has_primary_input_or_output has primary input or output p has primary output c if (a) p has output c and (b) the goal of process is to modify, produce, or transform c. cjm 2018-12-13T11:26:32Z RO:0004008 external has_primary_output has_primary_output has primary output p has primary input c if (a) p has input c and (b) the goal of process is to modify, consume, or transform c. cjm 2018-12-13T11:26:56Z RO:0004009 external has_primary_input has_primary_input has primary input cjm 2018-03-13T23:55:05Z causally upstream of or within, negative effect cjm 2018-03-13T23:55:19Z causally upstream of or within, positive effect p acts on population of c iff c' is a collection, has members of type c, and p has participant c pg 2020-06-08T17:21:33Z RO:0012003 external acts_on_population_of acts_on_population_of acts on population of acts on population of pg 2021-02-26T07:28:29Z RO:0012008 external results_in_fusion_of results_in_fusion_of results in fusion of results in fusion of q1 different_in_magnitude_relative_to q2 if and only if magnitude(q1) NOT =~ magnitude(q2). Here, magnitude(q) is a function that maps a quality to a unit-invariant scale. different in magnitude relative to q1 increased_in_magnitude_relative_to q2 if and only if magnitude(q1) > magnitude(q2). Here, magnitude(q) is a function that maps a quality to a unit-invariant scale. This relation is used to determine the 'directionality' of relative qualities such as 'increased strength', relative to the parent type, 'strength'. increased in magnitude relative to q1 decreased_in_magnitude_relative_to q2 if and only if magnitude(q1) < magnitude(q2). Here, magnitude(q) is a function that maps a quality to a unit-invariant scale. This relation is used to determine the 'directionality' of relative qualities such as 'decreased strength', relative to the parent type, 'strength'. decreased in magnitude relative to has relative magnitude s3 has_cross_section s3 if and only if : there exists some 2d plane that intersects the bearer of s3, and the impression of s3 upon that plane has shape quality s2. Example: a spherical object has the quality of being spherical, and the spherical quality has_cross_section round. has cross section p has anatomical participant c iff p has participant c, and c is an anatomical entity cjm 2018-09-26T01:08:58Z results in changes to anatomical or cellular structure Relation between biological objects that resemble or are related to each other sufficiently to warrant a comparison. TODO: Add homeomorphy axiom ECO:0000041 SO:similar_to sameness similar to correspondence resemblance in similarity relationship with has_completed A relation between a cell and molecule or complex such that every instance of the cell has a high number of instances of that molecule expressed on the cell surface. For the formal definition, see Masci et al (PMID:19243617). has_high_plasma_membrane_amount A relation between a cell and molecule or complex such that every instance of the cell has a low number of instances of that molecule expressed on the cell surface. For the formal definition, see Masci et al (PMID:19243617). has_low_plasma_membrane_amount has_not_completed http://purl.obolibrary.org/obo/BFO_0000051 exactly 0 ?Y lacks_part http://purl.obolibrary.org/obo/BFO_0000051 exactly 0 (http://purl.obolibrary.org/obo/GO_0005886 and http://purl.obolibrary.org/obo/BFO_0000051 some ?Y) lacks_plasma_membrane_part carries uberon channel_for channel for uberon channels_from channels_from uberon channels_into channels_into x is a conduit for y iff y passes through the lumen of x. uberon conduit_for conduit for uberon extends_fibers_into extends_fibers_into Relationship between a fluid and a material entity, where the fluid is the output of a realization of a filtration role that inheres in the material entity. uberon filtered_through Relationship between a fluid and a filtration barrier, where the portion of fluid arises as a transformation of another portion of fluid on the other side of the barrier, with larger particles removed filtered through uberon protects protects x proximally_connected_to y iff the proximal part of x is connected to y. i.e. x connected_to y and x distal_to y. uberon proximally_connected_to proximally connected to uberon sexually_homologous_to sexually_homologous_to c site_of p if c is the bearer of a disposition that is realized by a process that has p as part. uberon capable_of_has_part site_of site_of uberon subdivision_of placeholder relation. X = 'subdivision of A' and subdivision_of some B means that X is the mereological sum of A and B subdivision of Relation between an anatomical structure (including cells) and a neuron that chemically synapses to it. uberon synapsed_by synapsed by uberon transitively_connected_to transitively_connected to . uberon transitively_proximally_connected_to transitively proximally connected to a relation that indicates a cell line cell is a model for studying a disease. Domain: a cell line cell Range: a disease. is model for has_disease_location contained_in entity Entity entity Julius Caesar Verdi’s Requiem the Second World War your body mass index BFO 2 Reference: In all areas of empirical inquiry we encounter general terms of two sorts. First are general terms which refer to universals or types:animaltuberculosissurgical procedurediseaseSecond, are general terms used to refer to groups of entities which instantiate a given universal but do not correspond to the extension of any subuniversal of that universal because there is nothing intrinsic to the entities in question by virtue of which they – and only they – are counted as belonging to the given group. Examples are: animal purchased by the Emperortuberculosis diagnosed on a Wednesdaysurgical procedure performed on a patient from Stockholmperson identified as candidate for clinical trial #2056-555person who is signatory of Form 656-PPVpainting by Leonardo da VinciSuch terms, which represent what are called ‘specializations’ in [81 Entity doesn't have a closure axiom because the subclasses don't necessarily exhaust all possibilites. For example Werner Ceusters 'portions of reality' include 4 sorts, entities (as BFO construes them), universals, configurations, and relations. It is an open question as to whether entities as construed in BFO will at some point also include these other portions of reality. See, for example, 'How to track absolutely everything' at http://www.referent-tracking.com/_RTU/papers/CeustersICbookRevised.pdf An entity is anything that exists or has existed or will exist. (axiom label in BFO2 Reference: [001-001]) entity continuant Continuant continuant An entity that exists in full at any time in which it exists at all, persists through time while maintaining its identity and has no temporal parts. BFO 2 Reference: Continuant entities are entities which can be sliced to yield parts only along the spatial dimension, yielding for example the parts of your table which we call its legs, its top, its nails. ‘My desk stretches from the window to the door. It has spatial parts, and can be sliced (in space) in two. With respect to time, however, a thing is a continuant.’ [60, p. 240 Continuant doesn't have a closure axiom because the subclasses don't necessarily exhaust all possibilites. For example, in an expansion involving bringing in some of Ceuster's other portions of reality, questions are raised as to whether universals are continuants A continuant is an entity that persists, endures, or continues to exist through time while maintaining its identity. (axiom label in BFO2 Reference: [008-002]) if b is a continuant and if, for some t, c has_continuant_part b at t, then c is a continuant. (axiom label in BFO2 Reference: [126-001]) if b is a continuant and if, for some t, cis continuant_part of b at t, then c is a continuant. (axiom label in BFO2 Reference: [009-002]) if b is a material entity, then there is some temporal interval (referred to below as a one-dimensional temporal region) during which b exists. (axiom label in BFO2 Reference: [011-002]) (forall (x y) (if (and (Continuant x) (exists (t) (continuantPartOfAt y x t))) (Continuant y))) // axiom label in BFO2 CLIF: [009-002] (forall (x y) (if (and (Continuant x) (exists (t) (hasContinuantPartOfAt y x t))) (Continuant y))) // axiom label in BFO2 CLIF: [126-001] (forall (x) (if (Continuant x) (Entity x))) // axiom label in BFO2 CLIF: [008-002] (forall (x) (if (Material Entity x) (exists (t) (and (TemporalRegion t) (existsAt x t))))) // axiom label in BFO2 CLIF: [011-002] continuant occurrent Occurrent occurrent An entity that has temporal parts and that happens, unfolds or develops through time. BFO 2 Reference: every occurrent that is not a temporal or spatiotemporal region is s-dependent on some independent continuant that is not a spatial region BFO 2 Reference: s-dependence obtains between every process and its participants in the sense that, as a matter of necessity, this process could not have existed unless these or those participants existed also. A process may have a succession of participants at different phases of its unfolding. Thus there may be different players on the field at different times during the course of a football game; but the process which is the entire game s-depends_on all of these players nonetheless. Some temporal parts of this process will s-depend_on on only some of the players. Occurrent doesn't have a closure axiom because the subclasses don't necessarily exhaust all possibilites. An example would be the sum of a process and the process boundary of another process. Simons uses different terminology for relations of occurrents to regions: Denote the spatio-temporal location of a given occurrent e by 'spn[e]' and call this region its span. We may say an occurrent is at its span, in any larger region, and covers any smaller region. Now suppose we have fixed a frame of reference so that we can speak not merely of spatio-temporal but also of spatial regions (places) and temporal regions (times). The spread of an occurrent, (relative to a frame of reference) is the space it exactly occupies, and its spell is likewise the time it exactly occupies. We write 'spr[e]' and `spl[e]' respectively for the spread and spell of e, omitting mention of the frame. An occurrent is an entity that unfolds itself in time or it is the instantaneous boundary of such an entity (for example a beginning or an ending) or it is a temporal or spatiotemporal region which such an entity occupies_temporal_region or occupies_spatiotemporal_region. (axiom label in BFO2 Reference: [077-002]) Every occurrent occupies_spatiotemporal_region some spatiotemporal region. (axiom label in BFO2 Reference: [108-001]) b is an occurrent entity iff b is an entity that has temporal parts. (axiom label in BFO2 Reference: [079-001]) (forall (x) (if (Occurrent x) (exists (r) (and (SpatioTemporalRegion r) (occupiesSpatioTemporalRegion x r))))) // axiom label in BFO2 CLIF: [108-001] (forall (x) (iff (Occurrent x) (and (Entity x) (exists (y) (temporalPartOf y x))))) // axiom label in BFO2 CLIF: [079-001] occurrent ic IndependentContinuant independent continuant a chair a heart a leg a molecule a spatial region an atom an orchestra. an organism the bottom right portion of a human torso the interior of your mouth A continuant that is a bearer of quality and realizable entity entities, in which other entities inhere and which itself cannot inhere in anything. b is an independent continuant = Def. b is a continuant which is such that there is no c and no t such that b s-depends_on c at t. (axiom label in BFO2 Reference: [017-002]) For any independent continuant b and any time t there is some spatial region r such that b is located_in r at t. (axiom label in BFO2 Reference: [134-001]) For every independent continuant b and time t during the region of time spanned by its life, there are entities which s-depends_on b during t. (axiom label in BFO2 Reference: [018-002]) (forall (x t) (if (IndependentContinuant x) (exists (r) (and (SpatialRegion r) (locatedInAt x r t))))) // axiom label in BFO2 CLIF: [134-001] (forall (x t) (if (and (IndependentContinuant x) (existsAt x t)) (exists (y) (and (Entity y) (specificallyDependsOnAt y x t))))) // axiom label in BFO2 CLIF: [018-002] (iff (IndependentContinuant a) (and (Continuant a) (not (exists (b t) (specificallyDependsOnAt a b t))))) // axiom label in BFO2 CLIF: [017-002] independent continuant spatial region process Process process a process of cell-division, \ a beating of the heart a process of meiosis a process of sleeping the course of a disease the flight of a bird the life of an organism your process of aging. An occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t. p is a process = Def. p is an occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t. (axiom label in BFO2 Reference: [083-003]) BFO 2 Reference: The realm of occurrents is less pervasively marked by the presence of natural units than is the case in the realm of independent continuants. Thus there is here no counterpart of ‘object’. In BFO 1.0 ‘process’ served as such a counterpart. In BFO 2.0 ‘process’ is, rather, the occurrent counterpart of ‘material entity’. Those natural – as contrasted with engineered, which here means: deliberately executed – units which do exist in the realm of occurrents are typically either parasitic on the existence of natural units on the continuant side, or they are fiat in nature. Thus we can count lives; we can count football games; we can count chemical reactions performed in experiments or in chemical manufacturing. We cannot count the processes taking place, for instance, in an episode of insect mating behavior.Even where natural units are identifiable, for example cycles in a cyclical process such as the beating of a heart or an organism’s sleep/wake cycle, the processes in question form a sequence with no discontinuities (temporal gaps) of the sort that we find for instance where billiard balls or zebrafish or planets are separated by clear spatial gaps. Lives of organisms are process units, but they too unfold in a continuous series from other, prior processes such as fertilization, and they unfold in turn in continuous series of post-life processes such as post-mortem decay. Clear examples of boundaries of processes are almost always of the fiat sort (midnight, a time of death as declared in an operating theater or on a death certificate, the initiation of a state of war) (iff (Process a) (and (Occurrent a) (exists (b) (properTemporalPartOf b a)) (exists (c t) (and (MaterialEntity c) (specificallyDependsOnAt a c t))))) // axiom label in BFO2 CLIF: [083-003] process disposition Disposition disposition an atom of element X has the disposition to decay to an atom of element Y certain people have a predisposition to colon cancer children are innately disposed to categorize objects in certain ways. the cell wall is disposed to filter chemicals in endocytosis and exocytosis BFO 2 Reference: Dispositions exist along a strength continuum. Weaker forms of disposition are realized in only a fraction of triggering cases. These forms occur in a significant number of cases of a similar type. b is a disposition means: b is a realizable entity & b’s bearer is some material entity & b is such that if it ceases to exist, then its bearer is physically changed, & b’s realization occurs when and because this bearer is in some special physical circumstances, & this realization occurs in virtue of the bearer’s physical make-up. (axiom label in BFO2 Reference: [062-002]) If b is a realizable entity then for all t at which b exists, b s-depends_on some material entity at t. (axiom label in BFO2 Reference: [063-002]) (forall (x t) (if (and (RealizableEntity x) (existsAt x t)) (exists (y) (and (MaterialEntity y) (specificallyDepends x y t))))) // axiom label in BFO2 CLIF: [063-002] (forall (x) (if (Disposition x) (and (RealizableEntity x) (exists (y) (and (MaterialEntity y) (bearerOfAt x y t)))))) // axiom label in BFO2 CLIF: [062-002] disposition realizable RealizableEntity realizable entity the disposition of this piece of metal to conduct electricity. the disposition of your blood to coagulate the function of your reproductive organs the role of being a doctor the role of this boundary to delineate where Utah and Colorado meet A specifically dependent continuant that inheres in continuant entities and are not exhibited in full at every time in which it inheres in an entity or group of entities. The exhibition or actualization of a realizable entity is a particular manifestation, functioning or process that occurs under certain circumstances. To say that b is a realizable entity is to say that b is a specifically dependent continuant that inheres in some independent continuant which is not a spatial region and is of a type instances of which are realized in processes of a correlated type. (axiom label in BFO2 Reference: [058-002]) All realizable dependent continuants have independent continuants that are not spatial regions as their bearers. (axiom label in BFO2 Reference: [060-002]) (forall (x t) (if (RealizableEntity x) (exists (y) (and (IndependentContinuant y) (not (SpatialRegion y)) (bearerOfAt y x t))))) // axiom label in BFO2 CLIF: [060-002] (forall (x) (if (RealizableEntity x) (and (SpecificallyDependentContinuant x) (exists (y) (and (IndependentContinuant y) (not (SpatialRegion y)) (inheresIn x y)))))) // axiom label in BFO2 CLIF: [058-002] realizable entity quality Quality quality the ambient temperature of this portion of air the color of a tomato the length of the circumference of your waist the mass of this piece of gold. the shape of your nose the shape of your nostril a quality is a specifically dependent continuant that, in contrast to roles and dispositions, does not require any further process in order to be realized. (axiom label in BFO2 Reference: [055-001]) If an entity is a quality at any time that it exists, then it is a quality at every time that it exists. (axiom label in BFO2 Reference: [105-001]) (forall (x) (if (Quality x) (SpecificallyDependentContinuant x))) // axiom label in BFO2 CLIF: [055-001] (forall (x) (if (exists (t) (and (existsAt x t) (Quality x))) (forall (t_1) (if (existsAt x t_1) (Quality x))))) // axiom label in BFO2 CLIF: [105-001] quality sdc SpecificallyDependentContinuant specifically dependent continuant Reciprocal specifically dependent continuants: the function of this key to open this lock and the mutually dependent disposition of this lock: to be opened by this key of one-sided specifically dependent continuants: the mass of this tomato of relational dependent continuants (multiple bearers): John’s love for Mary, the ownership relation between John and this statue, the relation of authority between John and his subordinates. the disposition of this fish to decay the function of this heart: to pump blood the mutual dependence of proton donors and acceptors in chemical reactions [79 the mutual dependence of the role predator and the role prey as played by two organisms in a given interaction the pink color of a medium rare piece of grilled filet mignon at its center the role of being a doctor the shape of this hole. the smell of this portion of mozzarella A continuant that inheres in or is borne by other entities. Every instance of A requires some specific instance of B which must always be the same. b is a relational specifically dependent continuant = Def. b is a specifically dependent continuant and there are n &gt; 1 independent continuants c1, … cn which are not spatial regions are such that for all 1 i &lt; j n, ci and cj share no common parts, are such that for each 1 i n, b s-depends_on ci at every time t during the course of b’s existence (axiom label in BFO2 Reference: [131-004]) b is a specifically dependent continuant = Def. b is a continuant & there is some independent continuant c which is not a spatial region and which is such that b s-depends_on c at every time t during the course of b’s existence. (axiom label in BFO2 Reference: [050-003]) Specifically dependent continuant doesn't have a closure axiom because the subclasses don't necessarily exhaust all possibilites. We're not sure what else will develop here, but for example there are questions such as what are promises, obligation, etc. (iff (RelationalSpecificallyDependentContinuant a) (and (SpecificallyDependentContinuant a) (forall (t) (exists (b c) (and (not (SpatialRegion b)) (not (SpatialRegion c)) (not (= b c)) (not (exists (d) (and (continuantPartOfAt d b t) (continuantPartOfAt d c t)))) (specificallyDependsOnAt a b t) (specificallyDependsOnAt a c t)))))) // axiom label in BFO2 CLIF: [131-004] (iff (SpecificallyDependentContinuant a) (and (Continuant a) (forall (t) (if (existsAt a t) (exists (b) (and (IndependentContinuant b) (not (SpatialRegion b)) (specificallyDependsOnAt a b t))))))) // axiom label in BFO2 CLIF: [050-003] specifically dependent continuant role Role role John’s role of husband to Mary is dependent on Mary’s role of wife to John, and both are dependent on the object aggregate comprising John and Mary as member parts joined together through the relational quality of being married. the priest role the role of a boundary to demarcate two neighboring administrative territories the role of a building in serving as a military target the role of a stone in marking a property boundary the role of subject in a clinical trial the student role A realizable entity the manifestation of which brings about some result or end that is not essential to a continuant in virtue of the kind of thing that it is but that can be served or participated in by that kind of continuant in some kinds of natural, social or institutional contexts. BFO 2 Reference: One major family of examples of non-rigid universals involves roles, and ontologies developed for corresponding administrative purposes may consist entirely of representatives of entities of this sort. Thus ‘professor’, defined as follows,b instance_of professor at t =Def. there is some c, c instance_of professor role & c inheres_in b at t.denotes a non-rigid universal and so also do ‘nurse’, ‘student’, ‘colonel’, ‘taxpayer’, and so forth. (These terms are all, in the jargon of philosophy, phase sortals.) By using role terms in definitions, we can create a BFO conformant treatment of such entities drawing on the fact that, while an instance of professor may be simultaneously an instance of trade union member, no instance of the type professor role is also (at any time) an instance of the type trade union member role (any more than any instance of the type color is at any time an instance of the type length).If an ontology of employment positions should be defined in terms of roles following the above pattern, this enables the ontology to do justice to the fact that individuals instantiate the corresponding universals – professor, sergeant, nurse – only during certain phases in their lives. b is a role means: b is a realizable entity & b exists because there is some single bearer that is in some special physical, social, or institutional set of circumstances in which this bearer does not have to be& b is not such that, if it ceases to exist, then the physical make-up of the bearer is thereby changed. (axiom label in BFO2 Reference: [061-001]) (forall (x) (if (Role x) (RealizableEntity x))) // axiom label in BFO2 CLIF: [061-001] role gdc GenericallyDependentContinuant generically dependent continuant The entries in your database are patterns instantiated as quality instances in your hard drive. The database itself is an aggregate of such patterns. When you create the database you create a particular instance of the generically dependent continuant type database. Each entry in the database is an instance of the generically dependent continuant type IAO: information content entity. the pdf file on your laptop, the pdf file that is a copy thereof on my laptop the sequence of this protein molecule; the sequence that is a copy thereof in that protein molecule. A continuant that is dependent on one or other independent continuant bearers. For every instance of A requires some instance of (an independent continuant type) B but which instance of B serves can change from time to time. b is a generically dependent continuant = Def. b is a continuant that g-depends_on one or more other entities. (axiom label in BFO2 Reference: [074-001]) (iff (GenericallyDependentContinuant a) (and (Continuant a) (exists (b t) (genericallyDependsOnAt a b t)))) // axiom label in BFO2 CLIF: [074-001] generically dependent continuant function Function function the function of a hammer to drive in nails the function of a heart pacemaker to regulate the beating of a heart through electricity the function of amylase in saliva to break down starch into sugar BFO 2 Reference: In the past, we have distinguished two varieties of function, artifactual function and biological function. These are not asserted subtypes of BFO:function however, since the same function – for example: to pump, to transport – can exist both in artifacts and in biological entities. The asserted subtypes of function that would be needed in order to yield a separate monoheirarchy are not artifactual function, biological function, etc., but rather transporting function, pumping function, etc. A function is a disposition that exists in virtue of the bearer’s physical make-up and this physical make-up is something the bearer possesses because it came into being, either through evolution (in the case of natural biological entities) or through intentional design (in the case of artifacts), in order to realize processes of a certain sort. (axiom label in BFO2 Reference: [064-001]) (forall (x) (if (Function x) (Disposition x))) // axiom label in BFO2 CLIF: [064-001] function material MaterialEntity material entity a flame a forest fire a human being a hurricane a photon a puff of smoke a sea wave a tornado an aggregate of human beings. an energy wave an epidemic the undetached arm of a human being An independent continuant that is spatially extended whose identity is independent of that of other entities and can be maintained through time. BFO 2 Reference: Material entities (continuants) can preserve their identity even while gaining and losing material parts. Continuants are contrasted with occurrents, which unfold themselves in successive temporal parts or phases [60 BFO 2 Reference: Object, Fiat Object Part and Object Aggregate are not intended to be exhaustive of Material Entity. Users are invited to propose new subcategories of Material Entity. BFO 2 Reference: ‘Matter’ is intended to encompass both mass and energy (we will address the ontological treatment of portions of energy in a later version of BFO). A portion of matter is anything that includes elementary particles among its proper or improper parts: quarks and leptons, including electrons, as the smallest particles thus far discovered; baryons (including protons and neutrons) at a higher level of granularity; atoms and molecules at still higher levels, forming the cells, organs, organisms and other material entities studied by biologists, the portions of rock studied by geologists, the fossils studied by paleontologists, and so on.Material entities are three-dimensional entities (entities extended in three spatial dimensions), as contrasted with the processes in which they participate, which are four-dimensional entities (entities extended also along the dimension of time).According to the FMA, material entities may have immaterial entities as parts – including the entities identified below as sites; for example the interior (or ‘lumen’) of your small intestine is a part of your body. BFO 2.0 embodies a decision to follow the FMA here. A material entity is an independent continuant that has some portion of matter as proper or improper continuant part. (axiom label in BFO2 Reference: [019-002]) Every entity which has a material entity as continuant part is a material entity. (axiom label in BFO2 Reference: [020-002]) every entity of which a material entity is continuant part is also a material entity. (axiom label in BFO2 Reference: [021-002]) (forall (x) (if (MaterialEntity x) (IndependentContinuant x))) // axiom label in BFO2 CLIF: [019-002] (forall (x) (if (and (Entity x) (exists (y t) (and (MaterialEntity y) (continuantPartOfAt x y t)))) (MaterialEntity x))) // axiom label in BFO2 CLIF: [021-002] (forall (x) (if (and (Entity x) (exists (y t) (and (MaterialEntity y) (continuantPartOfAt y x t)))) (MaterialEntity x))) // axiom label in BFO2 CLIF: [020-002] bfo BFO:0000040 material entity material entity immaterial entity A part of a cellular organism that is either an immaterial entity or a material entity with granularity above the level of a protein complex. Or, a substance produced by a cellular organism with granularity above the level of a protein complex. CARO:0000000 Following BFO, material anatomical entities may have immaterial parts (the lumen of your stomach is part of your stomach). The granularity limit follows the limits set by the Gene Ontology on the granularity limit for GO:cellular_component. Note that substances produced by an organism (sweat, feaces, urine) do not need to be part of an organism to qualify as an anatomical structure. anatomical entity anatomical entity Material anatomical entity that is a single connected structure with inherent 3D shape generated by coordinated expression of the organism's own genome. CARO:0000003 Note that the definition does not say 'generated exclusively by the co-ordinated expression of the organism's own genome', so this is still valid for cases where normal morphogenesis requires the actions of a facultative symbiont, or some looser dependency such as the a requirement for the presence of gut flora for normal gut development. connected anatomical structure An anatomical entity that has mass. CARO:0000006 material anatomical entity A structure consisting of multiple cell components but which is not itself a cell and does not have (complete) cells as a part. multi-cell-component structure CARO:0001000 Examples: a bundle of neuron projections in the brain; a region neuropil in an arthropod central nervous system; a region of cortex (preikaryal rind) in an arthropod brain. multi-cell-part structure A fasciculated bundle of neuron projections (GO:0043005), largely or completely lacking synapses. nerve fiber bundle CARO:0001001 neuron projection bundle Anatomical structure that is part of a multicellular organism and is at the gross anatomical level, e.g. above the level of a cell. Included are portions of organism substances such as blood, multi-cell-part structures such as axon tracts, acellular anatomical structures such as hair, and organism subdivisions such as head. Excluded is the whole organism and more granular parts of the organism, such as atoms, molecules, macromolecular complexes and cells. mah 10.7.2011 gross anatomical part Material anatomical entity that is a member of an individual species or is a viral or viroid particle. Melissa Haendel 9/18/11 organism or virus or viroid An anatomical structure that has more than one cell as a part. djs93 Sun Feb 27 10:53:00 GMT 2011 CARO:0010000 multicellular anatomical structure Elementary particle not affected by the strong force having a spin 1/2, a negative elementary charge and a rest mass of 0.000548579903(13) u, or 0.51099906(15) MeV. -1 0.000548579903 0.0 KEGG:C05359 PMID:21614077 Wikipedia:Electron electron chebi_ontology Elektron beta beta(-) beta-particle e e(-) e- negatron CHEBI:10545 electron A steroid compound with a structure based on a 19-carbon (androstane) skeleton. chebi_ontology C19-steroids CHEBI:131621 C19-steroid A class of carbonyl compound encompassing dicarboxylic acids and any derivatives obtained by substitution of either one or both of the carboxy hydrogens. chebi_ontology dicarboxylic acids and derivatives CHEBI:131927 dicarboxylic acids and O-substituted derivatives A carbohydrate acid derivative anion obtained by deprotonation of the carboxy groups of hyaluronic acid; major species at pH 7.3. -1 (C14H20NO11)n.H2O chebi_ontology hyaluronan hyaluronate polyanion CHEBI:132153 hyaluronate An organic group derived from any 3-oxo-Delta(4)-steroid. 0 C6H6O 94.111 94.04186 C1=C(C*)*C(CC1=O)* chebi_ontology a 3-oxo-Delta4-steroid group CHEBI:136849 3-oxo-Delta(4)-steroid group Any steroid that has beta-configuration at position 5. chebi_ontology 5beta steroids 5beta-steroid 5beta-steroids CHEBI:136889 5beta steroid A Bronsted acid derived from one or more inorganic compounds. Inorganic acids (also known as mineral acids) form hydrons and conjugate base ions when dissolved in water. Wikipedia:Mineral_acid chebi_ontology inorganic acids mineral acid mineral acids CHEBI:138103 inorganic acid Any member of a group of hydroxy steroids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration, while in lower vertebrates, some bile acids, known as allo-bile acids, have 5alpha-configuration. chebi_ontology CHEBI:138366 bile acids Any main group molecular entity that is gaseous at standard temperature and pressure (STP; 0degreeC and 100 kPa). Wikipedia:https://en.wikipedia.org/wiki/Gas chebi_ontology gas molecular entities gaseous molecular entities gaseous molecular entity CHEBI:138675 gas molecular entity -1 CH2NO2 InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4)/p-1 KXDHJXZQYSOELW-UHFFFAOYSA-M 60.03212 60.00910 NC([O-])=O Beilstein:3903503 CAS:302-11-4 Gmelin:239604 carbamate chebi_ontology Carbamat Karbamat carbamate ion carbamic acid, ion(1-) CHEBI:13941 carbamate An antigenic epitope recognized by an anti-bilirubin monoclonal antibody designated 24G7. A substructure of bilirubin IXalpha, it is the region containing the oxo group at C-1, the methyl group at C-2, C-(4, 5, 6, 9), and N-21 and -22. 0 C7H6N2O 134.136 134.04801 C(=CC(NC(=*)*)=*)(NC(C(C)=*)=O)* chebi_ontology CHEBI:142163 24G7 epitope An alpha-amino-acid anion that is the conjugate base of glutamic acid, having anionic carboxy groups and a cationic amino group -1 C5H8NO4 InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-1 WHUUTDBJXJRKMK-UHFFFAOYSA-M 146.12136 146.04588 [NH3+]C(CCC([O-])=O)C([O-])=O Gmelin:327908 glutamate(1-) hydrogen glutamate chebi_ontology 2-ammoniopentanedioate glutamate glutamic acid monoanion CHEBI:14321 glutamate(1-) A molecular entity that can accept an electron, a pair of electrons, an atom or a group from another molecular entity. CHEBI:13699 CHEBI:2377 KEGG:C00028 KEGG:C16722 Acceptor chebi_ontology A Akzeptor Hydrogen-acceptor Oxidized donor accepteur CHEBI:15339 acceptor 0 O2 InChI=1S/O2/c1-2 MYMOFIZGZYHOMD-UHFFFAOYSA-N 31.99880 31.98983 O=O CHEBI:10745 CHEBI:13416 CHEBI:23833 CHEBI:25366 CHEBI:30491 CHEBI:44742 CHEBI:7860 CAS:7782-44-7 Gmelin:485 HMDB:HMDB0001377 KEGG:C00007 KEGG:D00003 MetaCyc:OXYGEN-MOLECULE MolBase:750 PDBeChem:OXY PMID:10906528 PMID:16977326 PMID:18210929 PMID:18638417 PMID:19840863 PMID:7710549 PMID:9463773 Wikipedia:Oxygen dioxygen chebi_ontology Disauerstoff E 948 E-948 E948 O2 OXYGEN MOLECULE Oxygen [OO] dioxygene molecular oxygen CHEBI:15379 dioxygen A peptide containing ten or more amino acid residues. C4H6N2O3R2(C2H2NOR)n CHEBI:14860 CHEBI:8314 KEGG:C00403 Polypeptide polypeptides chebi_ontology Polypeptid polipeptido CHEBI:15841 polypeptide A nucleobase-containing molecular entity with a polymeric structure comprised of a linear sequence of 13 or more nucleotide residues. 0 (C5H8O6PR)n.C10H17O10PR2 CHEBI:13672 CHEBI:14859 CHEBI:8312 KEGG:C00419 Polynucleotide chebi_ontology polynucleotides CHEBI:15986 polynucleotide An azane that consists of a single nitrogen atom covelently bonded to three hydrogen atoms. 0 H3N InChI=1S/H3N/h1H3 QGZKDVFQNNGYKY-UHFFFAOYSA-N 17.03056 17.02655 [H]N([H])[H] CHEBI:13405 CHEBI:13406 CHEBI:13407 CHEBI:13771 CHEBI:22533 CHEBI:44269 CHEBI:44284 CHEBI:44404 CHEBI:7434 Beilstein:3587154 CAS:7664-41-7 Drug_Central:4625 Gmelin:79 HMDB:HMDB0000051 KEGG:C00014 KEGG:D02916 KNApSAcK:C00007267 MetaCyc:AMMONIA MolBase:930 PDBeChem:NH3 PMID:110589 PMID:11139349 PMID:11540049 PMID:11746427 PMID:11783653 PMID:13753780 PMID:14663195 PMID:15092448 PMID:15094021 PMID:15554424 PMID:15969015 PMID:16008360 PMID:16050680 PMID:16348008 PMID:16349403 PMID:16614889 PMID:16664306 PMID:16842901 PMID:17025297 PMID:17439666 PMID:17569513 PMID:17737668 PMID:18670398 PMID:22002069 PMID:22081570 PMID:22088435 PMID:22100291 PMID:22130175 PMID:22150211 PMID:22240068 PMID:22290316 PMID:22342082 PMID:22385337 PMID:22443779 PMID:22560242 Reaxys:3587154 Wikipedia:Ammonia AMMONIA Ammonia ammonia azane chebi_ontology Ammoniak NH3 R-717 [NH3] ammoniac amoniaco spirit of hartshorn CHEBI:16134 ammonia A sulfur oxoanion obtained by deprotonation of both OH groups of sulfuric acid. -2 O4S InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2 QAOWNCQODCNURD-UHFFFAOYSA-L 96.06360 95.95283 [O-]S([O-])(=O)=O CHEBI:15135 CHEBI:45687 CHEBI:9335 Beilstein:3648446 CAS:14808-79-8 Gmelin:2120 HMDB:HMDB0001448 KEGG:C00059 KEGG:D05963 MetaCyc:SULFATE PDBeChem:SO4 PMID:11200094 PMID:11452993 PMID:11581495 PMID:11798107 PMID:12166931 PMID:12668033 PMID:14597181 PMID:15093386 PMID:15984785 PMID:16186560 PMID:16345535 PMID:16347366 PMID:16348007 PMID:16483812 PMID:16534979 PMID:16656509 PMID:16742508 PMID:16742518 PMID:17120760 PMID:17420092 PMID:17439666 PMID:17709180 PMID:18398178 PMID:18815700 PMID:18846414 PMID:19047345 PMID:19244483 PMID:19544990 PMID:19628332 PMID:19812358 PMID:30398859 Reaxys:3648446 Wikipedia:Sulfate Sulfate sulfate tetraoxidosulfate(2-) tetraoxosulfate(2-) tetraoxosulfate(VI) chebi_ontology SO4(2-) SULFATE ION Sulfate anion(2-) Sulfate dianion Sulfate(2-) Sulfuric acid ion(2-) [SO4](2-) sulphate sulphate ion CHEBI:16189 sulfate A mucopolysaccharide composed of N-acetylglucosamine and glucuronic acid subunits. It is found in the connective tissues of vertebrates. A principal constituent of the extracellular matrix (ECM), it mediates the growth and metastasis of tumour cells. 0 (C14H21NO12)n CHEBI:14412 CHEBI:24622 CHEBI:24623 CHEBI:5772 Beilstein:8538277 CAS:9004-61-9 HMDB:HMDB0010366 KEGG:C00518 KEGG:D08043 KEGG:G10505 PMID:11122186 PMID:18056362 PMID:18290544 Reaxys:8187837 Wikipedia:Hyaluronan Hyaluronic acid chebi_ontology Hyaluronsaeure [beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n [beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n acide hyaluronique acido hialuronico hyaluronan CHEBI:16336 hyaluronic acid A naturally occurring polypeptide synthesized at the ribosome. CHEBI:8526 KEGG:C00017 chebi_ontology Protein polypeptide chain protein polypeptide chains CHEBI:16541 protein polypeptide chain Any member of the class of organooxygen compounds that is a polyhydroxy-aldehyde or -ketone or a lactol resulting from their intramolecular condensation (monosaccharides); substances derived from these by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom; and polymeric products arising by intermolecular acetal formation between two or more such molecules (disaccharides, polysaccharides and oligosaccharides). Carbohydrates contain only carbon, hydrogen and oxygen atoms; prior to any oxidation or reduction, most have the empirical formula Cm(H2O)n. Compounds obtained from carbohydrates by substitution, etc., are known as carbohydrate derivatives and may contain other elements. Cyclitols are generally not regarded as carbohydrates. CHEBI:15131 CHEBI:23008 CHEBI:9318 Wikipedia:Carbohydrate carbohydrate carbohydrates chebi_ontology Kohlenhydrat Kohlenhydrate carbohidrato carbohidratos glucide glucides glucido glucidos hydrates de carbone saccharide saccharides saccharidum CHEBI:16646 carbohydrate Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from alpha-amino acids, but it includes those derived from any amino carboxylic acid. X = OH, OR, NH2, NHR, etc. 0 (C2H2NOR)nC2H3NOR CHEBI:14753 CHEBI:25906 CHEBI:7990 KEGG:C00012 Peptide peptides chebi_ontology Peptid peptido peptidos CHEBI:16670 peptide Any oligosaccharide, polysaccharide or their derivatives consisting of monosaccharides or monosaccharide derivatives linked by glycosidic bonds. See also http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001. chebi_ontology glycans CHEBI:167559 glycan A member of the class of biladienes that is a linear tetrapyrrole with the dipyrrole units being of both exovinyl and endovinyl type. A product of heme degradation, it is produced in the reticuloendothelial system by the reduction of biliverdin and transported to the liver as a complex with serum albumin. 0 C33H36N4O6 InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/b26-13-,27-14- BPYKTIZUTYGOLE-IFADSCNNSA-N 584.66230 584.26348 CC1=C(C=C)\C(NC1=O)=C\c1[nH]c(Cc2[nH]c(\C=C3NC(=O)C(C=C)=C/3C)c(C)c2CCC(O)=O)c(CCC(O)=O)c1C CHEBI:13898 CHEBI:22870 CHEBI:3099 Beilstein:74376 CAS:635-65-4 Gmelin:411033 HMDB:HMDB0000054 KEGG:C00486 KNApSAcK:C00029828 MetaCyc:BILIRUBIN PMID:12799017 PMID:18442622 PMID:23763371 PMID:8605219 PMID:9587403 Reaxys:74376 Wikipedia:Bilirubin 3,18-diethenyl-2,7,13,17-tetramethyl-1,19-dioxo-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid bilirubin chebi_ontology 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid 8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione Bilirubin bilirubin(Z,Z) bilirubin-IXalpha CHEBI:16990 bilirubin IXalpha High molecular weight, linear polymers, composed of nucleotides containing deoxyribose and linked by phosphodiester bonds; DNA contain the genetic information of organisms. CHEBI:13302 CHEBI:21123 CHEBI:33698 CHEBI:4291 CAS:9007-49-2 KEGG:C00039 Deoxyribonucleic acid deoxyribonucleic acids chebi_ontology (Deoxyribonucleotide)m (Deoxyribonucleotide)n (Deoxyribonucleotide)n+m DNA DNAn DNAn+1 DNS Desoxyribonukleinsaeure deoxyribonucleic acids desoxyribose nucleic acid thymus nucleic acid CHEBI:16991 deoxyribonucleic acid A compound in which a carbonyl group is bonded to two carbon atoms: R2C=O (neither R may be H). 0 COR2 28.010 27.99491 [*]C([*])=O CHEBI:13427 CHEBI:13646 CHEBI:24974 CHEBI:6127 CHEBI:8742 KEGG:C01450 Wikipedia:Ketone Ketone ketones chebi_ontology Keton R-CO-R' a ketone cetone ketones CHEBI:17087 ketone A compound in which a carbohydrate component is covalently bound to a protein component. CHEBI:14349 CHEBI:5481 CHEBI:5493 KEGG:C00326 Glycoprotein glycoproteins chebi_ontology Glykoprotein Glykoproteine glicoproteina glicoproteinas glycoproteine glycoproteines CHEBI:17089 glycoprotein An androstanoid having 17beta-hydroxy and 3-oxo groups, together with unsaturation at C-4-C-5.. 0 C19H28O2 InChI=1S/C19H28O2/c1-18-9-7-13(20)11-12(18)3-4-14-15-5-6-17(21)19(15,2)10-8-16(14)18/h11,14-17,21H,3-10H2,1-2H3/t14-,15-,16-,17-,18-,19-/m0/s1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 288.42440 288.20893 [H][C@@]12CCC3=CC(=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H](O)CC[C@@]21[H] CHEBI:15214 CHEBI:26883 CHEBI:45798 CHEBI:9461 Beilstein:1915399 Beilstein:3653705 CAS:58-22-0 DrugBank:DB00624 Drug_Central:2607 Gmelin:538843 HMDB:HMDB0000234 KEGG:C00535 KEGG:D00075 KNApSAcK:C00003675 LIPID_MAPS_instance:LMST02020002 PDBeChem:TES PMID:10438974 PMID:11786693 PMID:18900503 PMID:24498482 Reaxys:1915399 Wikipedia:Testosterone 17beta-hydroxyandrost-4-en-3-one TESTOSTERONE Testosterone testosterone chebi_ontology 17beta-Hydroxy-4-androsten-3-one 17beta-hydroxy-4-androsten-3-one 4-androsten-17beta-ol-3-one Androderm Testosteron testosterona testosterone testosteronum CHEBI:17347 testosterone The carbon oxoanion resulting from the removal of a proton from carbonic acid. -1 CHO3 InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-1 BVKZGUZCCUSVTD-UHFFFAOYSA-M 61.01684 60.99312 OC([O-])=O CHEBI:13363 CHEBI:22863 CHEBI:40961 CHEBI:5589 Beilstein:3903504 CAS:71-52-3 Gmelin:49249 HMDB:HMDB0000595 KEGG:C00288 MetaCyc:HCO3 PDBeChem:BCT PMID:17215880 PMID:17505962 PMID:18439416 PMID:28732801 PMID:29150416 PMID:29460248 PMID:29466234 PMID:4208463 Wikipedia:Bicarbonate Hydrogencarbonate hydrogen(trioxidocarbonate)(1-) hydrogencarbonate hydrogencarbonate(1-) hydrogentrioxocarbonate(1-) hydrogentrioxocarbonate(IV) hydroxidodioxidocarbonate(1-) chebi_ontology Acid carbonate BICARBONATE ION Bicarbonate HCO3(-) HCO3- [CO2(OH)](-) hydrogen carbonate CHEBI:17544 hydrogencarbonate A molecular entity that can transfer ("donate") an electron, a pair of electrons, an atom or a group to another molecular entity. CHEBI:14202 CHEBI:4697 KEGG:C01351 Donor chebi_ontology Donator donneur CHEBI:17891 donor 'Lipids' is a loosely defined term for substances of biological origin that are soluble in nonpolar solvents. They consist of saponifiable lipids, such as glycerides (fats and oils) and phospholipids, as well as nonsaponifiable lipids, principally steroids. CHEBI:14517 CHEBI:25054 CHEBI:6486 KEGG:C01356 Lipid lipids chebi_ontology CHEBI:18059 lipid Any polysaccharide containing a substantial proportion of aminomonosaccharide residues. CHEBI:14361 CHEBI:24398 CHEBI:5495 KEGG:C02545 Wikipedia:Glycosaminoglycan Glycosaminoglycan glycosaminoglycan chebi_ontology Glykosaminoglykan glicosaminoglicano glycosaminoglycane glycosaminoglycans CHEBI:18085 glycosaminoglycan A biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically. This term is commonly used only for those containing more than ten monosaccharide residues. CHEBI:14864 CHEBI:26205 CHEBI:8322 KEGG:C00420 Polysaccharide polysaccharides chebi_ontology Glycan Glycane Glykan Glykane glycans polisacarido polisacaridos CHEBI:18154 polysaccharide An alpha-amino acid that is glutaric acid bearing a single amino substituent at position 2. 0 C5H9NO4 InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10) WHUUTDBJXJRKMK-UHFFFAOYSA-N 147.12930 147.05316 NC(CCC(O)=O)C(O)=O CHEBI:24314 CHEBI:5431 Beilstein:1723799 CAS:617-65-2 Gmelin:101971 KEGG:C00302 KEGG:D04341 KNApSAcK:C00001358 KNApSAcK:C00019577 PMID:15739367 PMID:17190852 PMID:24616376 PMID:24984001 Reaxys:1723799 Wikipedia:Glutamic_acid 2-aminopentanedioic acid Glutamic acid glutamic acid chebi_ontology 2-Aminoglutaric acid DL-Glutamic acid DL-Glutaminic acid E Glu Glutamate Glutaminic acid Glutaminsaeure CHEBI:18237 glutamic acid That part of DNA or RNA that may be involved in pairing. CHEBI:13873 CHEBI:25598 CHEBI:2995 KEGG:C00701 Wikipedia:Nucleobase chebi_ontology Base nucleobases CHEBI:18282 nucleobase A member of the class of imidazoles that is 1H-imidazole substituted at position C-4 by a 2-aminoethyl group. 0 C5H9N3 InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8) NTYJJOPFIAHURM-UHFFFAOYSA-N 111.14518 111.07965 NCCc1c[nH]cn1 CHEBI:14401 CHEBI:24596 CHEBI:43187 CHEBI:817 Beilstein:2012 CAS:51-45-6 Drug_Central:1375 Gmelin:2968 HMDB:HMDB0000870 KEGG:C00388 KEGG:D08040 KNApSAcK:C00001414 MetaCyc:HISTAMINE PDBeChem:HSM PMID:16399866 PMID:19547708 PMID:19843401 PMID:22770225 PMID:24101735 Reaxys:2012 Wikipedia:Histamine 2-(1H-imidazol-4-yl)ethanamine HISTAMINE Histamine chebi_ontology 1H-Imidazole-4-ethanamine 2-(4-Imidazolyl)ethylamine CHEBI:18295 histamine 0 C24H42 InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18+,19+,20-,21+,22+,23+,24-/m1/s1 QSHQKIURKJITMZ-OBUPQJQESA-N 330.59028 330.32865 [H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC Beilstein:2048472 5beta-cholane chebi_ontology CHEBI:20664 5beta-cholane An organic group formed by removing one or more hydroxy groups from an oxoacid that has the general structure RkE(=O)l(OH)m (l =/= 0). Although the term is almost always applied to organic compounds, with carboxylic acid as the oxoacid, acyl groups can in principle be derived from other types of acids such as sulfonic acids or phosphonic acids. acyl group alkanoyl chebi_ontology acyl groups alkanoyl group groupe acyle CHEBI:22221 acyl group alkali metals chebi_ontology Alkalimetall Alkalimetalle alkali metal metal alcalin metal alcalino metales alcalinos metaux alcalins CHEBI:22314 alkali metal atom chebi_ontology aminoglycans CHEBI:22506 aminoglycan A monoatomic or polyatomic species having one or more elementary charges of the electron. Anion anion chebi_ontology Anionen aniones anions CHEBI:22563 anion A substance that opposes oxidation or inhibits reactions brought about by dioxygen or peroxides. chebi_ontology antioxidants antioxydant antoxidant CHEBI:22586 antioxidant A molecular entity having an available pair of electrons capable of forming a covalent bond with a hydron (Bronsted base) or with the vacant orbital of some other molecular entity (Lewis base). KEGG:C00701 Base base chebi_ontology Base1 Base2 Basen Nucleobase bases CHEBI:22695 base A sodium salt of the conjugate of any bile acid with either glycine or taurine. KEGG:C01558 chebi_ontology Bile acid bile salts CHEBI:22868 bile salt The univalent carboacyl group formed by loss of -OH from the carboxy group of carbamic acid. 0 CH2NO 44.03272 44.01364 *C(N)=O PMID:24168430 carbamoyl chebi_ontology -C(O)NH2 -CONH2 aminocarbonyl carbamyl carbamyl group carboxamide CHEBI:23004 carbamoyl group 0 CO 28.01010 27.99491 O=C(*)* carbonyl carbonyl group chebi_ontology >C=O CHEBI:23019 carbonyl group An organic molecule or ion (usually a metal ion) that is required by an enzyme for its activity. It may be attached either loosely (coenzyme) or tightly (prosthetic group). Wikipedia:Cofactor_(biochemistry) cofactor cofactors chebi_ontology CHEBI:23357 cofactor Any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer etc., identifiable as a separately distinguishable entity. molecular entity chebi_ontology entidad molecular entidades moleculares entite moleculaire molecular entities molekulare Entitaet CHEBI:23367 molecular entity chebi_ontology Cyclopeptid Zyklopeptid cyclic peptides peptide cyclique peptido ciclico CHEBI:23449 cyclic peptide An azole that is either one of a pair of heterocyclic organic compounds comprising three carbon atoms and two nitrogen atoms arranged in a ring. chebi_ontology diazoles CHEBI:23677 diazole Any substance which when absorbed into a living organism may modify one or more of its functions. The term is generally accepted for a substance taken for a therapeutic purpose, but is also commonly used for abused substances. chebi_ontology drugs medicine CHEBI:23888 drug chebi_ontology monoatomic cations CHEBI:23906 monoatomic cation A compound or agent that combines with an enzyme in such a manner as to prevent the normal substrate-enzyme combination and the catalytic reaction. enzyme inhibitor chebi_ontology enzyme inhibitors inhibidor enzimatico inhibidores enzimaticos inhibiteur enzymatique inhibiteurs enzymatiques CHEBI:23924 enzyme inhibitor chebi_ontology CHEBI:24384 glycogens A chemical entity is a physical entity of interest in chemistry including molecular entities, parts thereof, and chemical substances. chemical entity chebi_ontology CHEBI:24431 chemical entity A role played by the molecular entity or part thereof within a biological context. chebi_ontology biological function CHEBI:24432 biological role A defined linked collection of atoms or a single atom within a molecular entity. group chebi_ontology Gruppe Rest groupe grupo grupos CHEBI:24433 group chebi_ontology CHEBI:24505 heparins A cyclic compound having as ring members atoms of carbon and at least of one other element. chebi_ontology organic heterocycle organic heterocyclic compounds CHEBI:24532 organic heterocyclic compound A heterodetic cyclic peptide is a peptide consisting only of amino-acid residues, but in which the linkages forming the ring are not solely peptide bonds; one or more is an isopeptide, disulfide, ester, or other bond. heterodetic cyclic peptide chebi_ontology heterodetic cyclic peptides peptide cyclique heterodetique peptido ciclico heterodetico CHEBI:24533 heterodetic cyclic peptide Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds. chebi_ontology endocrine hormones CHEBI:24621 hormone Hydroxides are chemical compounds containing a hydroxy group or salts containing hydroxide (OH(-)). chebi_ontology CHEBI:24651 hydroxides Any member of the class of 5beta-cholanic acids carrying at least one hydroxy group at unspecified position. chebi_ontology hydroxy-5beta-cholanic acids CHEBI:24663 hydroxy-5beta-cholanic acid A five-membered organic heterocycle containing two nitrogen atoms at positions 1 and 3, or any of its derivatives; compounds containing an imidazole skeleton. chebi_ontology CHEBI:24780 imidazoles A compound which contains oxygen, at least one other element, and at least one hydrogen bound to oxygen, and which produces a conjugate base by loss of positive hydrogen ion(s) (hydrons). oxoacid oxoacids chebi_ontology oxacids oxiacids oxo acid oxy-acids oxyacids CHEBI:24833 oxoacid chebi_ontology inorganic anions CHEBI:24834 inorganic anion A molecular entity that contains no carbon. chebi_ontology anorganische Verbindungen inorganic compounds inorganic entity inorganic molecular entities inorganics CHEBI:24835 inorganic molecular entity chebi_ontology inorganic oxides CHEBI:24836 inorganic oxide A salt is an assembly of cations and anions. salt chebi_ontology Salz Salze ionic compound ionic compounds sal sales salts sel sels CHEBI:24866 salt chebi_ontology monoatomic ions CHEBI:24867 monoatomic ion chebi_ontology organic salts organisches Salz CHEBI:24868 organic salt A molecular entity having a net electric charge. Ion ion chebi_ontology Ionen iones ions CHEBI:24870 ion chebi_ontology CHEBI:25046 linear tetrapyrrole Any intermediate or product resulting from metabolism. The term 'metabolite' subsumes the classes commonly known as primary and secondary metabolites. CHEBI:26619 CHEBI:35220 metabolite chebi_ontology metabolites primary metabolites secondary metabolites CHEBI:25212 metabolite chebi_ontology a metal cation metal cations CHEBI:25213 metal cation A molecule all atoms of which have the same atomic number. chebi_ontology homoatomic molecule homoatomic molecules CHEBI:25362 elemental molecule Any polyatomic entity that is an electrically neutral entity consisting of more than one atom. molecule chebi_ontology Molekuel molecula molecules neutral molecular compounds CHEBI:25367 molecule An oxoacid containing a single carboxy group. chebi_ontology monocarboxylic acids CHEBI:25384 monocarboxylic acid +1 0.00000 [*+] chebi_ontology monoatomic monocations monovalent inorganic cations CHEBI:25414 monoatomic monocation An endogenous compound that is used to transmit information across the synapse between a neuron and another cell. Wikipedia:Neurotransmitter chebi_ontology neurotransmitters CHEBI:25512 neurotransmitter 0 N 14.007 14.00307 WebElements:N nitrogen chebi_ontology 7N N Stickstoff azote nitrogen nitrogeno CHEBI:25555 nitrogen atom nonmetal chebi_ontology Nichtmetall Nichtmetalle no metal no metales non-metal non-metaux nonmetal nonmetals CHEBI:25585 nonmetal atom Any organic ion with a net negative charge. chebi_ontology organic anions CHEBI:25696 organic anion chebi_ontology organic ions CHEBI:25699 organic ion Compounds of the general formula SO3HOR where R is an organyl group chebi_ontology organic sulfates CHEBI:25704 organic sulfate An oxide is a chemical compound of oxygen with other chemical elements. oxide chebi_ontology oxides CHEBI:25741 oxide 0 O InChI=1S/O QVGXLLKOCUKJST-UHFFFAOYSA-N 15.99940 15.99491 [O] KEGG:C00007 WebElements:O oxygen chebi_ontology 8O O Sauerstoff oxigeno oxygen oxygene CHEBI:25805 oxygen atom oxygen molecular entity chebi_ontology oxygen molecular entities CHEBI:25806 oxygen molecular entity Any peptide with hormonal activity in animals, whether endocrine, neuroendocrine, or paracrine. chebi_ontology peptide hormones polypeptide hormone CHEBI:25905 peptide hormone Any amino acid whose side chain is capable of forming one or more hydrogen bonds. 0 C2H4NO2R 74.059 74.02420 OC(C(*)N)=O CHEBI:8283 MetaCyc:Polar-amino-acids PMID:12016058 polar amino acid chebi_ontology polar amino acids polar amino-acid polar amino-acids CHEBI:26167 polar amino acid 0 Na InChI=1S/Na KEAYESYHFKHZAL-UHFFFAOYSA-N 22.98977 22.98977 [Na] CAS:7440-23-5 Gmelin:16221 KEGG:C01330 WebElements:Na sodium chebi_ontology 11Na Na Natrium natrium sodio sodium CHEBI:26708 sodium atom chebi_ontology sodium compounds sodium molecular entities CHEBI:26712 sodium molecular entity Any alkali metal salt having sodium(1+) as the cation. chebi_ontology Natriumsalz Natriumsalze sodium salts CHEBI:26714 sodium salt An ester of an alcohol and sulfuric acid. 0 O4SR2 96.06300 95.95173 [*]OS(=O)(=O)O[*] chebi_ontology sulfate ester sulfuric acid ester sulfuric acid esters CHEBI:26819 sulfuric ester Salts and esters of sulfuric acid sulfates chebi_ontology sulfuric acid derivative sulphates CHEBI:26820 sulfates 0 S InChI=1S/S NINIDFKCEFEMDL-UHFFFAOYSA-N 32.06600 31.97207 [S] CAS:7704-34-9 KEGG:C00087 KEGG:D06527 PPDB:605 WebElements:S sulfur chebi_ontology 16S Elemental sulfur S Schwefel azufre soufre sulfur sulphur theion CHEBI:26833 sulfur atom sulfur molecular entity chebi_ontology sulfur molecular entities CHEBI:26835 sulfur molecular entity A sulfur oxoacid that consists of two oxo and two hydroxy groups joined covalently to a central sulfur atom. 0 H2O4S InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4) QAOWNCQODCNURD-UHFFFAOYSA-N 98.07948 97.96738 [H]OS(=O)(=O)O[H] CAS:7664-93-9 Gmelin:2122 KEGG:C00059 KEGG:D05963 KNApSAcK:C00007530 MolBase:4 PMID:13568755 PMID:16122922 PMID:19397353 PMID:22047659 PMID:22136045 PMID:22204399 PMID:22267186 PMID:22296037 PMID:22364556 PMID:22435616 PPDB:606 Reaxys:2037554 Wikipedia:Sulfuric_acid Sulfuric acid dihydrogen tetraoxosulfate dihydroxidodioxidosulfur hydrogen tetraoxosulfate(2-) hydrogen tetraoxosulfate(VI) sulfuric acid tetraoxosulfuric acid chebi_ontology Acide sulfurique Acido sulfurico Acidum sulfuricum H2SO4 Schwefelsaeureloesungen [S(OH)2O2] [SO2(OH)2] sulphuric acid CHEBI:26836 sulfuric acid A natural pigment containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next. tetrapyrrole tetrapyrroles chebi_ontology a tetrapyrrole CHEBI:26932 tetrapyrrole Any nutrient required in small quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Wikipedia:Micronutrient chebi_ontology micronutrients trace elements CHEBI:27027 micronutrient A univalent carboacyl group is a group formed by loss of OH from the carboxy group of a carboxylic acid. chebi_ontology univalent acyl group univalent carboacyl groups univalent carboxylic acyl groups CHEBI:27207 univalent carboacyl group A neutral compound having formal unit electrical charges of opposite sign on non-adjacent atoms. Sometimes referred to as inner salts, dipolar ions (a misnomer). zwitterion zwitterions chebi_ontology compose zwitterionique compuestos zwitterionicos zwitteriones zwitterionic compounds CHEBI:27369 zwitterion 0 C InChI=1S/C OKTJSMMVPCPJKN-UHFFFAOYSA-N 12.01070 12.00000 [C] CHEBI:23009 CHEBI:3399 CAS:7440-44-0 KEGG:C06265 WebElements:C carbon chebi_ontology 6C C Carbon Kohlenstoff carbon carbone carbonium carbono CHEBI:27594 carbon atom A polydisperse, highly branched glucan composed of chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage, joined together by alpha(1->6) glycosidic linkages. A small number of alpha(1->3) glycosidic linkages and some cumulative alpha(1->6) links also may occur. The branches in glycogen typically contain 8 to 12 glucose residues. CHEBI:24379 CHEBI:5466 CAS:9005-79-2 GlyGen:G99991IU GlyTouCan:G99991IU HMDB:HMDB0000757 KEGG:C00182 MetaCyc:CPD0-971 Wikipedia:Glycogen Glycogen chebi_ontology WURCS=2.0/1,4,3/[a2122h-1a_1-5]/1-1-1-1/a4-b1_b4-c1_b6-d1 animal starch liver starch CHEBI:28087 glycogen A one-carbon compound that is ammonia in which one of the hydrogens is replaced by a carboxy group. Although carbamic acid derivatives are common, carbamic acid itself has never been synthesised. 0 CH3NO2 InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4) KXDHJXZQYSOELW-UHFFFAOYSA-N 61.04006 61.01638 NC(O)=O CHEBI:22504 CHEBI:23002 CHEBI:3386 CHEBI:44573 Beilstein:1734754 CAS:463-77-4 DrugBank:DB04261 Gmelin:130345 KEGG:C01563 PDBeChem:OUT Wikipedia:Carbamic_acid CARBAMIC ACID Carbamic acid carbamic acid chebi_ontology Aminoameisensaeure Aminoformic acid Carbamate Carbamidsaeure CHEBI:28616 carbamic acid An onium cation obtained by protonation of ammonia. +1 H4N InChI=1S/H3N/h1H3/p+1 QGZKDVFQNNGYKY-UHFFFAOYSA-O 18.03850 18.03383 [H][N+]([H])([H])[H] CHEBI:22534 CHEBI:49783 CHEBI:7435 CAS:14798-03-9 Gmelin:84 KEGG:C01342 MetaCyc:AMMONIUM MolBase:929 PDBeChem:NH4 PMID:11319011 PMID:11341317 PMID:12096804 PMID:14512268 PMID:14879753 PMID:16345391 PMID:16903292 PMID:17392693 PMID:18515490 PMID:19199063 PMID:19596600 PMID:19682559 PMID:19716251 PMID:21993530 PMID:22265469 PMID:22524020 PMID:22562341 PMID:22631217 Reaxys:16093784 Wikipedia:Ammonium ammonium azanium chebi_ontology Ammonium(1+) NH4(+) NH4+ [NH4](+) ammonium cation ammonium ion CHEBI:28938 ammonium A carboxylic acid dianion obtained by deprotonation of both carboxy groups of any dicarboxylic acid. -2 C2O4R 88.019 87.97966 [O-]C(=O)[*]C([O-])=O CHEBI:13632 CHEBI:23688 CHEBI:23689 CHEBI:38711 dicarboxylic acid dianion chebi_ontology a dicarboxylate dicarboxylate dicarboxylates dicarboxylic acid dianions CHEBI:28965 dicarboxylic acid dianion 0 CH2O3 InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4) BVKZGUZCCUSVTD-UHFFFAOYSA-N 62.02478 62.00039 OC(O)=O CHEBI:13351 CHEBI:23017 CHEBI:23744 CHEBI:3401 CAS:463-79-6 Gmelin:25554 KEGG:C01353 PDBeChem:CO3 Carbonic acid carbonic acid dihydroxidooxidocarbon chebi_ontology Dihydrogen carbonate H2CO3 Koehlensaeure [CO(OH)2] CHEBI:28976 carbonic acid The conjugate base formed when the carboxy group of a carboxylic acid is deprotonated. -1 CO2R 44.00950 43.98983 [O-]C([*])=O CHEBI:13626 CHEBI:13945 CHEBI:23026 CHEBI:58657 chebi_ontology a carboxylate carboxylic acid anions carboxylic anions CHEBI:29067 carboxylic acid anion A monoatomic monocation obtained from sodium. +1 Na InChI=1S/Na/q+1 FKNQFGJONOIPTF-UHFFFAOYSA-N 22.98977 22.98922 [Na+] CHEBI:26717 CHEBI:49766 CHEBI:9175 CAS:17341-25-2 Gmelin:15196 KEGG:C01330 PDBeChem:NA sodium cation sodium(1+) sodium(1+) ion sodium(I) cation chebi_ontology Na(+) Na+ SODIUM ION CHEBI:29101 sodium(1+) -1 H2N InChI=1S/H2N/h1H2/q-1 HYGWNUKOUCZBND-UHFFFAOYSA-N 16.02262 16.01927 [H][N-][H] amide azanide dihydridonitrate(1-) chebi_ontology NH2(-) CHEBI:29337 azanide A divalent inorganic anion resulting from the removal of two protons from ammonia. -2 HN InChI=1S/HN/h1H/q-2 DZQYTNGKSBCIOE-UHFFFAOYSA-N 15.01468 15.01200 [N--][H] azanediide hydridonitrate(2-) chebi_ontology NH(2-) imide CHEBI:29340 hydridonitrate(2-) +1 HO2 InChI=1S/O2/c1-2/p+1 MYMOFIZGZYHOMD-UHFFFAOYSA-O 33.00674 32.99711 [H][O+]=O Gmelin:508 dioxidenium hydridodioxygen(1+) chebi_ontology HO2(+) HOO(+) [HO2](+) CHEBI:29793 hydridodioxygen(1+) A dicarboxylic acid dianion that is the conjugate base of glutamate(1-). -2 C5H7NO4 InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-2 WHUUTDBJXJRKMK-UHFFFAOYSA-L 145.11342 145.03860 NC(CCC([O-])=O)C([O-])=O Beilstein:4134100 Gmelin:327903 Reaxys:4134100 2-aminopentanedioate glutamate glutamate(2-) chebi_ontology glutamic acid dianion CHEBI:29987 glutamate(2-) Particle of zero charge, zero rest mass, spin quantum number 1, energy hnu and momentum hnu/c (h is the Planck constant, nu the frequency of radiation and c the speed of light), carrier of electromagnetic force. 0 0.0 0.0 * CHEBI:10581 CHEBI:14383 KEGG:C00205 photon chebi_ontology Lichtquant Light foton gamma hnu light quantum CHEBI:30212 photon Any member of a group of hydroxy-5beta-cholanic acids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration. KEGG:C01558 Bile acid chebi_ontology 5beta-bile acid 5beta-bile acids Bile salt Gallensaeure Gallensaeuren bile acids CHEBI:3098 bile acid An amide is a derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. CHEBI:22473 CHEBI:2633 KEGG:C00241 Amide amides chebi_ontology CHEBI:32988 amide Intended use of the molecular entity or part thereof by humans. chebi_ontology CHEBI:33232 application A particle not known to have substructure. elementary particle chebi_ontology elementary particles CHEBI:33233 fundamental particle A monoatomic entity is a molecular entity consisting of a single atom. chebi_ontology atomic entity monoatomic entities CHEBI:33238 monoatomic entity chebi_ontology oxoacid derivatives CHEBI:33241 oxoacid derivative chebi_ontology inorganic hydrides CHEBI:33242 inorganic hydride An organic fundamental parent is a structure used as a basis for substitutive names in organic nomenclature, containing, in addition to one or more hydrogen atoms, a single atom of an element, a number of atoms (alike or different) linked together to form an unbranched chain, a monocyclic or polycyclic ring system, or a ring assembly or ring/chain system. chebi_ontology organic fundamental parents organic parent hydrides CHEBI:33245 organic fundamental parent Any substituent group which does not contain carbon. chebi_ontology inorganic groups CHEBI:33246 inorganic group Any substituent group or skeleton containing carbon. chebi_ontology organic groups CHEBI:33247 organic group Any organic substituent group, regardless of functional type, having one free valence at a carbon atom. organyl group organyl groups chebi_ontology groupe organyle grupo organilo grupos organilo CHEBI:33249 organyl group A chemical entity constituting the smallest component of an element having the chemical properties of the element. CHEBI:22671 CHEBI:23907 atom chebi_ontology atome atomo atoms atomus element elements CHEBI:33250 atom A nucleus is the positively charged central portion of an atom, excluding the orbital electrons. nucleus chebi_ontology Atomkern Kern noyau noyau atomique nuclei nucleo nucleo atomico nucleus atomi CHEBI:33252 atomic nucleus Heavy nuclear particle: proton or neutron. nucleon chebi_ontology Nukleon Nukleonen nucleons CHEBI:33253 nucleon A derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group. primary amide primary amides chebi_ontology CHEBI:33256 primary amide A molecular entity all atoms of which have the same atomic number. chebi_ontology homoatomic entity homoatomic molecular entities homoatomic molecular entity CHEBI:33259 elemental molecular entity chebi_ontology CHEBI:33262 elemental oxygen 0 O2 31.999 31.98983 chebi_ontology CHEBI:33263 diatomic oxygen An anion consisting of more than one atom. chebi_ontology polyatomic anions CHEBI:33273 polyatomic anion chebi_ontology chemical messenger CHEBI:33280 molecular messenger A nutrient is a food component that an organism uses to survive and grow. chebi_ontology nutrients CHEBI:33284 nutrient A heteroorganic entity is an organic molecular entity in which carbon atoms or organic groups are bonded directly to one or more heteroatoms. chebi_ontology heteroorganic entities organoelement compounds CHEBI:33285 heteroorganic entity A substance administered to aid diagnosis of a disease. chebi_ontology diagnostic aid CHEBI:33295 diagnostic agent A molecular entity containing one or more atoms of an alkali metal. chebi_ontology alkali metal molecular entities CHEBI:33296 alkali metal molecular entity Any p-block element atom that is in group 15 of the periodic table: nitrogen, phosphorus, arsenic, antimony and bismuth. pnictogens chebi_ontology group 15 elements group V elements nitrogenoideos nitrogenoides pnictogene pnictogenes CHEBI:33300 pnictogen A p-block molecular entity containing any pnictogen. pnictogen molecular entity chebi_ontology pnictogen molecular entities CHEBI:33302 pnictogen molecular entity Any p-block element belonging to the group 16 family of the periodic table. PMID:17084588 chalcogen chalcogens chebi_ontology Chalkogen Chalkogene anfigeno anfigenos calcogeno calcogenos chalcogene chalcogenes group 16 elements group VI elements CHEBI:33303 chalcogen Any p-block molecular entity containing a chalcogen. chalcogen molecular entity chebi_ontology chalcogen compounds chalcogen molecular entities CHEBI:33304 chalcogen molecular entity group 14 elements chebi_ontology carbon group element carbon group elements carbonoides cristallogene cristallogenes group IV elements CHEBI:33306 carbon group element atom An atom belonging to one of the main groups (found in the s- and p- blocks) of the periodic table. main group elements chebi_ontology Hauptgruppenelement Hauptgruppenelemente main group element CHEBI:33318 main group element atom chebi_ontology oxoacids of sulfur sulfur oxoacids CHEBI:33402 sulfur oxoacid sulfur oxoacid derivative chebi_ontology sulfur oxoacid derivatives CHEBI:33424 sulfur oxoacid derivative sulfur oxoanion chebi_ontology oxoanions of sulfur sulfur oxoanions CHEBI:33482 sulfur oxoanion chalcogen oxoacid chebi_ontology chalcogen oxoacids CHEBI:33484 chalcogen oxoacid chalcogen oxoanion chebi_ontology chalcogen oxoanions CHEBI:33485 chalcogen oxoanion chebi_ontology alkali metal cations CHEBI:33504 alkali metal cation An atom of an element that exhibits typical metallic properties, being typically shiny, with high electrical and thermal conductivity. CHEBI:25217 CHEBI:6788 KEGG:C00050 PMID:21784043 Wikipedia:Metal chebi_ontology elemental metal elemental metals metal element metal elements metals CHEBI:33521 metal atom An amino-acid anion obtained by deprotonation of any alpha-amino acid. alpha-amino-acid anion chebi_ontology alpha-amino acid anions alpha-amino-acid anions CHEBI:33558 alpha-amino-acid anion chebi_ontology s-block element s-block elements CHEBI:33559 s-block element atom Any main group element atom belonging to the p-block of the periodic table. chebi_ontology p-block element p-block elements CHEBI:33560 p-block element atom A carbon oxoacid acid carrying at least one -C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid. 0 CHO2R 45.01740 44.99765 OC([*])=O CHEBI:13428 CHEBI:13627 CHEBI:23027 PMID:17147560 PMID:18433345 Wikipedia:Carboxylic_acid carboxylic acid carboxylic acids chebi_ontology Carbonsaeure Carbonsaeuren Karbonsaeure RC(=O)OH acide carboxylique acides carboxyliques acido carboxilico acidos carboxilicos CHEBI:33575 carboxylic acid A molecular entity containing one or more atoms from any of groups 1, 2, 13, 14, 15, 16, 17, and 18 of the periodic table. chebi_ontology main group compounds main group molecular entities CHEBI:33579 main group molecular entity carbon group molecular entity chebi_ontology carbon group molecular entities CHEBI:33582 carbon group molecular entity Any molecule that consists of a series of atoms joined together to form a ring. Wikipedia:Cyclic_compound chebi_ontology cyclic compounds CHEBI:33595 cyclic compound chebi_ontology hydrogen compounds hydrogen molecular entities CHEBI:33608 hydrogen molecular entity chebi_ontology polycyclic compounds CHEBI:33635 polycyclic compound A cyclically conjugated molecular entity with a stability (due to delocalization) significantly greater than that of a hypothetical localized structure (e.g. Kekule structure) is said to possess aromatic character. aromatic compounds aromatic molecular entity chebi_ontology aromatics aromatische Verbindungen CHEBI:33655 aromatic compound chebi_ontology organic aromatic compounds CHEBI:33659 organic aromatic compound An s-block molecular entity is a molecular entity containing one or more atoms of an s-block element. s-block molecular entity chebi_ontology s-block compounds s-block molecular entities CHEBI:33674 s-block molecular entity A main group molecular entity that contains one or more atoms of a p-block element. chebi_ontology p-block compounds p-block molecular entities p-block molecular entitiy CHEBI:33675 p-block molecular entity Hydrides are chemical compounds of hydrogen with other chemical elements. chebi_ontology CHEBI:33692 hydrides oxygen hydride chebi_ontology hydrides of oxygen oxygen hydrides CHEBI:33693 oxygen hydride A macromolecule formed by a living organism. biopolymer chebi_ontology Biopolymere biomacromolecules biopolymers CHEBI:33694 biomacromolecule chebi_ontology genetically encoded biomacromolecules genetically encoded biopolymers information biomacromolecules information biopolymers information macromolecule information macromolecules CHEBI:33695 information biomacromolecule A macromolecule made up of nucleotide units and hydrolysable into certain pyrimidine or purine bases (usually adenine, cytosine, guanine, thymine, uracil), D-ribose or 2-deoxy-D-ribose and phosphoric acid. nucleic acids chebi_ontology NA Nukleinsaeure Nukleinsaeuren acide nucleique acides nucleiques acido nucleico acidos nucleicos CHEBI:33696 nucleic acid High molecular weight, linear polymers, composed of nucleotides containing ribose and linked by phosphodiester bonds; RNA is central to the synthesis of proteins. CAS:63231-63-0 ribonucleic acid ribonucleic acids chebi_ontology RNA RNS Ribonukleinsaeure pentosenucleic acids ribonucleic acids ribose nucleic acid yeast nucleic acid CHEBI:33697 ribonucleic acid chebi_ontology canonical amino-acid residue canonical amino-acid residues common amino acid residues proteinogenic amino-acid residues standard amino acid residues standard amino-acid residues CHEBI:33700 proteinogenic amino-acid residue A cation consisting of more than one atom. chebi_ontology polyatomic cations CHEBI:33702 polyatomic cation An amino acid in which the amino group is located on the carbon atom at the position alpha to the carboxy group. 0 C2H4NO2R 74.05870 74.02420 NC([*])C(O)=O CHEBI:10208 CHEBI:13779 CHEBI:22442 CHEBI:2642 KEGG:C00045 KEGG:C05167 alpha-amino acid chebi_ontology Amino acid Amino acids alpha-amino acids alpha-amino carboxylic acids CHEBI:33704 alpha-amino acid When two or more amino acids combine to form a peptide, the elements of water are removed, and what remains of each amino acid is called an amino-acid residue. amino-acid residue chebi_ontology amino acid residue amino-acid residues CHEBI:33708 amino-acid residue A carboxylic acid containing one or more amino groups. CHEBI:13815 CHEBI:22477 Wikipedia:Amino_acid chebi_ontology Aminocarbonsaeure Aminokarbonsaeure Aminosaeure amino acids CHEBI:33709 amino acid chebi_ontology alpha-amino-acid residues CHEBI:33710 alpha-amino-acid residue carbohydrate acid chebi_ontology carbohydrate acids CHEBI:33720 carbohydrate acid carbohydrate acid anion chebi_ontology carbohydrate acid anions CHEBI:33721 carbohydrate acid anion chebi_ontology canonical nucleoside residues common nucleoside residues nucleoside residue standard nucleoside residues CHEBI:33791 canonical nucleoside residue chebi_ontology N Nuc canonical ribonucleoside residues common ribonucleoside residue common ribonucleoside residues standard ribonucleoside residues CHEBI:33792 canonical ribonucleoside residue chebi_ontology canonical deoxyribonucleoside residues common 2'-deoxyribonucleoside residue common 2'-deoxyribonucleoside residues dN dNuc standard deoxyribonucleoside residues CHEBI:33793 canonical deoxyribonucleoside residue An organic compound having at least one hydroxy group attached to a carbon atom. CHEBI:64710 hydroxy compounds chebi_ontology organic alcohol organic hydroxy compounds CHEBI:33822 organic hydroxy compound Any organic molecule that consists of atoms connected in the form of a ring. chebi_ontology organic cyclic compounds CHEBI:33832 organic cyclic compound A heterocyclic compound formally derived from an arene by replacement of one or more methine (-C=) and/or vinylene (-CH=CH-) groups by trivalent or divalent heteroatoms, respectively, in such a way as to maintain the continuous pi-electron system characteristic of aromatic systems and a number of out-of-plane pi-electrons corresponding to the Hueckel rule (4n+2). heteroarenes chebi_ontology hetarenes CHEBI:33833 heteroarene Conjugated protein is a protein that contains a non-peptide component, usually in stoichiometric proportion. COMe:PRX000001 conjugated proteins chebi_ontology complex protein CHEBI:33837 conjugated protein A macromolecule is a molecule of high relative molecular mass, the structure of which essentially comprises the multiple repetition of units derived, actually or conceptually, from molecules of low relative molecular mass. Wikipedia:Macromolecule macromolecule chebi_ontology macromolecules polymer polymer molecule polymers CHEBI:33839 macromolecule A substance used in a chemical reaction to detect, measure, examine, or produce other substances. reagent chebi_ontology reactif reactivo reagents CHEBI:33893 reagent Any nutrient required in large quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Macronutrients are usually chemical elements (carbon, hydrogen, nitrogen, oxygen, phosphorus and sulfur) that humans consume in the largest quantities. Calcium, sodium, magnesium and potassium are sometimes included as macronutrients because they are required in relatively large quantities compared with other vitamins and minerals. chebi_ontology macronutrients CHEBI:33937 macronutrient chebi_ontology nitrogen hydrides CHEBI:35106 nitrogen hydride Saturated acyclic nitrogen hydrides having the general formula NnHn+2. chebi_ontology azanes CHEBI:35107 azane A substance that diminishes the rate of a chemical reaction. inhibitor chebi_ontology inhibidor inhibiteur inhibitors CHEBI:35222 inhibitor A substance that increases the rate of a reaction without modifying the overall standard Gibbs energy change in the reaction. catalyst chebi_ontology Katalysator catalizador catalyseur CHEBI:35223 catalyst The zwitterionic form of an amino acid having a negatively charged carboxyl group and a positively charged amino group. amino acid zwitterion chebi_ontology CHEBI:35238 amino acid zwitterion A derivative of ammonium, NH4(+), in which one (or more) of the hydrogens bonded to the nitrogen have been replaced with univalent organyl groups. The substituting carbon of the organyl group must not itself be directly attached to a heteroatom (thereby excluding protonated amides, hemiaminals, etc). chebi_ontology ammonium ion derivatives azanium ion derivative azanium ion derivatives CHEBI:35274 ammonium ion derivative Any of naturally occurring compounds and synthetic analogues, based on the cyclopenta[a]phenanthrene carbon skeleton, partially or completely hydrogenated; there are usually methyl groups at C-10 and C-13, and often an alkyl group at C-17. By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred. Natural steroids are derived biogenetically from squalene which is a triterpene. 0 C19H31R 259.450 259.24258 C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCCC4)C CHEBI:13687 CHEBI:26768 CHEBI:9263 KEGG:C00377 MetaCyc:Steroids Steroid steroids chebi_ontology a steroid CHEBI:35341 steroid A 17-hydroxy steroid in which the hydroxy group at position 17 has a beta-configuration. 0 C18H29OR 261.423 261.22184 CC12CCC3C(CCC4CCCCC34[*])C1CC[C@@H]2O CHEBI:19176 CHEBI:794 KEGG:C03051 MetaCyc:17-beta-Hydroxysteroids 17beta-hydroxy steroid chebi_ontology 17beta-hydroxy steroids 17beta-hydroxysteroid 17beta-hydroxysteroids CHEBI:35343 17beta-hydroxy steroid CHEBI:24748 CHEBI:5814 KEGG:C02159 chebi_ontology Hydroxysteroid hydroxy steroids hydroxysteroids CHEBI:35350 hydroxy steroid Any heteroorganic entity containing at least one carbon-nitrogen bond. organonitrogen compounds chebi_ontology organonitrogens CHEBI:35352 organonitrogen compound An oxoanion is an anion derived from an oxoacid by loss of hydron(s) bound to oxygen. CHEBI:33274 CHEBI:33436 oxoanion chebi_ontology oxoacid anions oxoanions CHEBI:35406 oxoanion A substance that reduces or suppresses inflammation. chebi_ontology anti-inflammatory drugs antiinflammatory agent antiinflammatory drug antiinflammatory drugs CHEBI:35472 anti-inflammatory drug chebi_ontology alkali metal salts CHEBI:35479 alkali metal salt natural product fundamental parents chebi_ontology CHEBI:35507 natural product fundamental parent chebi_ontology steroid fundamental parents CHEBI:35508 steroid fundamental parent 0 C19H32 InChI=1S/C19H32/c1-18-11-5-7-16(18)15-9-8-14-6-3-4-12-19(14,2)17(15)10-13-18/h14-17H,3-13H2,1-2H3/t14?,15-,16-,17-,18-,19-/m0/s1 QZLYKIGBANMMBK-FZFXZXLVSA-N 260.45738 260.25040 [H][C@@]12CCC3CCCC[C@]3(C)[C@@]1([H])CC[C@]1(C)CCC[C@@]21[H] Beilstein:5247532 CAS:24887-75-0 LIPID_MAPS_instance:LMST02020000 androstane chebi_ontology CHEBI:35509 androstane 0 C24H42 InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18?,19+,20-,21+,22+,23+,24-/m1/s1 QSHQKIURKJITMZ-BRPMRXRMSA-N 330.59028 330.32865 [H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC cholane chebi_ontology CHEBI:35519 cholane A negative ion consisting solely of carbon and oxygen atoms, and therefore having the general formula CxOy(n-) for some integers x, y and n. carbon oxoanion chebi_ontology carbon oxoanions oxocarbon anion oxocarbon anions CHEBI:35604 carbon oxoanion chebi_ontology carbon oxoacids oxoacids of carbon CHEBI:35605 carbon oxoacid Any carboxylic acid containing two carboxy groups. CHEBI:23692 CHEBI:36172 CHEBI:4501 KEGG:C02028 Dicarboxylic acid chebi_ontology dicarboxylic acids CHEBI:35692 dicarboxylic acid dicarboxylic acid anion chebi_ontology dicarboxylic acid anions CHEBI:35693 dicarboxylic acid anion A compound formally derived from an oxoacid RkE(=O)l(OH)m (l > 0) and an alcohol, phenol, heteroarenol, or enol by linking with formal loss of water from an acidic hydroxy group of the former and a hydroxy group of the latter. CHEBI:23960 CHEBI:4859 KEGG:C00287 Wikipedia:Ester Ester chebi_ontology esters CHEBI:35701 ester chebi_ontology glycosaminoglycan sulfate glycosaminoglycan sulfates sulfated glycosaminoglycans CHEBI:35722 sulfated glycosaminoglycan chebi_ontology carbohydrate sulfates carbohydrate sulphates CHEBI:35724 carbohydrate sulfate A carboxylic acid anion formed when the carboxy group of a monocarboxylic acid is deprotonated. -1 CO2R 44.01000 43.98983 [O-]C([*])=O CHEBI:13657 CHEBI:25382 CHEBI:3407 KEGG:C00060 chebi_ontology Carboxylate Monocarboxylate a monocarboxylate monocarboxylates monocarboxylic acid anions CHEBI:35757 monocarboxylic acid anion CHEBI:24979 CHEBI:25804 chebi_ontology keto steroids ketosteroids oxo steroids oxosteroids CHEBI:35789 oxo steroid pnictogen hydride chebi_ontology pnictogen hydrides CHEBI:35881 pnictogen hydride CHEBI:22867 CHEBI:50419 LIPID_MAPS_class:LMST04 chebi_ontology bile acids and derivatives cholanoids CHEBI:36078 cholanoid A biological macromolecule minimally consisting of one polypeptide chain synthesized at the ribosome. CHEBI:13677 CHEBI:14911 proteins chebi_ontology CHEBI:36080 protein chebi_ontology bile acid anions CHEBI:36235 bile acid anion A steroid acid that consists of cholane having a carboxy group in place of the methyl group at position 24. 0 C24H40O2 InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17?,18+,19-,20+,21+,23+,24-/m1/s1 RPKLZQLYODPWTM-KBMWBBLPSA-N 360.57320 360.30283 [H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC(O)=O CAS:25312-65-6 Patent:JP2008069152 Reaxys:13246008 cholan-24-oic acid chebi_ontology CHEBI:36237 cholanic acid 0 C24H40O2 InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17+,18+,19-,20+,21+,23+,24-/m1/s1 RPKLZQLYODPWTM-LVVAJZGHSA-N 360.57320 360.30283 [H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC(O)=O Beilstein:3214794 CAS:546-18-9 LIPID_MAPS_instance:LMST04010441 5beta-cholan-24-oic acid 5beta-cholanic acid chebi_ontology (5beta)-cholan-24-oic acid (5beta,17beta)-gamma-methylandrostane-17-butanoic acid 5beta-cholanoic acid ursocholanic acid CHEBI:36238 5beta-cholanic acid Members of the class of cholanic acids based on a 5beta-cholane skeleton. chebi_ontology CHEBI:36248 5beta-cholanic acids A salt of a bile acid. chebi_ontology bile acid salts CHEBI:36277 bile acid salt CHEBI:23166 CHEBI:23211 chebi_ontology CHEBI:36278 cholanic acids Lepton is a fermion that does not experience the strong force (strong interaction). The term is derived from the Greek lambdaepsilonpitauomicronsigma (small, thin). chebi_ontology leptons CHEBI:36338 lepton Baryon is a fermion that does experience the strong force (strong interaction). The term is derived from the Greek betaalpharhoupsilonsigma (heavy). chebi_ontology baryons CHEBI:36339 baryon Particle of half-integer spin quantum number following Fermi-Dirac statistics. Fermions are named after Enrico Fermi. fermion chebi_ontology fermions CHEBI:36340 fermion Particle of integer spin quantum number following Bose-Einstein statistics. Bosons are named after Satyendra Nath Bose. boson chebi_ontology bosons CHEBI:36341 boson A particle smaller than an atom. Wikipedia:Subatomic_particle chebi_ontology subatomic particles CHEBI:36342 subatomic particle A subatomic particle known to have substructure (i.e. consisting of smaller particles). chebi_ontology composite particles CHEBI:36343 composite particle Hadron is a subatomic particle which experiences the strong force. chebi_ontology hadrons CHEBI:36344 hadron A nucleus or any of its constituents in any of their energy states. nuclear particle chebi_ontology CHEBI:36347 nuclear particle Any molecular entity consisting of more than one atom. chebi_ontology polyatomic entities CHEBI:36357 polyatomic entity An ion consisting of more than one atom. chebi_ontology polyatomic ions CHEBI:36358 polyatomic ion Any compound containing the carbonyl group, C=O. The term is commonly used in the restricted sense of aldehydes and ketones, although it actually includes carboxylic acids and derivatives. carbonyl compounds chebi_ontology CHEBI:36586 carbonyl compound Organic compounds containing an oxygen atom, =O, doubly bonded to carbon or another element. oxo compounds chebi_ontology organic oxo compounds CHEBI:36587 organic oxo compound Compounds based on a biladiene skeleton. chebi_ontology CHEBI:36735 biladienes A hydroxy steroid carrying a hydroxy group at position 17. chebi_ontology 17-hydroxy steroids CHEBI:36838 17-hydroxy steroid chalcogen hydride chebi_ontology chalcogen hydrides CHEBI:36902 chalcogen hydride chebi_ontology inorganic ions CHEBI:36914 inorganic ion chebi_ontology inorganic cations CHEBI:36915 inorganic cation A monoatomic or polyatomic species having one or more elementary charges of the proton. CHEBI:23058 CHEBI:3473 KEGG:C01373 Cation cation chebi_ontology Kation Kationen cationes cations CHEBI:36916 cation chalcocarbonic acid chalcocarbonic acids chebi_ontology chalcocarbonic acids CHEBI:36961 chalcocarbonic acid An organochalcogen compound is a compound containing at least one carbon-chalcogen bond. organochalcogen compound chebi_ontology organochalcogen compounds CHEBI:36962 organochalcogen compound An organochalcogen compound containing at least one carbon-oxygen bond. PMID:17586126 organooxygen compound chebi_ontology organooxygen compounds CHEBI:36963 organooxygen compound amino-acid anion chebi_ontology amino acid anions amino-acid anions CHEBI:37022 amino-acid anion A polysaccharide composed of glucose residues. C12H22O11(C6H10O5)n CHEBI:24255 CHEBI:5392 CAS:9037-91-6 KEGG:C01379 Glucan glucan chebi_ontology glucans CHEBI:37163 glucan Glycans composed of a single type of monosaccharide residue. They are named by replacing the ending '-ose' of the sugar by '-an'. homopolysaccharide chebi_ontology homoglycan homopolysaccharides CHEBI:37164 homopolysaccharide chebi_ontology organic hydrides CHEBI:37175 organic hydride mononuclear parent hydrides chebi_ontology mononuclear hydride mononuclear hydrides CHEBI:37176 mononuclear parent hydride chebi_ontology CHEBI:37246 elemental sodium Any of the group of polysaccharides composed of alternating units from uronic acids and glycosamines, and commonly partially esterified with sulfuric acid. CHEBI:25425 CHEBI:7011 KEGG:C05114 Mucopolysaccharide mucopolysaccharides chebi_ontology Mucopolysaccharid Mukopolysaccharid mucopolisacarido mucopolisacaridos CHEBI:37395 mucopolysaccharide An acid is a molecular entity capable of donating a hydron (Bronsted acid) or capable of forming a covalent bond with an electron pair (Lewis acid). CHEBI:13800 CHEBI:13801 CHEBI:22209 CHEBI:2426 KEGG:C00174 Acid acid chebi_ontology Saeure Saeuren acide acido acids CHEBI:37527 acid A molecular entity consisting of two or more chemical elements. chebi_ontology chemical compound heteroatomic molecular entities CHEBI:37577 heteroatomic molecular entity An amide of a carboxylic acid, having the structure RC(=O)NR2. The term is used as a suffix in systematic name formation to denote the -C(=O)NH2 group including its carbon atom. 0 CNOR3 42.01680 41.99799 [*]C(=O)N([*])[*] CHEBI:35354 CHEBI:35355 carboxamides chebi_ontology carboxamides primary carboxamide CHEBI:37622 carboxamide sulfuric acid derivative chebi_ontology sulfuric acid derivatives CHEBI:37826 sulfuric acid derivative A carboacyl group is a group formed by loss of at least one OH from the carboxy group of a carboxylic acid. carboacyl groups carboxylic acyl group chebi_ontology carboxylic acyl groups CHEBI:37838 carboacyl group A compound composed of two or more pyrrole units. Beilstein:8538310 chebi_ontology PPys poly(pyrrole)s polypyrroles CHEBI:38077 polypyrrole Any organonitrogen compound containing a cyclic component with nitrogen and at least one other element as ring member atoms. chebi_ontology heterocyclic organonitrogen compounds organonitrogen heterocyclic compounds CHEBI:38101 organonitrogen heterocyclic compound C4H6N2O3R2(C7H9N2O2R)n CAS:9064-67-9 KEGG:C00211 Collagen chebi_ontology CHEBI:3815 Collagen chebi_ontology monocyclic heteroarenes CHEBI:38179 monocyclic heteroarene organic sodium salt chebi_ontology organic sodium salts CHEBI:38700 organic sodium salt Any dianion containing at least one carboxy group. carboxylic acid dianion chebi_ontology carboxylic acid dianions CHEBI:38716 carboxylic acid dianion A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency. 0 C207H308N56O58S InChI=1S/C207H308N56O58S/c1-108(2)89-140(186(302)240-135(69-74-163(279)280)182(298)254-149(204(320)321)94-117-43-20-15-21-44-117)250-193(309)152-54-35-86-262(152)202(318)147(92-116-41-18-14-19-42-116)252-171(287)114(11)230-175(291)132(66-71-160(273)274)234-170(286)113(10)231-191(307)150(105-265)255-183(299)136(70-75-164(281)282)241-190(306)146(98-165(283)284)249-180(296)133(67-72-161(275)276)235-169(285)112(9)229-157(270)101-225-174(290)145(97-156(213)269)251-194(310)153-55-36-87-263(153)203(319)148(93-119-60-64-123(268)65-61-119)253-199(315)167(110(5)6)257-185(301)129(49-26-30-79-210)243-198(314)168(111(7)8)259-196(312)155-57-38-85-261(155)201(317)139(53-34-83-223-207(218)219)244-178(294)130(51-32-81-221-205(214)215)237-177(293)128(48-25-29-78-209)236-176(292)127(47-24-28-77-208)232-158(271)103-227-197(313)166(109(3)4)258-195(311)154-56-37-84-260(154)200(316)138(50-27-31-80-211)233-159(272)102-226-173(289)143(95-120-99-224-126-46-23-22-45-124(120)126)247-179(295)131(52-33-82-222-206(216)217)238-187(303)142(90-115-39-16-13-17-40-115)246-189(305)144(96-121-100-220-107-228-121)248-181(297)134(68-73-162(277)278)239-184(300)137(76-88-322-12)242-192(308)151(106-266)256-188(304)141(245-172(288)125(212)104-264)91-118-58-62-122(267)63-59-118/h13-23,39-46,58-65,99-100,107-114,125,127-155,166-168,224,264-268H,24-38,47-57,66-98,101-106,208-212H2,1-12H3,(H2,213,269)(H,220,228)(H,225,290)(H,226,289)(H,227,313)(H,229,270)(H,230,291)(H,231,307)(H,232,271)(H,233,272)(H,234,286)(H,235,285)(H,236,292)(H,237,293)(H,238,303)(H,239,300)(H,240,302)(H,241,306)(H,242,308)(H,243,314)(H,244,294)(H,245,288)(H,246,305)(H,247,295)(H,248,297)(H,249,296)(H,250,309)(H,251,310)(H,252,287)(H,253,315)(H,254,298)(H,255,299)(H,256,304)(H,257,301)(H,258,311)(H,259,312)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,320,321)(H4,214,215,221)(H4,216,217,222)(H4,218,219,223)/t112-,113-,114-,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,166-,167-,168-/m0/s1 IDLFZVILOHSSID-OVLDLUHVSA-N 4541.06600 4538.25937 CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(O)=O CAS:9002-60-2 DrugBank:DB01285 Drug_Central:4931 KEGG:C02017 KEGG:D00146 Corticotropin L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-alpha-aspartylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine chebi_ontology ACTH Adrenocorticotropic hormone SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF adrenocorticotropin corticotrofina corticotrophine corticotrophinum corticotropin cortrophin CHEBI:3892 corticotropin A molecular entity capable of donating a hydron to an acceptor (Bronsted base). Bronsted acid chebi_ontology Bronsted-Saeure acide de Bronsted donneur d'hydron hydron donor CHEBI:39141 Bronsted acid A molecular entity capable of accepting a hydron from a donor (Bronsted acid). Bronsted base chebi_ontology Bronsted-Base accepteur d'hydron base de Bronsted hydron acceptor CHEBI:39142 Bronsted base A molecular entity able to provide a pair of electrons and thus capable of forming a covalent bond with an electron-pair acceptor (Lewis acid), thereby producing a Lewis adduct. Lewis base chebi_ontology Lewis-Base base de Lewis donneur d'une paire d'electrons electron donor CHEBI:39144 Lewis base KEGG:C02019 Cyclic ketone cyclic ketones chebi_ontology CHEBI:3992 cyclic ketone -2 CO3 InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-2 BVKZGUZCCUSVTD-UHFFFAOYSA-L 60.00890 59.98584 [O-]C([O-])=O CHEBI:29201 CHEBI:41605 Beilstein:3600898 CAS:3812-32-6 Gmelin:1559 PDBeChem:CO3 carbonate trioxidocarbonate(2-) chebi_ontology CARBONATE ION CO3(2-) Karbonat [CO3](2-) CHEBI:41609 carbonate 0 HO 17.00734 17.00274 *O[H] CHEBI:24706 CHEBI:43171 PDBeChem:OH HYDROXY GROUP hydroxy hydroxy group chebi_ontology -OH hydroxyl hydroxyl group CHEBI:43176 hydroxy group -1 HO4S InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-1 QAOWNCQODCNURD-UHFFFAOYSA-M 97.07154 96.96010 [H]OS([O-])(=O)=O CHEBI:29199 CHEBI:45693 Gmelin:2121 hydrogen(tetraoxidosulfate)(1-) hydrogensulfate hydrogensulfate(1-) hydrogentetraoxosulfate(1-) hydrogentetraoxosulfate(VI) hydroxidotrioxidosulfate(1-) chebi_ontology HSO4(-) HYDROGEN SULFATE [SO3(OH)](-) CHEBI:45696 hydrogensulfate 0 O 15.99940 15.99491 O=* CHEBI:29353 CHEBI:44607 PDBeChem:O OXO GROUP oxo chebi_ontology =O CHEBI:46629 oxo group 0 CHO2 45.01744 44.99765 *C(=O)O CHEBI:23025 CHEBI:41420 PDBeChem:FMT CARBOXY GROUP carboxy chebi_ontology -C(O)OH -CO2H -COOH carboxyl group CHEBI:46883 carboxy group Any oxo steroid where an oxo substituent is located at position 3. 0 C19H29OR 273.434 273.22184 C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCC(C4)=O)C CHEBI:13607 CHEBI:1653 CHEBI:20182 CHEBI:71186 KEGG:C01876 MetaCyc:3-Oxosteroids PMID:9811880 chebi_ontology 3-Oxosteroid 3-oxo steroids 3-oxosteroids a 3-oxosteroid CHEBI:47788 3-oxo steroid Any steroid substituted by at least one carboxy group. chebi_ontology steroid acids CHEBI:47891 steroid acid A 3-oxo steroid conjugated to a C=C double bond at the alpha,beta position. 0 C19H27OR 271.418 271.20619 C12C(C3C(C(CC3)*)(C)CC1)CCC=4C2(CCC(C4)=O)C CHEBI:13604 CHEBI:1626 CHEBI:20157 KEGG:C00619 MetaCyc:3-Oxo-Delta-4-Steroids chebi_ontology 3-Oxo-delta4-steroid 3-oxo Delta(4)-steroid 3-oxo Delta(4)-steroids 3-oxo-Delta(4) steroids a 3-oxo-Delta(4)-steroid CHEBI:47909 3-oxo-Delta(4) steroid chebi_ontology Schwefeloxide oxides of sulfur sulfur oxides CHEBI:48154 sulfur oxide Substance which binds to cell receptors normally responding to naturally occurring substances and which produces a response of its own. agonist chebi_ontology agonista agoniste agonists CHEBI:48705 agonist 0 H InChI=1S/H YZCKVEUIGOORGS-UHFFFAOYSA-N 1.00794 1.00783 [H] CHEBI:24634 CHEBI:49636 WebElements:H hydrogen chebi_ontology 1H H Wasserstoff hidrogeno hydrogen hydrogene CHEBI:49637 hydrogen atom A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by organyl groups. chebi_ontology organic amino compounds CHEBI:50047 organic amino compound Any hormone that is responsible for controlling sexual characteristics and reproductive function. chebi_ontology Geschlechtshormon Geschlechtshormone Sexualhormon Sexualhormone hormone sexuelle hormones sexuelles sex hormones CHEBI:50112 sex hormone A sex hormone that stimulates or controls the development and maintenance of masculine characteristics in vertebrates by binding to androgen receptors. Androgen chebi_ontology Androgene androgene androgenes androgeno androgenos androgens CHEBI:50113 androgen Any anion formed by loss of a proton from a steroid acid. chebi_ontology steroid acid anions CHEBI:50160 steroid acid anion chebi_ontology canonical nucleotide residues CHEBI:50297 canonical nucleotide residue chebi_ontology canonical deoxyribonucleotide residues CHEBI:50298 canonical deoxyribonucleotide residue chebi_ontology canonical ribonucleotide residues CHEBI:50299 canonical ribonucleotide residue chebi_ontology CHEBI:50312 onium compound Mononuclear cations derived by addition of a hydron to a mononuclear parent hydride of the pnictogen, chalcogen and halogen families. onium cations chebi_ontology onium cations onium ion onium ions CHEBI:50313 onium cation chebi_ontology nucleotide residues CHEBI:50319 nucleotide residue chebi_ontology nucleoside residues CHEBI:50320 nucleoside residue A univalent organyl group obtained by cleaving the bond from C-2 to the side chain of a proteinogenic amino-acid. chebi_ontology canonical amino-acid side-chain canonical amino-acid side-chains proteinogenic amino-acid side-chain proteinogenic amino-acid side-chain groups proteinogenic amino-acid side-chains CHEBI:50325 proteinogenic amino-acid side-chain group 0 C3H5O2 73.07060 73.02895 C(CC(=O)O)* 2-carboxyethyl chebi_ontology glutamic acid side-chain CHEBI:50329 2-carboxyethyl group Any steroid based on an androstane skeleton and its derivatives. chebi_ontology androstanoids CHEBI:50402 androstanoid Any molecular entity that contains carbon. CHEBI:25700 CHEBI:33244 chebi_ontology organic compounds organic entity organic molecular entities CHEBI:50860 organic molecular entity A role is particular behaviour which a material entity may exhibit. chebi_ontology CHEBI:50906 role A poison that interferes with the functions of the nervous system. CHEBI:50911 Wikipedia:Neurotoxin chebi_ontology agente neurotoxico nerve poison nerve poisons neurotoxic agent neurotoxic agents neurotoxicant neurotoxins CHEBI:50910 neurotoxin A role played by the molecular entity or part thereof within a chemical context. chebi_ontology CHEBI:51086 chemical role CHEBI:25556 CHEBI:7594 KEGG:C06061 chebi_ontology Nitrogenous compounds nitrogen compounds nitrogen molecular entities CHEBI:51143 nitrogen molecular entity An organic molecule that is electrically neutral carrying a positive and a negative charge in one of its major canonical descriptions. In most dipolar compounds the charges are delocalized; however the term is also applied to species where this is not the case. chebi_ontology dipolar compounds CHEBI:51151 dipolar compound Any organic substituent group, regardless of functional type, having two free valences at carbon atom(s). chebi_ontology organodiyl groups CHEBI:51422 organodiyl group chebi_ontology CHEBI:51446 organic divalent group chebi_ontology CHEBI:51447 organic univalent group An alpha,beta-unsaturated ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) in which the C=O function is conjugated to a C=C double bond at the alpha,beta position. 0 C3OR4 52.03150 51.99491 [*]\C([*])=C(\[*])C([*])=O Wikipedia:Enone chebi_ontology enones CHEBI:51689 enone A ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) or R(1)C#C-C(=O)R(2) (R(2) =/= H) in which the ketonic C=O function is conjugated to an unsaturated C-C bond at the alpha,beta position. chebi_ontology alpha,beta-unsaturated ketones CHEBI:51721 alpha,beta-unsaturated ketone chebi_ontology organic polycyclic compounds CHEBI:51958 organic polycyclic compound A biological role played by the molecular entity or part thereof within a biochemical context. chebi_ontology CHEBI:52206 biochemical role A role played by the molecular entity or part thereof which causes the development of a pathological process. chebi_ontology etiopathogenetic agent etiopathogenetic role CHEBI:52209 aetiopathogenetic role A biological role which describes how a drug interacts within a biological system and how the interactions affect its medicinal properties. chebi_ontology CHEBI:52210 pharmacological role chebi_ontology CHEBI:52211 physiological role Any substance introduced into a living organism with therapeutic or diagnostic purpose. CHEBI:33293 CHEBI:33294 chebi_ontology farmaco medicament pharmaceuticals CHEBI:52217 pharmaceutical The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds. chebi_ontology antigenic determinant epitope function epitope role CHEBI:53000 epitope A polymer carrying multiple negative charges. chebi_ontology polyanion polyanions CHEBI:53309 polyanionic macromolecule A macromolecule containing ionic groups. chebi_ontology ionic polymer polyionic macromolecule CHEBI:53368 ionic macromolecule A 29-amino acid peptide hormone consisting of His, Ser, Gln, Gly, Thr, Phe, Thr, Ser, Asp, Tyr, Ser, Lys, Tyr, Leu, Asp, Ser, Arg, Arg, Ala, Gln, Asp, Phe, Val, Gln, Trp, Leu, Met, Asn and Thr residues joined in sequence. 0 C153H225N43O49S InChI=1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 3482.74700 3480.61570 CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAS:16941-32-5 CAS:9007-92-5 DrugBank:DB00040 Drug_Central:2994 KEGG:C01501 KEGG:D00116 PMID:21940356 PMID:22014161 PMID:22154917 PMID:22166985 PMID:22167521 PMID:22214853 PMID:22227186 PMID:22286080 PMID:22294753 PMID:22318544 PMID:22334714 PMID:22399501 PMID:22438981 PMID:22454291 Reaxys:13191924 Wikipedia:Glucagon Glucagon L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine chebi_ontology Glucagone HSQGTFTSDYSKYLDSRRAQDFVQWLMNT His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr glucagon glucagonum CHEBI:5391 glucagon A cyclic compound having as ring members atoms of at least two different elements. Heterocyclic compound chebi_ontology compuesto heterociclico compuestos heterociclicos heterocycle heterocyclic compounds CHEBI:5686 heterocyclic compound A dicarboxylic acid dianion obtained by deprotonation of the two carboxy groups of bilirubin; major species at pH 7.3. -2 C33H34N4O6 InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/p-2/b26-13-,27-14- BPYKTIZUTYGOLE-IFADSCNNSA-L 582.64630 582.24893 CC1=C(C=C)\C(NC1=O)=C\c1[nH]c(Cc2[nH]c(\C=C3NC(=O)C(C=C)=C/3C)c(C)c2CCC([O-])=O)c(CCC([O-])=O)c1C Beilstein:4083310 chebi_ontology 2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate bilirubin IXalpha bilirubin dianion CHEBI:57977 bilirubin(2-) An ammonium ion that is the conjugate acid of histamine protonated on the side-chain nitrogen. +1 C5H10N3 InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)/p+1 NTYJJOPFIAHURM-UHFFFAOYSA-O 112.15300 112.08692 [NH3+]CCc1c[nH]cn1 2-(1H-imidazol-4-yl)ethanaminium chebi_ontology histamine histaminium cation CHEBI:58432 histaminium An organic anion of general formula RS(=O)2O(-) where R is an organyl group. -1 O4SR 96.06300 95.95173 [O-]S(=O)(=O)O[*] chebi_ontology organosulfate oxoanions CHEBI:58958 organosulfate oxoanion An organic anion arising from deprotonation of a acyclic tetrapyrrole compound. chebi_ontology acyclic tetrapyrrole anion acyclic tetrapyrrole anions linear tetrapyrrole anions CHEBI:59252 linear tetrapyrrole anion A reagent that forms a bond to its reaction partner (the electrophile) by donating both bonding electrons. chebi_ontology nucleophile nucleophiles nucleophilic reagents CHEBI:59740 nucleophilic reagent A chemical substance is a portion of matter of constant composition, composed of molecular entities of the same type or of different types. chebi_ontology Chemische Substanz CHEBI:59999 chemical substance A mixture is a chemical substance composed of multiple molecules, at least two of which are of a different kind. chebi_ontology Mischung CHEBI:60004 mixture A polymer is a mixture, which is composed of macromolecules of different kinds and which may be differentiated by composition, length, degree of branching etc.. Wikipedia:Polymer Polymer chebi_ontology Kunststoff CHEBI:60027 polymer An ionic polymer is a polymer, composed of ionic macromolecules. chebi_ontology polyionic polymer CHEBI:60164 ionic polymer An atom or small molecule with a positive charge that does not contain carbon in covalent linkage, with a valency of one. chebi_ontology a monovalent cation CHEBI:60242 monovalent inorganic cation Zwitterionic form of any peptide where, in general, the amino terminus is positively charged and the carboxy terminus is negatively charged. 0 C2H4NO2R(C2H2NOR)n chebi_ontology peptide zwitterions CHEBI:60466 peptide zwitterion Any compound that has a nucleobase as a part. chebi_ontology nucleobase-containing compound nucleobase-containing compounds nucleobase-containing molecular entities CHEBI:61120 nucleobase-containing molecular entity A polymer, composed of polyanion macromolecules. chebi_ontology polyanion polyanions CHEBI:61469 polyanionic polymer Zwitterionic form of a polar amino acid having an anionic carboxy group and a protonated amino group. 0 C2H4NO2R 74.059 74.02420 C(C([O-])=O)(*)[NH3+] MetaCyc:Polar-amino-acids chebi_ontology a polar amino acid CHEBI:62031 polar amino acid zwitterion A substance that removes electrons from another reactant in a redox reaction. chebi_ontology oxidant oxidants oxidiser oxidisers oxidising agents oxidizer oxidizers oxidizing agent oxidizing agents CHEBI:63248 oxidising agent Any organooxygen compound derived from a carbohydrate by replacement of one or more hydroxy group(s) by an amino group, a thiol group or similar heteroatomic groups. The term also includes derivatives of these compounds. chebi_ontology carbohydrate derivatives derivatised carbohydrate derivatised carbohydrates derivatized carbohydrate derivatized carbohydrates CHEBI:63299 carbohydrate derivative A carbohydrate derivative that is formally obtained from a carbohydrate acid. chebi_ontology carbohydrate acid derivatives CHEBI:63436 carbohydrate acid derivative A carboxylic acid anion resulting from the deprotonation of the carboxy group of a carbohydrate acid derivative. chebi_ontology carbohydrate acid anion derivative carbohydrate acid anion derivatives carbohydrate acid derivative anions CHEBI:63551 carbohydrate acid derivative anion Any substance which is added to food to preserve or enhance its flavour and/or appearance. Wikipedia:Food_additive chebi_ontology food additives CHEBI:64047 food additive An organic amino compound in which an aminoalkyl group is linked to an arene. chebi_ontology aralkylamino compounds CHEBI:64365 aralkylamino compound A fourteen-membered heterodetic cyclic peptide comprising the sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys cyclised by a disulfide bridge between the two Cys residues at positions 3 and 14. 0 C76H104N18O19S2 InChI=1S/C76H104N18O19S2/c1-41(79)64(100)82-37-61(99)83-58-39-114-115-40-59(76(112)113)92-72(108)57(38-95)91-75(111)63(43(3)97)94-71(107)54(33-46-23-11-6-12-24-46)90-74(110)62(42(2)96)93-66(102)51(28-16-18-30-78)84-69(105)55(34-47-36-81-49-26-14-13-25-48(47)49)88-68(104)53(32-45-21-9-5-10-22-45)86-67(103)52(31-44-19-7-4-8-20-44)87-70(106)56(35-60(80)98)89-65(101)50(85-73(58)109)27-15-17-29-77/h4-14,19-26,36,41-43,50-59,62-63,81,95-97H,15-18,27-35,37-40,77-79H2,1-3H3,(H2,80,98)(H,82,100)(H,83,99)(H,84,105)(H,85,109)(H,86,103)(H,87,106)(H,88,104)(H,89,101)(H,90,110)(H,91,111)(H,92,108)(H,93,102)(H,94,107)(H,112,113)/t41-,42+,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,59-,62-,63-/m0/s1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 1637.87800 1636.71666 C[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC1=O)[C@@H](C)O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N CAS:38916-34-6 Drug_Central:2997 HMDB:HMDB0013072 KEGG:C16022 KEGG:D07431 LINCS:LSM-5326 PMID:21922516 PMID:22129035 PMID:22147011 PMID:22251942 PMID:22483686 PMID:22509294 Reaxys:10148626 Wikipedia:Somatostatin L-alanyl-N-[(4R,7S,10S,13S,16S,19S,22S,25S,28S,31S,34S,37R)-19,34-bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-13,25,28-tribenzyl-4-carboxy-10,16-bis[(1R)-1-hydroxyethyl]-7-(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6,9,12,15,18,21,24,27,30,33,36-undecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35-undecaazacyclooctatriacontan-37-yl]glycinamide chebi_ontology Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide Somatostatin-1 Somatostatin-14 Synthetic growth hormone release-inhibiting hormone somatostatin somatostatina somatostatine somatostatinum CHEBI:64628 somatostatin An organic molecular entity containing a single carbon atom (C1). chebi_ontology one-carbon compounds CHEBI:64708 one-carbon compound Any organic molecular entity that is acidic and contains carbon in covalent linkage. chebi_ontology organic acids CHEBI:64709 organic acid Any substance that causes disturbance to organisms by chemical reaction or other activity on the molecular scale, when a sufficient quantity is absorbed by the organism. Wikipedia:Poison chebi_ontology poisonous agent poisonous agents poisonous substance poisonous substances poisons toxic agent toxic agents toxic substance toxic substances CHEBI:64909 poison A carbohydrate derivative that is any derivative of a polysaccharide. chebi_ontology polysaccharide derivatives CHEBI:65212 polysaccharide derivative Any compound that has anti-inflammatory effects. chebi_ontology anti-inflammatory agents antiinflammatory agent antiinflammatory agents CHEBI:67079 anti-inflammatory agent Any monocyclic heteroarene consisting of a five-membered ring containing nitrogen. Azoles can also contain one or more other non-carbon atoms, such as nitrogen, sulfur or oxygen. Wikipedia:Azole chebi_ontology azoles CHEBI:68452 azole A bicyclic macrolide natural product consisting of a 16-membered bicyclic lactone attached to the rare 2-thiazolidinone moiety. It is obtained from the Red Sea sponge Latrunculia magnifica and from the Fiji Islands sponge Cacospongia mycofijiensis. Latrunculin A inhibits actin polymerisation, microfilament organsation and microfilament-mediated processes. 0 C22H31NO5S InChI=1S/C22H31NO5S/c1-15-7-5-3-4-6-8-16(2)11-20(24)27-18-12-17(10-9-15)28-22(26,13-18)19-14-29-21(25)23-19/h3-5,7,11,15,17-19,26H,6,8-10,12-14H2,1-2H3,(H,23,25)/b4-3+,7-5-,16-11-/t15-,17-,18-,19+,22-/m1/s1 DDVBPZROPPMBLW-IZGXTMSKSA-N 421.55000 421.192 [H][C@]1(CSC(=O)N1)[C@@]1(O)C[C@H]2C[C@@H](CC[C@H](C)\C=C/C=C/CC\C(C)=C/C(=O)O2)O1 CHEBI:43626 CAS:76343-93-6 PDBeChem:LAR PMID:10859320 PMID:12087066 PMID:17897856 PMID:19528469 PMID:20677927 PMID:22492972 PMID:22498812 PMID:3200109 PMID:3556584 PMID:9250716 Reaxys:4239363 (4R)-4-[(1R,4Z,8E,10Z,12S,15R,17R)-17-hydroxy-5,12-dimethyl-3-oxo-2,16-dioxabicyclo[13.3.1]nonadeca-4,8,10-trien-17-yl]-1,3-thiazolidin-2-one LATRUNCULIN A chebi_ontology (+)-latrunculin A (4R)-4-[(1R,4Z,8E,10Z,12S,15R,17R)-17-hydroxy-5,12-dimethyl-3-oxo-2,16-dioxabicyclo[13.3.1]nonadeca-4,8,10-trien-17-yl]-1,3-thiazolidin-2-one LAT-A LatA NSC 613011 CHEBI:69136 latrunculin A Any molecule that consists of at least one carbon atom as part of the electrically neutral entity. chebi_ontology organic compound organic compounds organic molecules CHEBI:72695 organic molecule A biomacromolecule composed of carbohydrate residues which is secreted by a microorganism into the surrounding environment. MetaCyc:Exopolysaccharides PMID:11160795 PMID:11785425 PMID:1444258 PMID:15738217 PMID:16075348 PMID:17440912 PMID:18097339 PMID:19453747 PMID:20172021 PMID:20631870 PMID:20718297 PMID:2688547 PMID:6354590 Wikipedia:Exopolysaccharide Wikipedia:Extracellular_polymeric_substance chebi_ontology exopolysaccharides extracellular polymeric substance extracellular polymeric substances CHEBI:72813 exopolysaccharide Any metabolite produced during a metabolic reaction in eukaryotes, the taxon that include members of the fungi, plantae and animalia kingdoms. chebi_ontology eukaryotic metabolites CHEBI:75763 eukaryotic metabolite Any eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals. CHEBI:77721 CHEBI:77743 chebi_ontology animal metabolites CHEBI:75767 animal metabolite Any animal metabolite produced during a metabolic reaction in mammals. CHEBI:77464 CHEBI:77744 chebi_ontology mammalian metabolites CHEBI:75768 mammalian metabolite Any mammalian metabolite produced during a metabolic reaction in a mouse (Mus musculus). chebi_ontology Mus musculus metabolite Mus musculus metabolites mouse metabolites CHEBI:75771 mouse metabolite Any fungal metabolite produced during a metabolic reaction in Baker's yeast (Saccharomyces cerevisiae). CHEBI:76949 CHEBI:76951 chebi_ontology S. cerevisiae metabolite S. cerevisiae metabolites S. cerevisiae secondary metabolite S. cerevisiae secondary metabolites Saccharomyces cerevisiae metabolites Saccharomyces cerevisiae secondary metabolites baker's yeast metabolite baker's yeast metabolites baker's yeast secondary metabolite baker's yeast secondary metabolites CHEBI:75772 Saccharomyces cerevisiae metabolite Any metabolite produced during a metabolic reaction in prokaryotes, the taxon that include members of domains such as the bacteria and archaea. chebi_ontology prokaryotic metabolites CHEBI:75787 prokaryotic metabolite Any enzyme inhibitor that interferes with the action of a hydrolase (EC 3.*.*.*). Wikipedia:Hydrolase chebi_ontology EC 3.* (hydrolase) inhibitors EC 3.* inhibitor EC 3.* inhibitors EC 3.*.*.* inhibitor EC 3.*.*.* inhibitors hydrolase (EC 3.*) inhibitor hydrolase (EC 3.*) inhibitors hydrolase inhibitor hydrolase inhibitors CHEBI:76759 EC 3.* (hydrolase) inhibitor Any hydrolase inhibitor that interferes with the action of a hydrolase acting on C-N bonds, other than peptide bonds (EC 3.5.*.*). chebi_ontology EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors EC 3.5.* inhibitor EC 3.5.* inhibitors CHEBI:76764 EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor An EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor that interferes with the action of any non-peptide linear amide C-N hydrolase (EC 3.5.1.*). chebi_ontology EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors EC 3.5.1.* inhibitor EC 3.5.1.* inhibitors non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors CHEBI:76807 EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor Any eukaryotic metabolite produced during a metabolic reaction in fungi, the kingdom that includes microorganisms such as the yeasts and moulds. CHEBI:75765 CHEBI:76947 chebi_ontology fungal metabolites CHEBI:76946 fungal metabolite Any prokaryotic metabolite produced during a metabolic reaction in bacteria. CHEBI:75760 CHEBI:76970 chebi_ontology CHEBI:76969 bacterial metabolite Any bacterial metabolite produced during a metabolic reaction in Escherichia coli. chebi_ontology E.coli metabolite E.coli metabolites Escherichia coli metabolites CHEBI:76971 Escherichia coli metabolite Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens). CHEBI:75770 CHEBI:77123 chebi_ontology H. sapiens metabolite H. sapiens metabolites Homo sapiens metabolite Homo sapiens metabolites CHEBI:77746 human metabolite An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the action of amidase (EC 3.5.1.4). Wikipedia:Amidase chebi_ontology EC 3.5.1.4 (amidase) inhibitors EC 3.5.1.4 inhibitor EC 3.5.1.4 inhibitors N-acetylaminohydrolase inhibitor N-acetylaminohydrolase inhibitors acylamidase inhibitor acylamidase inhibitors acylamide amidohydrolase inhibitor acylamide amidohydrolase inhibitors amidase (EC 3.5.1.4) inhibitor amidase (EC 3.5.1.4) inhibitors amidase inhibitor amidase inhibitors amidohydrolase inhibitor amidohydrolase inhibitors deaminase inhibitor deaminase inhibitors fatty acylamidase inhibitor fatty acylamidase inhibitors CHEBI:77941 EC 3.5.1.4 (amidase) inhibitor A food additive that is a (generally inert) gas which is used to envelop foodstuffs during packing and so protect them from unwanted chemical reactions such as food spoilage or oxidation during subsequent transport and storage. The term includes propellant gases, used to expel foods from a container. Wikipedia:Packaging_gas chebi_ontology food packaging gases CHEBI:77974 food packaging gas A physiological role played by any substance that is distributed in foodstuffs. It includes materials derived from plants or animals, such as vitamins or minerals, as well as environmental contaminants. chebi_ontology dietary component dietary components food components CHEBI:78295 food component A substance used in a thermodynamic heat pump cycle or refrigeration cycle that undergoes a phase change from a gas to a liquid and back. Refrigerants are used in air-conditioning systems and freezers or refrigerators and are assigned a "R" number (by ASHRAE - formerly the American Society of Heating, Refrigerating and Air Conditioning Engineers), which is determined systematically according to their molecular structure. Wikipedia:Refrigerant chebi_ontology refrigerants CHEBI:78433 refrigerant An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of any alpha-amino acid; major species at pH 7.3. 0 C2H4NO2R 74.059 74.02420 [NH3+]C([*])C([O-])=O CHEBI:83409 MetaCyc:Alpha-Amino-Acids chebi_ontology an alpha-amino acid CHEBI:78608 alpha-amino acid zwitterion Any organooxygen compound that is a polyhydroxy-aldehyde or -ketone, or a compound derived from one. Carbohydrates contain only carbon, hydrogen and oxygen and usually have an empirical formula Cm(H2O)n; carbohydrate derivatives may contain other elements by substitution or condensation. chebi_ontology carbohydrates and derivatives carbohydrates and their derivatives CHEBI:78616 carbohydrates and carbohydrate derivatives Any metabolite produced by all living cells. chebi_ontology essential metabolite essential metabolites fundamental metabolites CHEBI:78675 fundamental metabolite Any organic molecular entity that contains at least one C=C bond. chebi_ontology olefinic compounds CHEBI:78840 olefinic compound Any inorganic anion with a valency of two. chebi_ontology divalent inorganic anions CHEBI:79388 divalent inorganic anion Any inorganic anion with a valency of one. chebi_ontology monovalent inorganic anions CHEBI:79389 monovalent inorganic anion An animal metabolite produced by arthropods such as crabs, lobsters, crayfish, shrimps and krill. chebi_ontology crustacean metabolites CHEBI:83039 crustacean metabolite A Daphnia metabolite produced by the species Daphnia magna. chebi_ontology Daphnia magna metabolites CHEBI:83056 Daphnia magna metabolite A crustacean metabolite produced by the genus of small planktonic arthropods, Daphnia Wikipedia:Daphnia chebi_ontology Daphnia metabolites CHEBI:83057 Daphnia metabolite A family of cyclic nonapeptide hormones found in most mammals. Synthesised in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Together with the similar neuropeptide oxytocin, they are believed to influence social cognition and behaviour. 0 C46H65N15O12S2.C46H65N13O12S2 2140.458 2138.86956 CAS:11000-17-2 KEGG:C00840 KEGG:D00101 PMID:18988842 PMID:20445498 Vasopressin chebi_ontology ADH AVP Antidiuretic hormone Inyectable de vasopresina Solute injectable de vasopressine VP Vasopressini injectio arginine vasopressin argipressin beta-Hypophamine CHEBI:9937 vasopressin a maintaining cell culture process that keeps cell line cell alive and actively cultured. YH cell line cell culturing cell line cell A cultured cell that is part of a cell line - a stable and homogeneous population of cells with a common biological origin and propagation history in culture A cultured cell that is part of a cell line - a stable and homogeneous population of cells with a common biological origin and propagation history in culture Yongqun He, Matthew Brush, Sirarat Sarntivijai, Alexander Diehl, Jie Zheng, Yu Lin, Bjoern Peters A 'cell line cell' is a part of a cell line established through the passaging/selection of a primary cultured cells or the experimental modification of an existing cell line. New types of cell line cells are established after sufficient passaging of a primary culture to establish a stable and homogenous population that qualifies as a line (typically 1-20 passages), or following some spontaneous or experimental modification that confers novel characteristics to an existing line. A cell line cell typically has mutations of five or more genes compared to the original cell that derives the cell line cell. Some gene mutations may turn on some oncogenes. Cell line cells can be in active culture, stored in a quiescent state for future use (e.g. frozen in liquid nitrogen), or applied in experimental procedures. cell line cell suspension cell line culturing is a cell line culturing method where cells do not require a surface for growth and differentiation. This method is appropriate for cells that are adapted to suspension culture or cells that are non-adhesive (e.g. hematopoietic cells) suspension cell line culturing adherent cell line culturing is a cell line culturing method where cells require a surface for growth and differentiation. adherent cell line culturing a material processing that modifies an existing cell line cell to generate another cell line cell. Yongqun He cell line cell modification a role that inheres in a cell line repository organization. SS, YH cell line repository role an organization that serves as a repository of cell lines. SS, YH cell line repository adherent on coated surface cell line culturing is an adherent cell line culturing method that the surface is coated with extracellular matrix component to increase adhesion properties and provide other signals needed for growth and differentiation. adherent on coated surface cell line culturing a cell line cell that is in the ATCC cell line repository SS, YH, UV, SS ATCC cell line ATCC cell line cell a cell line cell that is in the HyperCLDB cell line repository SS, YH, UV, SS HyperCLDB cell line HyperCLDB cell line cell an immortal human lymphocyte cell line cell that is derived from T cell. YH immortal human T cell line cell adherent on feeder cells cell line culturing adherent-patchy cell line culturing loosely adherent cell line culturing mouse, Swiss albino A cell line cell that is capable of replicating a limited number of times in culture before undergoing senescence. Yongqun He, Matthew Brush, Sirarat Sarntivijai finite cell line cell mortal cell line cell immortal cell line cell A cell line cell that is expected to be capable of an unlimited number of divisions, and is thus able to support indefinite propagation in vitro as part of an immortal cell line. Yongqun He, Matthew Brush, Allen Xiang, Asiyah Yu Lin, Sirarat Sarntivijai, James Malone, Jie Zheng, Tomasz Adamusiak continuous cell line cell permanent cell line cell immortal cell line cell YH a immortal cell line that is dervied from human tissue. immortal human cell line immortal human cell line cell An immortal skin-derived cell line cell that derives from cat. Yongqun He immortal cat cell line cell An immortal skin-derived cell line cell that derives from frog. Yongqun He immortal frog cell line cell an immortal cell line cell that is generated by fusing two different types of cells. One of the parent cells is typically a cancer cell. Yongqun He immortal hybrid cell line cell An immortal cell line cell that derives from zebra fish. Yongqun He immortal zebra fish cell line cell mouse immortal cell line mouse immortal cell line cell a cell line that requires suspension cell cuturing. suspension cell line suspension cell line cell a cell line that is cultured through adherence cell culturing. adherent cell line adherent cell line cell a cell culture growth mode that indicates a cell needs to adhere to a cell culture plate to grow. YH adherent cell culture growth mode a cell culture growth mode that indicates a cell can grow when the cell is suspended in cell culture medium. YH suspension cell culture growth mode a disposition that represents a mode of cell culture growth, i.e., the cell will grow at a specific cell culture mode. For example, an adherent cell culture growh mode means that the cell will grow when the cell is adhere to a cell culture plate. YH cell culture growth mode cell line He, Tong-Chuan, et al., Identification of c-MYC as a target of the APC pathway. Science 281.5382 (1998): 1509-1512.: "To evaluate the transcriptional effects of APC, we studied a human colorectal cancer cell line (HT29-APC) containing a zinc-inducible APC gene and a control cell line (HT29–β-Gal) containing an analogous inducible lacZ gene". Note that common usage in the literature is often of the form "a human colorectal cancer cell line", as seen above. But such references to studies in "a line" refer to the fact that discrete populations of cells that are input into culturing or experiments, not an entire lineage of cells. It is these discrete populations that we refer to as 'cell lines'. A cultured cell population that represents a genetically stable and homogenous population of cultured cells that shares a common propagation history (i.e. has been successively passaged together in culture). A cultured cell population that represents a genetically stable and homogenous population of cultured cells that shares a common propagation history (i.e. has been successively passaged together in culture). In the spring of 2013, a working group comprised of domain experts and representatives from CLO, OBI, CL, and ReO worked to establish a consensus model and definitions of cultured cells across these efforts. This included a careful characterization of how the term 'cell line' should be defined and applied. Notes about this work and its outcomes can be found on the CLO wiki here: http://code.google.com/p/clo-ontology/wiki/Cell_Lines MB, SS, JZ, MAH, BP, CS, YH The term 'line' is used when a culture has undergone an intentional experimental process to establish a more uniform and stable population of cells (see 'establishing cell line'). This will require one or more passages, but may involve additional selection processes. Through such passaging and/or selection processes, the resulting 'line' attains some level of genetic stability and compositional homogeneity which is typically absent in primary cultures. Because of their relative homogeneity, ‘lines’ are capable of being characterized and stably propagated over a period of time. A new *type* of cell line can be established not only through the passaging/selection of a primary culture, but also through experimental modifications of existing lines (e.g. immortalization, stable genetic modifications, drug selection for a resistant subset, etc.). The definition provided here establishes the 'scale' of cell populations that qualify as cell lines - specifically those with a shared propagation history in culture. In this way, the 'cell line' class demarcates populations that represent what researchers actually use in the practice of science - e.g. as inputs to culturing, experimentation, and sharing. The definition is such that cell lines will exhibit important attributes. For example, they will have a relatively homogenous cell type composition as they have experienced similar selective pressures due to their continuous co-propagation. In addition, these populations can also be characterized by a passage number, again owing to their common passaging history.  As defined here, 'cell line' can refer to a population of cells in active culture, applied experimentally, or stored in a quiescent state for future use. cell line mixed adherent and suspension cell line culturing mixed suspension clusters in suspension cell line culturing Oliver Note: this term needs precise definition. will consult term users later. cell line co-expression Ba/F3 Stably co-expresses EpoR and JAK2V617F EpoR and JAK2V617F constructs Ba/F3 cell line co-expression Ba/F3 cell line EpoR and JAK2V617F co-expression CHO cell line co-expression CHO Established (in your ontology) Stably transfected with Cre-beta lactamase: Cre Bla CHO cell line CHO cell line co-expression of lactamase suspension with feeder cells cell line culturing suspension-multicell aggregates cell line culturing a immortal cell line that is dervied from mouse tissue. Yue Liu, Yongqun He immortal mouse cell line immortal mouse cell line cell YH a immortal cell line that is dervied from mouse macrophage. immortal mouse macrophage cell line a cell line that is derived from stem cell ZX, YH immortal stem cell line cell YH a immortal cell line that is dervied from mouse liver. immortal mouse liver cell line YH a immortal cell line that is dervied from a Gorilla gorilla tissue. immortal Gorilla gorilla cell line immortal Gorilla gorilla cell line cell a immortal stem cell line that is derived from somatic stem cell ZX, YH immortal somatic stem cell line cell a immortal somatic stem cell line that is derived from epithelial fate stem cell ZX, YH immortal epithelial fate stem cell line cell a immortal epithelial fate stem cell line that is derived from basal cell ZX, YH immortal basal cell line cell a immortal somatic stem cell line that is derived from multi fate stem cell ZX, YH immortal multi fate stem cell line cell a immortal multi fate stem cell line that is derived from neuronal stem cell ZX, YH immortal neuronal stem cell line cell a immortal neuronal stem cell line that is derived from neuroblast ZX, YH immortal neuroblast cell line cell a immortal multi fate stem cell line that is derived from mesenchymal cell ZX, YH immortal mesenchymal cell line cell a cell line that is derived from non-terminally differentiated cell ZX, YH immortal non-terminally differentiated cell line immortal non-terminally differentiated cell line cell a immortal non-terminally differentiated cell line that is derived from osteoblast ZX, YH immortal osteoblast cell line immortal osteoblast cell line cell a immortal non-terminally differentiated cell line that is derived from muscle precursor cell ZX, YH immortal muscle precursor cell line immortal muscle precursor cell line cell a immortal muscle precursor cell line that is derived from myoblast ZX, YH immortal myoblast cell line immortal myoblast cell line cell a immortal myoblast cell line that is derived from fusion competent myoblast ZX, YH immortal fusion competent myoblast cell line immortal fusion competent myoblast cell line cell a cell line that is derived from secretory cell ZX, YH immortal secretory cell line immortal secretory cell line cell a immortal secretory cell line that is derived from glandular epithelial cell ZX, YH immortal glandular epithelial cell line cell a immortal glandular epithelial cell line cell that is derived from chromophil cell of anterior pituitary gland ZX, YH immortal anterior pituitary gland chromophil cell line cell a immortal chromophil cell line cell of anterior pituitary gland that is derived from thyrotroph ZX, YH immortal thyrotroph cell line cell a immortal chromophil cell line of anterior pituitary gland that is derived from acidophil cell of pars distalis of adenohypophysis ZX, YH immortal pars distalis of adenohypophysis acidophil cell line cell a immortal glandular epithelial cell line that is derived from neck cell ZX, YH immortal neck cell line cell a immortal glandular epithelial cell line that is derived from glandular cell of stomach ZX, YH immortal glandular cell line of stomach cell a immortal glandular cell line of stomach that is derived from parietal cell ZX, YH immortal parietal cell line cell a immortal secretory cell line that is derived from exocrine cell ZX, YH immortal exocrine cell line immortal exocrine cell line cell a immortal secretory cell line that is derived from endocrine cell ZX, YH immortal endocrine cell line immortal endocrine cell line cell a immortal endocrine cell line that is derived from mast cell ZX, YH immortal mast cell line immortal mast cell line cell a immortal endocrine cell line cell that is derived from neuroendocrine cell ZX, YH immortal neuroendocrine cell line cell a immortal endocrine cell line that is derived from Leydig cell ZX, YH immortal Leydig cell line immortal Leydig cell line cell a immortal secretory cell line cell that is derived from Sertoli cell ZX, YH immortal Sertoli cell line cell a immortal secretory cell line that is derived from plasma cell ZX, YH immortal plasma cell line immortal plasma cell line cell an immortal cell line cell that is derived from contractile cell ZX, YH immortal contractile cell line cell a immortal contractile cell line cell that is derived from myofibroblast cell ZX, YH immortal myofibroblast cell line cell a immortal contractile cell line cell that is derived from muscle cell ZX, YH immortal muscle cell line cell a immortal muscle cell line cell that is derived from skeletal muscle cell ZX, YH immortal skeletal muscle cell line cell a immortal muscle cell line cell that is derived from smooth muscle cell ZX, YH immortal smooth muscle cell line cell an immortal cell line cell that is derived from electrically active cell ZX, YH immortal electrically active cell line cell a immortal electrically active cell line cell that is derived from electrically responsive cell ZX, YH immortal electrically responsive cell line cell a immortal electrically responsive cell line cell that is derived from neuron ZX, YH immortal neuron cell line cell a immortal neuron cell line cell that is derived from bipolar neuron ZX, YH immortal bipolar neuron cell line cell a immortal bipolar neuron cell line cell that is derived from ON-bipolar cell ZX, YH immortal ON-bipolar cell line cell a immortal neuron cell line cell that is derived from peripheral neuron ZX, YH immortal peripheral neuron cell line cell a immortal neuron cell line cell that is derived from stellate cell ZX, YH immortal stellate cell line cell an immortal cell line cell that is derived from barrier cell ZX, YH immortal barrier cell line cell an immortal barrier cell line cell that is derived from lining cell ZX, YH immortal lining cell line cell a immortal lining cell line cell that is derived from mesothelial cell ZX, YH immortal mesothelial cell line cell a immortal mesothelial cell line cell that is derived from seminiferous tubule epithelial cell ZX, YH immortal seminiferous tubule epithelial cell line cell a immortal seminiferous tubule epithelial cell line cell that is derived from spermatocyte ZX, YH immortal spermatocyte cell line cell a immortal lining cell line cell that is derived from endothelial cell ZX, YH immortal endothelial cell line cell a immortal barrier cell line cell that is derived from myelinating Schwann cell ZX, YH immortal myelinating Schwann cell line cell a cell line that is derived from motile cell ZX, YH immortal motile cell line immortal motile cell line cell a immortal motile cell line that is derived from phagocyte ZX, YH immortal phagocyte cell line cell a immortal phagocyte cell line that is derived from mononuclear phagocyte ZX, YH immortal mononuclear phagocyte cell line cell a immortal phagocyte cell line that is derived from macrophage ZX, YH immortal macrophage cell line cell a immortal macrophage cell line that is derived from tissue-resident macrophage ZX, YH immortal tissue-resident macrophage cell line cell a immortal tissue-resident macrophage cell line that is derived from microglial cell ZX, YH immortal microglial cell line cell a immortal tissue-resident macrophage cell line that is derived from peritoneal macrophage ZX, YH immortal peritoneal macrophage cell line cell a immortal phagocyte cell line that is derived from polygonal cell ZX, YH immortal polygonal cell line immortal polygonal cell line cell a immortal motile cell line that is derived from amoeboid cell ZX, YH immortal amoeboid cell line immortal amoeboid cell line cell a immortal motile cell line that is derived from leukocyte ZX, YH immortal leukocyte cell line immortal leukocyte cell line cell a immortal leukocyte cell line that is derived from dendritic cell ZX, YH immortal dendritic cell line immortal dendritic cell line cell a immortal dendritic cell line that is derived from Langerhans cell ZX, YH immortal Langerhans cell line immortal Langerhans cell line cell a immortal leukocyte cell line that is derived from myeloid leukocyte ZX, YH immortal myeloid leukocyte cell line immortal myeloid leukocyte cell line cell a immortal myeloid leukocyte cell line that is derived from monocyte ZX, YH immortal monocyte cell line immortal monocyte cell line cell a immortal leukocyte cell line that is derived from nongranular leukocyte ZX, YH immortal nongranular leukocyte cell line immortal nongranular leukocyte cell line cell a immortal nongranular leukocyte cell line that is derived from lymphocyte ZX, YH immortal lymphocyte cell line immortal lymphocyte cell line cell a immortal lymphocyte cell line that is derived from T cell ZX, YH immortal T cell line immortal T cell line cell a immortal T cell line that is derived from alpha-beta T cell ZX, YH immortal alpha-beta T cell line immortal alpha-beta T cell line cell a immortal alpha-beta T cell line that is derived from immature alpha-beta T cell ZX, YH immortal immature alpha-beta T cell line immortal immature alpha-beta T cell line cell a immortal immature alpha-beta T cell line that is derived from double-positive, alpha-beta thymocyte ZX, YH immortal double-positive, alpha-beta thymocyte cell line immortal double-positive, alpha-beta thymocyte cell line cell a immortal alpha-beta T cell line that is derived from mature alpha-beta T cell ZX, YH immortal mature alpha-beta T cell line immortal mature alpha-beta T cell line cell a immortal mature alpha-beta T cell line that is derived from CD4-positive, CD25-positive, alpha-beta regulatory T cell ZX, YH immortal CD4-positive, CD25-positive, alpha-beta regulatory T cell line immortal CD4-positive, CD25-positive, alpha-beta regulatory T cell line cell a immortal CD4-positive, CD25-positive, alpha-beta regulatory T cell line that is derived from induced T-regulatory cell ZX, YH immortal induced T-regulatory cell line immortal induced T-regulatory cell line cell a immortal T cell line that is derived from mature T cell ZX, YH immortal mature T cell line immortal mature T cell line cell a immortal mature T cell line that is derived from helper T cell ZX, YH immortal helper T cell line immortal helper T cell line cell a immortal T cell line that is derived from immature T cell ZX, YH immortal immature T cell line immortal immature T cell line cell a immortal lymphocyte cell line that is derived from B cell ZX, YH immortal B cell line immortal B-cell line cell immortal B cell line cell a immortal B cell line that is derived from precursor B cell ZX, YH immortal precursor B cell line immortal precursor B cell line cell a immortal lymphocyte cell line that is derived from natural killer cell ZX, YH immortal natural killer cell line immortal natural killer cell line cell a cell line that is derived from single nucleate cell ZX, YH immortal single nucleate cell line immortal single nucleate cell line cell a cell line that is derived from multinucleate cell ZX, YH immortal multinucleate cell line immortal multinucleate cell line cell a immortal cell line cell that is derived from eukaryotic cell ZX, YH immortal eukaryotic cell line cell a immortal eukaryotic cell line that is derived from vegetative cell (sensu Mycetozoa) ZX, YH immortal vegetative cell line (sensu Mycetozoa) immortal vegetative cell line (sensu Mycetozoa) cell a immortal vegetative cell line (sensu Mycetozoa) that is derived from aggregate cell ZX, YH immortal aggregate cell line immortal aggregate cell line cell a immortal vegetative cell line (sensu Mycetozoa) that is derived from anterior like cell ZX, YH immortal anterior like cell line immortal anterior like cell line cell a immortal eukaryotic cell line that is derived from animal cell ZX, YH immortal animal cell line immortal animal cell line cell a immortal animal cell line that is derived from epithelial cell ZX, YH immortal epithelial cell line cell a immortal epithelial cell line that is derived from duct epithelial cell ZX, YH immortal duct epithelial cell line cell a immortal epithelial cell line that is derived from columnar/cuboidal epithelial cell ZX, YH immortal columnar/cuboidal epithelial cell line cell a immortal columnar/cuboidal epithelial cell line that is derived from neurecto-epithelial cell ZX, YH immortal neurecto-epithelial cell line immortal neurecto-epithelial cell line cell a immortal neurecto-epithelial cell line that is derived from melanocyte ZX, YH immortal melanocyte cell line cell a immortal neurecto-epithelial cell line that is derived from pigmented epithelial cell ZX, YH immortal pigmented epithelial cell line immortal pigmented epithelial cell line cell a immortal epithelial cell line that is derived from squamous epithelial cell ZX, YH immortal squamous epithelial cell line cell a immortal squamous epithelial cell line that is derived from stratified squamous epithelial cell ZX, YH immortal stratified squamous epithelial cell line cell a immortal stratified squamous epithelial cell line that is derived from keratinizing barrier epithelial cell ZX, YH immortal keratinizing barrier epithelial cell line cell a immortal keratinizing barrier epithelial cell line that is derived from keratinocyte ZX, YH immortal keratinocyte cell line cell a immortal squamous epithelial cell line that is derived from epidermal cell ZX, YH immortal epidermal cell line cell a immortal epithelial cell line that is derived from stratified epithelial cell ZX, YH immortal stratified epithelial cell line cell a immortal epithelial cell line that is derived from epithelial cell of lung ZX, YH immortal epithelial cell line of lung cell a immortal epithelial cell line that is derived from epithelial cell of pancreas ZX, YH immortal epithelial cell line of pancreas cell a immortal epithelial cell line that is derived from ecto-epithelial cell ZX, YH immortal ecto-epithelial cell line cell a immortal epithelial cell line that is derived from meso-epithelial cell ZX, YH immortal meso-epithelial cell line immortal meso-epithelial cell line cell a immortal animal cell line that is derived from extraembryonic cell ZX, YH immortal extraembryonic cell line cell a immortal extraembryonic cell line that is derived from trophoblast cell ZX, YH immortal trophoblast cell line immortal trophoblast cell line cell a immortal animal cell line that is derived from hematopoietic cell ZX, YH immortal hematopoietic cell line immortal hematopoietic cell line cell a immortal hematopoietic cell line that is derived from megakaryocyte-erythroid progenitor cell ZX, YH immortal megakaryocyte-erythroid progenitor cell line immortal megakaryocyte-erythroid progenitor cell line cell a immortal hematopoietic cell line that is derived from blood cell ZX, YH immortal blood cell line immortal blood cell line cell a immortal hematopoietic cell line that is derived from myeloid cell ZX, YH immortal myeloid cell line immortal myeloid cell line cell a immortal myeloid cell line that is derived from erythroblast ZX, YH immortal erythroblast cell line immortal erythroblast cell line cell a immortal hematopoietic cell line that is derived from hematopoietic lineage restricted progenitor cell ZX, YH immortal hematopoietic lineage restricted progenitor cell line immortal hematopoietic lineage restricted progenitor cell line cell a immortal hematopoietic lineage restricted progenitor cell line that is derived from pro-B cell ZX, YH immortal pro-B cell line immortal pro-B cell line cell a immortal hematopoietic lineage restricted progenitor cell line that is derived from myeloblast ZX, YH immortal myeloblast cell line immortal myeloblast cell line cell a immortal myeloblast cell line that is derived from basophilic myeloblast ZX, YH immortal basophilic myeloblast cell line immortal basophilic myeloblast cell line cell a immortal animal cell line that is derived from neural cell ZX, YH immortal neural cell line immortal neural cell line cell a immortal neural cell line that is derived from glial cell ZX, YH immortal glial cell line immortal glial cell line cell a immortal glial cell line that is derived from glial cell (sensu Vertebrata) ZX, YH immortal glial cell line (sensu Vertebrata) immortal glial cell line (sensu Vertebrata) cell a immortal glial cell line (sensu Vertebrata) that is derived from astrocyte ZX, YH immortal astrocyte cell line immortal astrocyte cell line cell a immortal animal cell line that is derived from connective tissue cell ZX, YH immortal connective tissue cell line cell a immortal connective tissue cell line that is derived from fibroblast ZX, YH immortal fibroblast cell line immortal fibroblast cell line cell a immortal connective tissue cell line that is derived from stromal cell ZX, YH immortal stromal cell line immortal stromal cell line cell a cell line that is derived from stuff accumulating cell ZX, YH immortal stuff accumulating cell line cell a cell line that is derived from parenchymal cell ZX, YH immortal parenchymal cell line immortal parenchymal cell line cell a cell line that is derived from nucleate cell ZX, YH immortal nucleate cell line immortal nucleate cell line cell a cell line that is derived from somatic cell ZX, YH immortal somatic cell line cell a immortal epithelial cell line cell that is derived from HeLa cell Yongqun He HeLa derived cell line cell an immortal cell line cell that is established by fusing a specific antibody-producing B cell with a myeloma (B cell cancer) cell that is selected for its ability to produce a monoclonal antibody. The production of monoclonal antibodies using the hybridoma technology was invented by Cesar Milstein and Georges J. F. Köhler in 1975. They shared the Nobel Prize of 1984 for Medicine and Physiology with Niels Kaj Jerne, who made other contributions to immunology. Yongqun He WEB: http://en.wikipedia.org/wiki/Hybridoma_technology hybridoma cell line cell a function of a cell that can be passaged in culture medium without death or genetic change. Yongqun He cell passageble capability cell line lineage is a history of the development of a cell line. The cell line lineage may include the original cell type from a tissue and organism that derives the cell line cell. It may also include the cell line passage and cell culturing information. This term will be a subclass of BFO 2 'history'. The BFO 2 'history' term will be imported to CLO after the BFO 2 is finalized. Yongqun He cell line lineage a cell line cell that is in the Coriell cell line repositories. SS, YH, UV, SS Coriell cell line cell a cell line cell that is in the RIKEN Cell bank SS, YH, UV, SS RIKEN Cell Bank cell A cell line comprised of cells which can all be traced back to a single ancestor cell, and which therefore can be treated as identical. This can be used to study just the progeny of single cells. MHB 2013-07-16: This should be made into a defined class, using an axiom referencing a clonal cell expansion process, or a clonal cell line creation process. YH, SS, MHB clonal cell line cloned cell line REO: REO_0000397 An immortal B cell line cell that derives from peripheral vein. Yue Liu, Yongqun He immortal peripheral vein-derived B cell line cell An immortal cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived cell line cell An immortal fibroblast cell line cell that derives from arm. Yue Liu, Yongqun He immortal arm-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from tunica albuginea of testis. Yue Liu, Yongqun He immortal tunica albuginea of testis-derived fibroblast cell line cell An immortal cell line cell that derives from amniotic fluid. Yue Liu, Yongqun He immortal amniotic fluid-derived cell line cell An immortal T cell line cell that derives from peripheral vein. Yue Liu, Yongqun He immortal peripheral vein-derived T cell line cell An immortal fibroblast cell line cell that derives from animal ovary. Yue Liu, Yongqun He immortal animal ovary-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from skin. Yue Liu, Yongqun He immortal skin-derived fibroblast cell line cell An immortal keratinocyte cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived keratinocyte cell line cell An immortal fibroblast cell line cell that derives from testis. Yue Liu, Yongqun He immortal testis-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from liver. Yue Liu, Yongqun He immortal liver-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from lung. Yue Liu, Yongqun He immortal lung-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from embryo. Yue Liu, Yongqun He immortal embryo-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from thoracic aorta. Yue Liu, Yongqun He immortal thoracic aorta-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from gum. Yue Liu, Yongqun He immortal gum-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from digit. Yue Liu, Yongqun He immortal digit-derived fibroblast cell line cell An immortal cell line cell that derives from skin. Yue Liu, Yongqun He immortal skin-derived cell line cell An immortal smooth muscle cell line cell that derives from trachealis. Yue Liu, Yongqun He immortal trachealis-derived smooth muscle cell line cell An immortal fibroblast cell line cell that derives from neck. Yue Liu, Yongqun He immortal neck-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from umbilical cord. Yue Liu, Yongqun He immortal umbilical cord-derived fibroblast cell line cell An immortal endothelial cell line cell that derives from abdominal aorta. Yue Liu, Yongqun He immortal abdominal aorta-derived endothelial cell line cell An immortal endothelial cell line cell that derives from iliac vein. Yue Liu, Yongqun He immortal iliac vein-derived endothelial cell line cell An immortal endothelial cell line cell that derives from common iliac artery. Yue Liu, Yongqun He immortal common iliac artery-derived endothelial cell line cell An immortal fibroblast cell line cell that derives from gonad. Yue Liu, Yongqun He immortal gonad-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from amnion. Yue Liu, Yongqun He immortal amnion-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from thigh. Yue Liu, Yongqun He immortal thigh-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from umbilical vein. Yue Liu, Yongqun He immortal umbilical vein-derived fibroblast cell line cell An immortal cell line cell that derives from vasculature. Yue Liu, Yongqun He immortal vasculature-derived cell line cell An immortal cell line cell that derives from spleen. Yue Liu, Yongqun He immortal spleen-derived cell line cell An immortal cell line cell that derives from multi-cellular organism. Yue Liu, Yongqun He immortal multi-cellular organism-derived cell line cell An immortal cell line cell that derives from fetal membrane. Yue Liu, Yongqun He immortal fetal membrane-derived cell line cell An immortal cell line cell that derives from dento-alveolar joint. Yue Liu, Yongqun He immortal dento-alveolar joint-derived cell line cell An immortal cell line cell that derives from mixed endoderm/mesoderm-derived structure. Yue Liu, Yongqun He immortal mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal cell line cell that derives from late embryo. Yue Liu, Yongqun He immortal late embryo-derived cell line cell An immortal cell line cell that derives from muscle spindle. Yue Liu, Yongqun He immortal muscle spindle-derived cell line cell An immortal cell line cell that derives from thymus. Yue Liu, Yongqun He immortal thymus-derived cell line cell An immortal cell line cell that derives from amnion. Yue Liu, Yongqun He immortal amnion-derived cell line cell An immortal cell line cell that derives from tongue. Yue Liu, Yongqun He immortal tongue-derived cell line cell An immortal cell line cell that derives from pair of lungs. Yue Liu, Yongqun He immortal lung-derived cell line cell An immortal cell line cell that derives from kidney. Yue Liu, Yongqun He immortal kidney-derived cell line cell An immortal fibroblast cell line cell that derives from abdominal cavity. Yue Liu, Yongqun He immortal abdominal cavity-derived fibroblast cell line cell An immortal smooth muscle cell line cell that derives from thoracic aorta. Yue Liu, Yongqun He immortal thoracic aorta-derived smooth muscle cell line cell An immortal cell line cell that derives from placenta. Yue Liu, Yongqun He immortal placenta-derived cell line cell An immortal fibroblast cell line cell that derives from pericardium. Yue Liu, Yongqun He immortal pericardium-derived fibroblast cell line cell An immortal cell line cell that derives from embryo. Yue Liu, Yongqun He immortal embryo-derived cell line cell An immortal fibroblast cell line cell that derives from foetal structure. Yue Liu, Yongqun He immortal foetal structure-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from external genitalia. Yue Liu, Yongqun He immortal external genitalia-derived fibroblast cell line cell An immortal cell line cell that derives from prostate gland. Yue Liu, Yongqun He immortal prostate gland-derived cell line cell An immortal cell line cell that derives from septum of telencephalon. Yue Liu, Yongqun He immortal septum of telencephalon-derived cell line cell An immortal cell line cell that derives from larva. Yue Liu, Yongqun He immortal larva-derived cell line cell An immortal cell line cell that derives from area X. Yue Liu, Yongqun He immortal area X-derived cell line cell An immortal cell line cell that derives from somatic nervous system. Yue Liu, Yongqun He immortal somatic nervous system-derived cell line cell An immortal cell line cell that derives from lymph. Yue Liu, Yongqun He immortal lymph-derived cell line cell An immortal endothelial cell line cell that derives from thoracic aorta. Yue Liu, Yongqun He immortal thoracic aorta-derived endothelial cell line cell An immortal cell line cell that derives from liver. Yue Liu, Yongqun He immortal liver-derived cell line cell An immortal cell line cell that derives from colon. Yue Liu, Yongqun He immortal colon-derived cell line cell An immortal cell line cell that derives from caecum. Yue Liu, Yongqun He immortal caecum-derived cell line cell An immortal cell line cell that derives from pancreas. Yue Liu, Yongqun He immortal pancreas-derived cell line cell An immortal cell line cell that derives from brain. Yue Liu, Yongqun He immortal brain-derived cell line cell An immortal cell line cell that derives from tail. Yue Liu, Yongqun He immortal tail-derived cell line cell An immortal cell line cell that derives from collecting duct of renal tubule. Yue Liu, Yongqun He immortal collecting duct of renal tubule-derived cell line cell An immortal cell line cell that derives from mesonephros. Yue Liu, Yongqun He immortal mesonephros-derived cell line cell An immortal cell line cell that derives from female gonad. Yue Liu, Yongqun He immortal female gonad-derived cell line cell An immortal cell line cell that derives from chorion. Yue Liu, Yongqun He immortal chorion-derived cell line cell An immortal cell line cell that derives from lymphoid follicle. Yue Liu, Yongqun He immortal lymphoid follicle-derived cell line cell An immortal fibroblast cell line cell that derives from leg. Yue Liu, Yongqun He immortal leg-derived fibroblast cell line cell An immortal cell line cell that derives from limb/fin. Yue Liu, Yongqun He immortal limb/fin-derived cell line cell An immortal cell line cell that derives from testis. Yue Liu, Yongqun He immortal testis-derived cell line cell An immortal cell line cell that derives from stomach. Yue Liu, Yongqun He immortal stomach-derived cell line cell An immortal cell line cell that derives from endothelium. Yue Liu, Yongqun He immortal endothelium-derived cell line cell An immortal fibroblast cell line cell that derives from foreskin. Yue Liu, Yongqun He immortal foreskin-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from achilles tendon. Yue Liu, Yongqun He immortal achilles tendon-derived fibroblast cell line cell An immortal cell line cell that derives from bone element. Yue Liu, Yongqun He immortal bone element-derived cell line cell An immortal cell line cell that derives from thyroid gland. Yue Liu, Yongqun He immortal thyroid gland-derived cell line cell An immortal cell line cell that derives from urinary bladder. Yue Liu, Yongqun He immortal urinary bladder-derived cell line cell An immortal cell line cell that derives from acetabular part of hip bone. Yue Liu, Yongqun He immortal acetabular part of hip bone-derived cell line cell An immortal cell line cell that derives from breast. Yue Liu, Yongqun He immortal breast-derived cell line cell An immortal cell line cell that derives from epithelium. Yue Liu, Yongqun He immortal epithelium-derived cell line cell An immortal cell line cell that derives from comma-shaped body. Yue Liu, Yongqun He immortal comma-shaped body-derived cell line cell An immortal cell line cell that derives from supra-orbital vein. Yue Liu, Yongqun He immortal supra-orbital vein-derived cell line cell An immortal fibroblast cell line cell that derives from ear. Yue Liu, Yongqun He immortal ear-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from inguinal region. Yue Liu, Yongqun He immortal inguinal region-derived fibroblast cell line cell An immortal cell line cell that derives from mesothelium. Yue Liu, Yongqun He immortal mesothelium-derived cell line cell An immortal cell line cell that derives from uterus. Yue Liu, Yongqun He immortal uterus-derived cell line cell An immortal cell line cell that derives from endometrium. Yue Liu, Yongqun He immortal endometrium-derived cell line cell An immortal cell line cell that derives from uterine cervix. Yue Liu, Yongqun He immortal uterine cervix-derived cell line cell An immortal cell line cell that derives from heart. Yue Liu, Yongqun He immortal heart-derived cell line cell An immortal cell line cell that derives from pituitary gland. Yue Liu, Yongqun He immortal pituitary gland-derived cell line cell An immortal cell line cell that derives from gill. Yue Liu, Yongqun He immortal gill-derived cell line cell An immortal cell line cell that derives from follicular fluid. Yue Liu, Yongqun He immortal follicular fluid-derived cell line cell An immortal cell line cell that derives from eye. Yue Liu, Yongqun He immortal eye-derived cell line cell An immortal plasma cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived plasma cell line cell An immortal cell line cell that derives from floating rib. Yue Liu, Yongqun He immortal floating rib-derived cell line cell An immortal cell line cell that derives from mammary gland. Yue Liu, Yongqun He immortal mammary gland-derived cell line cell An immortal fibroblast cell line cell that derives from thorax. Yue Liu, Yongqun He immortal thorax-derived fibroblast cell line cell An immortal cell line cell that derives from paired fin. Yue Liu, Yongqun He immortal paired fin-derived cell line cell An immortal cell line cell that derives from neural nucleus. Yue Liu, Yongqun He immortal neural nucleus-derived cell line cell An immortal cell line cell that derives from Ammon's horn. Yue Liu, Yongqun He immortal Ammon's horn-derived cell line cell An immortal cell line cell that derives from bone marrow. Yue Liu, Yongqun He immortal bone marrow-derived cell line cell An immortal cell line cell that derives from islet of Langerhans. Yue Liu, Yongqun He immortal islet of Langerhans-derived cell line cell An immortal cell line cell that derives from pyramid of medulla oblongata. Yue Liu, Yongqun He immortal pyramid of medulla oblongata-derived cell line cell a hybridoma cell line cell that is established by fusing cells from two mice. most hybridoma cell line cells are mouse x mouse Yongqun He mouse x mouse hybridoma cell line cell An immortal epithelial cell line cell that derives from uterine cervix. Yue Liu, Yongqun He immortal uterine cervix-derived epithelial cell line cell An immortal cell line cell that derives from ileocecal junction. Yue Liu, Yongqun He immortal ileocecal junction-derived cell line cell An immortal cell line cell that derives from compact bone. Yue Liu, Yongqun He immortal compact bone-derived cell line cell An immortal cell line cell that derives from abdominal aorta. Yue Liu, Yongqun He immortal abdominal aorta-derived cell line cell An immortal cell line cell that derives from bronchus. Yue Liu, Yongqun He immortal bronchus-derived cell line cell An immortal cell line cell that derives from iliac artery. Yue Liu, Yongqun He immortal iliac artery-derived cell line cell An immortal cell line cell that derives from synovial membrane of synovial joint. Yue Liu, Yongqun He immortal synovial membrane of synovial joint-derived cell line cell An immortal cell line cell that derives from iliac vein. Yue Liu, Yongqun He immortal iliac vein-derived cell line cell An immortal cell line cell that derives from vagina. Yue Liu, Yongqun He immortal vagina-derived cell line cell An immortal cell line cell that derives from larynx. Yue Liu, Yongqun He immortal larynx-derived cell line cell An immortal cell line cell that derives from inferior cervical ganglion. Yue Liu, Yongqun He immortal inferior cervical ganglion-derived cell line cell An immortal cell line cell that derives from esophagus. Yue Liu, Yongqun He immortal esophagus-derived cell line cell An immortal cell line cell that derives from femoral artery. Yue Liu, Yongqun He immortal femoral artery-derived cell line cell An immortal cell line cell that derives from prepuce of penis. Yue Liu, Yongqun He immortal prepuce of penis-derived cell line cell An immortal cell line cell that derives from gingival epithelium. Yue Liu, Yongqun He immortal gingival epithelium-derived cell line cell An immortal cell line cell that derives from gingiva. Yue Liu, Yongqun He immortal gingiva-derived cell line cell An immortal cell line cell that derives from mouth. Yue Liu, Yongqun He immortal mouth-derived cell line cell An immortal cell line cell that derives from peripheral vein. Yue Liu, Yongqun He immortal peripheral vein-derived cell line cell An immortal cell line cell that derives from peritoneum. Yue Liu, Yongqun He immortal peritoneum-derived cell line cell An immortal cell line cell that derives from round window. Yue Liu, Yongqun He immortal round window-derived cell line cell An immortal fibroblast cell line cell that derives from conjunctiva structure. Yue Liu, Yongqun He immortal conjunctiva structure-derived fibroblast cell line cell An immortal cell line cell that derives from intestine. Yue Liu, Yongqun He immortal intestine-derived cell line cell An immortal cell line cell that derives from rectum. Yue Liu, Yongqun He immortal rectum-derived cell line cell An immortal cell line cell that derives from pulmonary vein. Yue Liu, Yongqun He immortal pulmonary vein-derived cell line cell An immortal fibroblast cell line cell that derives from buttock. Yue Liu, Yongqun He immortal buttock-derived fibroblast cell line cell An immortal cell line cell that derives from tonsil. Yue Liu, Yongqun He immortal tonsil-derived cell line cell An immortal fibroblast cell line cell that derives from umbilicus. Yue Liu, Yongqun He immortal umbilicus-derived fibroblast cell line cell An immortal cell line cell that derives from posterior commissure. Yue Liu, Yongqun He immortal posterior commissure-derived cell line cell An immortal cell line cell that derives from soft palate. Yue Liu, Yongqun He immortal soft palate-derived cell line cell An immortal cell line cell that derives from adrenal gland. Yue Liu, Yongqun He immortal adrenal gland-derived cell line cell An immortal cell line cell that derives from pronephros. Yue Liu, Yongqun He immortal pronephros-derived cell line cell An immortal smooth muscle cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived smooth muscle cell line cell An immortal cell line cell that derives from sublingual artery. Yue Liu, Yongqun He immortal sublingual artery-derived cell line cell An immortal cell line cell that derives from aorta. Yue Liu, Yongqun He immortal aorta-derived cell line cell An immortal cell line cell that derives from ligament. Yue Liu, Yongqun He immortal ligament-derived cell line cell An immortal fibroblast cell line cell that derives from uterus. Yue Liu, Yongqun He immortal uterus-derived fibroblast cell line cell An immortal cell line cell that derives from cerebral lobe. Yue Liu, Yongqun He immortal cerebral lobe-derived cell line cell An immortal cell line cell that derives from squamous part of temporal bone. Yue Liu, Yongqun He immortal squamous part of temporal bone-derived cell line cell An immortal fibroblast cell line cell that derives from pronephros. Yue Liu, Yongqun He immortal pronephros-derived fibroblast cell line cell An immortal cell line cell that derives from mucosa. Yue Liu, Yongqun He immortal mucosa-derived cell line cell An immortal cell line cell that derives from epidermis. Yue Liu, Yongqun He immortal epidermis-derived cell line cell An immortal cell line cell that derives from submandibular gland. Yue Liu, Yongqun He immortal submandibular gland-derived cell line cell An immortal mesothelial cell line cell that derives from lung. Yue Liu, Yongqun He immortal lung-derived mesothelial cell line cell An immortal epithelial cell line cell that derives from eye structure. Yue Liu, Yongqun He immortal eye structure-derived epithelial cell line cell An immortal fibroblast cell line cell that derives from hip. Yue Liu, Yongqun He immortal hip-derived fibroblast cell line cell An immortal cell line cell that derives from prostate epithelium. Yue Liu, Yongqun He immortal prostate epithelium-derived cell line cell An immortal cell line cell that derives from retinal neural layer. Yue Liu, Yongqun He immortal retinal neural layer-derived cell line cell An immortal cell line cell that derives from ureter. Yue Liu, Yongqun He immortal ureter-derived cell line cell An immortal smooth muscle cell line cell that derives from iliac vein. Yue Liu, Yongqun He immortal iliac vein-derived smooth muscle cell line cell An immortal smooth muscle cell line cell that derives from common iliac artery. Yue Liu, Yongqun He immortal common iliac artery-derived smooth muscle cell line cell An immortal keratinocyte cell line cell that derives from mammary gland. Yue Liu, Yongqun He immortal mammary gland-derived keratinocyte cell line cell An immortal endothelial cell line cell that derives from umbilical vein. Yue Liu, Yongqun He immortal umbilical vein-derived endothelial cell line cell An immortal fibroblast cell line cell that derives from scalp. Yue Liu, Yongqun He immortal scalp-derived fibroblast cell line cell An immortal myoblast cell line cell that derives from skeletal muscle. Yue Liu, Yongqun He immortal skeletal muscle-derived myoblast cell line cell An immortal endothelial cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived endothelial cell line cell An immortal fibroblast cell line cell that derives from sacrum. Yue Liu, Yongqun He immortal sacrum-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from shoulder. Yue Liu, Yongqun He immortal shoulder-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from placenta. Yue Liu, Yongqun He immortal placenta-derived fibroblast cell line cell An immortal cell line cell that derives from dermis. Yue Liu, Yongqun He immortal dermis-derived cell line cell An immortal cell line cell that derives from cornea. Yue Liu, Yongqun He immortal cornea-derived cell line cell An immortal cell line cell that derives from mammalian vulva. Yue Liu, Yongqun He immortal mammalian vulva-derived cell line cell An immortal cell line cell that derives from spherical lensed eye. Yue Liu, Yongqun He immortal spherical lensed eye-derived cell line cell An immortal cell line cell that derives from ileum. Yue Liu, Yongqun He immortal ileum-derived cell line cell An immortal fibroblast cell line cell that derives from cervix. Yue Liu, Yongqun He immortal cervix-derived fibroblast cell line cell An immortal myoblast cell line cell that derives from rhomboid. Yue Liu, Yongqun He immortal rhomboid-derived myoblast cell line cell An immortal cell line cell that derives from abdominal cavity. Yue Liu, Yongqun He immortal abdominal cavity-derived cell line cell An immortal cell line cell that derives from umbilical vein. Yue Liu, Yongqun He immortal umbilical vein-derived cell line cell An immortal cell line cell that derives from duodenum. Yue Liu, Yongqun He immortal duodenum-derived cell line cell An immortal cell line cell that derives from connective tissue. Yue Liu, Yongqun He immortal connective tissue-derived cell line cell An immortal cell line cell that derives from parotid gland. Yue Liu, Yongqun He immortal parotid gland-derived cell line cell An immortal fibroblast cell line cell that derives from ischium. Yue Liu, Yongqun He immortal ischium-derived fibroblast cell line cell An immortal cell line cell that derives from buttock. Yue Liu, Yongqun He immortal buttock-derived cell line cell An immortal cell line cell that derives from anatomical cluster. Yue Liu, Yongqun He immortal anatomical cluster-derived cell line cell An immortal cell line cell that derives from thigh. Yue Liu, Yongqun He immortal thigh-derived cell line cell An immortal cell line cell that derives from chordate pharynx. Yue Liu, Yongqun He immortal chordate pharynx-derived cell line cell An immortal cell line cell that derives from retina. Yue Liu, Yongqun He immortal retina-derived cell line cell An immortal cell line cell that derives from yolk sac. Yue Liu, Yongqun He immortal yolk sac-derived cell line cell An immortal cell line cell that derives from nasal concha. Yue Liu, Yongqun He immortal nasal concha-derived cell line cell An immortal cell line cell that derives from arm. Yue Liu, Yongqun He immortal arm-derived cell line cell An immortal cell line cell that derives from sacrum. Yue Liu, Yongqun He immortal sacrum-derived cell line cell An immortal cell line cell that derives from conjunctiva. Yue Liu, Yongqun He immortal conjunctiva-derived cell line cell An immortal cell line cell that derives from trachea. Yue Liu, Yongqun He immortal trachea-derived cell line cell An immortal cell line cell that derives from respiration organ. Yue Liu, Yongqun He immortal respiration organ-derived cell line cell An immortal cell line cell that derives from renal glomerulus. Yue Liu, Yongqun He immortal renal glomerulus-derived cell line cell An immortal cell line cell that derives from nephron tubule. Yue Liu, Yongqun He immortal nephron tubule-derived cell line cell An immortal cell line cell that derives from sternum. Yue Liu, Yongqun He immortal sternum-derived cell line cell An immortal cell line cell that derives from hypodermis. Yue Liu, Yongqun He immortal hypodermis-derived cell line cell An immortal cell line cell that derives from proximal tubule. Yue Liu, Yongqun He immortal proximal tubule-derived cell line cell An immortal cell line cell that derives from mucosa of vagina. Yue Liu, Yongqun He immortal mucosa of vagina-derived cell line cell An immortal cell line cell that derives from endocervix. Yue Liu, Yongqun He immortal endocervix-derived cell line cell An immortal mesothelial cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived mesothelial cell line cell An immortal peripheral vein-derived B cell line cell that derives from human. Yue Liu, Yongqun He immortal human peripheral vein-derived B cell line cell An immortal cell line cell that derives from pulmonary nerve plexus. Yue Liu, Yongqun He immortal pulmonary nerve plexus-derived cell line cell An immortal cell line cell that derives from pelvic fin. Yue Liu, Yongqun He immortal pelvic fin-derived cell line cell An immortal cell line cell that derives from right ureter. Yue Liu, Yongqun He immortal right ureter-derived cell line cell An immortal cell line cell that derives from superior rostral sulcus. Yue Liu, Yongqun He immortal superior rostral sulcus-derived cell line cell An immortal cell line cell that derives from gonad. Yue Liu, Yongqun He immortal gonad-derived cell line cell An immortal fibroblast cell line cell that derives from cornea structure. Yue Liu, Yongqun He immortal cornea structure-derived fibroblast cell line cell An immortal cell line cell that derives from glomerular capsule. Yue Liu, Yongqun He immortal glomerular capsule-derived cell line cell An immortal cell line cell that derives from nasal vestibule. Yue Liu, Yongqun He immortal nasal vestibule-derived cell line cell An immortal cell line cell that derives from adrenal cortex. Yue Liu, Yongqun He immortal adrenal cortex-derived cell line cell An immortal fibroblast cell line cell that derives from 16914. Yue Liu, Yongqun He immortal 16914-derived fibroblast cell line cell An immortal epithelial cell line cell that derives from organism part. Yue Liu, Yongqun He immortal organism part-derived epithelial cell line cell An immortal fibroblast cell line cell that derives from axilla. Yue Liu, Yongqun He immortal axilla-derived fibroblast cell line cell An immortal endothelial cell line cell that derives from pulmonary artery. Yue Liu, Yongqun He immortal pulmonary artery-derived endothelial cell line cell An immortal smooth muscle cell line cell that derives from pulmonary artery. Yue Liu, Yongqun He immortal pulmonary artery-derived smooth muscle cell line cell An immortal epithelial cell line cell that derives from retina structure. Yue Liu, Yongqun He immortal retina structure-derived epithelial cell line cell An immortal fibroblast cell line cell that derives from calf. Yue Liu, Yongqun He immortal calf-derived fibroblast cell line cell An immortal fibroblast cell line cell that derives from nose structure. Yue Liu, Yongqun He immortal nose structure-derived fibroblast cell line cell An immortal smooth muscle cell line cell that derives from carotid artery. Yue Liu, Yongqun He immortal carotid artery-derived smooth muscle cell line cell An immortal fibroblast cell line cell that derives from brain. Yue Liu, Yongqun He immortal brain-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee peripheral vein-derived B cell line cell An immortal arm-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human arm-derived fibroblast cell line cell An immortal organism part-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human organism part-derived fibroblast cell line cell An immortal organism part-derived fibroblast cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle organism part-derived fibroblast cell line cell An immortal tunica albuginea of testis-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human tunica albuginea of testis-derived fibroblast cell line cell An immortal amniotic fluid-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human amniotic fluid-derived cell line cell An immortal peripheral vein-derived T cell line cell that derives from human. Yue Liu, Yongqun He immortal human peripheral vein-derived T cell line cell An immortal organism part-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat organism part-derived cell line cell An immortal organism part-derived fibroblast cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee organism part-derived fibroblast cell line cell An immortal animal ovary-derived fibroblast cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster ovary-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Bornean orangutan. Yue Liu, Yongqun He immortal Bornean orangutan skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from pig-tailed macaque. Yue Liu, Yongqun He immortal pig-tailed macaque skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Kenya baboon. Yue Liu, Yongqun He immortal Kenya baboon skin-derived fibroblast cell line cell An immortal organism part-derived cell line cell that derives from long-tailed macaque. Yue Liu, Yongqun He immortal long-tailed macaque organism part-derived cell line cell An immortal organism part-derived keratinocyte cell line cell that derives from pig-tailed macaque. Yue Liu, Yongqun He immortal pig-tailed macaque organism part-derived keratinocyte cell line cell An immortal organism part-derived keratinocyte cell line cell that derives from long-tailed macaque. Yue Liu, Yongqun He immortal long-tailed macaque organism part-derived keratinocyte cell line cell An immortal testis-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human testis-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from pygmy chimpanzee. Yue Liu, Yongqun He immortal pygmy chimpanzee skin-derived fibroblast cell line cell An immortal liver-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human liver-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from red-bellied lemur. Yue Liu, Yongqun He immortal red-bellied lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from black lemur. Yue Liu, Yongqun He immortal black lemur skin-derived fibroblast cell line cell An immortal organism part-derived keratinocyte cell line cell that derives from Kenya baboon. Yue Liu, Yongqun He immortal Kenya baboon organism part-derived keratinocyte cell line cell An immortal skin-derived fibroblast cell line cell that derives from variegated lemur. Yue Liu, Yongqun He immortal variegated lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from small-eared galago. Yue Liu, Yongqun He immortal small-eared galago skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from western gorilla. Yue Liu, Yongqun He immortal western gorilla skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Angolan colobus. Yue Liu, Yongqun He immortal Angolan colobus skin-derived fibroblast cell line cell An immortal organism part-derived fibroblast cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse organism part-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Colobus guereza. Yue Liu, Yongqun He immortal Colobus guereza skin-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from pygmy chimpanzee. Yue Liu, Yongqun He immortal pygmy chimpanzee peripheral vein-derived B cell line cell An immortal skin-derived fibroblast cell line cell that derives from Allen's swamp monkey. Yue Liu, Yongqun He immortal Allen's swamp monkey skin-derived fibroblast cell line cell An immortal lung-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human lung-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from mongoose lemur. Yue Liu, Yongqun He immortal mongoose lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Ring-tailed lemur. Yue Liu, Yongqun He immortal Ring-tailed lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from black-handed spider monkey. Yue Liu, Yongqun He immortal black-handed spider monkey skin-derived fibroblast cell line cell An immortal embryo-derived fibroblast cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster embryo-derived fibroblast cell line cell An immortal thoracic aorta-derived fibroblast cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat thoracic aorta-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Charles Island giant tortoise. Yue Liu, Yongqun He immortal Charles Island giant tortoise skin-derived fibroblast cell line cell An immortal testis-derived fibroblast cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat testis-derived fibroblast cell line cell An immortal gum-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human gum-derived fibroblast cell line cell An immortal organism part-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse organism part-derived cell line cell An immortal digit-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human digit-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human skin-derived fibroblast cell line cell An immortal skin-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human skin-derived cell line cell An immortal organism part-derived fibroblast cell line cell that derives from Indian muntjac. Yue Liu, Yongqun He immortal Indian muntjac organism part-derived fibroblast cell line cell An immortal organism part-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human organism part-derived cell line cell An immortal trachealis-derived smooth muscle cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit trachealis-derived smooth muscle cell line cell An immortal neck-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human neck-derived fibroblast cell line cell An immortal umbilical cord-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human umbilical cord-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from lesser panda. Yue Liu, Yongqun He immortal lesser panda skin-derived fibroblast cell line cell An immortal abdominal aorta-derived endothelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human abdominal aorta-derived endothelial cell line cell An immortal iliac vein-derived endothelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human iliac vein-derived endothelial cell line cell An immortal common iliac artery-derived endothelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human common iliac artery-derived endothelial cell line cell An immortal embryo-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human embryo-derived fibroblast cell line cell An immortal gonad-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human gonad-derived fibroblast cell line cell An immortal amnion-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human amnion-derived fibroblast cell line cell An immortal thigh-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human thigh-derived fibroblast cell line cell An immortal umbilical vein-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human umbilical vein-derived fibroblast cell line cell An immortal cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle cell line cell An immortal vasculature-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle vasculature-derived cell line cell An immortal spleen-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat spleen-derived cell line cell An immortal fibroblast cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat fibroblast cell line cell An immortal cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat cell line cell An immortal multi-cellular organism-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat multi-cellular organism-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle fetal membrane-derived cell line cell An immortal spleen-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle spleen-derived cell line cell An immortal dento-alveolar joint-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle dento-alveolar joint-derived cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal late embryo-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat late embryo-derived cell line cell An immortal muscle spindle-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat muscle spindle-derived cell line cell An immortal thymus-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat thymus-derived cell line cell An immortal amnion-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human amnion-derived cell line cell An immortal skin-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat skin-derived cell line cell An immortal lymphocyte cell line cell that derives from human. Yue Liu, Yongqun He immortal human lymphocyte cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal tongue-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat tongue-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat pair of lungs-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat fetal membrane-derived cell line cell An immortal kidney-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat kidney-derived cell line cell An immortal lung-derived fibroblast cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog lung-derived fibroblast cell line cell An immortal abdominal cavity-derived fibroblast cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog abdominal cavity-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog thoracic aorta-derived smooth muscle cell line cell An immortal placenta-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat placenta-derived cell line cell An immortal skin-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat skin-derived cell line cell An immortal fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human fibroblast cell line cell An immortal pericardium-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human pericardium-derived fibroblast cell line cell An immortal embryo-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat embryo-derived cell line cell An immortal embryo-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit embryo-derived cell line cell a cell growth where the cell is a cell line cell. Yongqun He cell line cell growth An immortal mononuclear phagocyte cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat mononuclear phagocyte cell line cell An immortal foetal structure-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human foetal structure-derived fibroblast cell line cell An immortal external genitalia-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human external genitalia-derived fibroblast cell line cell An immortal prostate gland-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat prostate gland-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from human. Yue Liu, Yongqun He Obsolete - many cell line cells were previously mistakenly assigned under this class. Now no cell line cells available under this class. immortal human septum of telencephalon-derived cell line cell - Obsolete An immortal larva-derived cell line cell that derives from cabbage moth. Yue Liu, Yongqun He immortal cabbage moth larva-derived cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal kidney-derived cell line cell that derives from monkey. Yue Liu, Yongqun He immortal monkey kidney-derived cell line cell An immortal lymphocyte cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse lymphocyte cell line cell An immortal lung-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human lung-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse pair of lungs-derived cell line cell An immortal area X-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse area X-derived cell line cell An immortal area X-derived cell line cell that derives from Mus musculus x Rattus norvegicus. Yue Liu, Yongqun He immortal Mus musculus x Rattus norvegicus area X-derived cell line cell An immortal somatic nervous system-derived cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster somatic nervous system-derived cell line cell a hybridoma cell line cell that is established by fusing cells from a mouse and a rat. Yongqun He mouse x rat hybridoma cell line cell An immortal fibroblast cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse fibroblast cell line cell An immortal cell line cell that derives from common quail. Yue Liu, Yongqun He immortal common quail cell line cell An immortal lymph-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse lymph-derived cell line cell An immortal multi-cellular organism-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse multi-cellular organism-derived cell line cell An immortal embryo-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse embryo-derived cell line cell An immortal embryo-derived cell line cell that derives from turnip moth. Yue Liu, Yongqun He immortal turnip moth embryo-derived cell line cell An immortal thoracic aorta-derived endothelial cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle thoracic aorta-derived endothelial cell line cell An immortal lung-derived fibroblast cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle lung-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle thoracic aorta-derived smooth muscle cell line cell An immortal thigh-derived fibroblast cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle thigh-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig thoracic aorta-derived smooth muscle cell line cell An immortal induced T-regulatory cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster induced T-regulatory cell line cell An immortal cell line cell that derives from human. Yue Liu, Yongqun He immortal human cell line cell An immortal liver-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat liver-derived cell line cell An immortal colon-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human colon-derived cell line cell An immortal caecum-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human caecum-derived cell line cell An immortal pancreas-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse pancreas-derived cell line cell An immortal lung-derived fibroblast cell line cell that derives from pig-tailed macaque. Yue Liu, Yongqun He immortal pig-tailed macaque lung-derived fibroblast cell line cell An immortal brain-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human brain-derived cell line cell An immortal trophoblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human trophoblast cell line cell An immortal tail-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse tail-derived cell line cell An immortal skin-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse skin-derived cell line cell An immortal collecting duct of renal tubule-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse collecting duct of renal tubule-derived cell line cell An immortal myeloblast cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse myeloblast cell line cell An immortal peripheral neuron cell line cell that derives from human. Yue Liu, Yongqun He immortal human peripheral neuron cell line cell An immortal arm-derived fibroblast cell line cell that derives from pig-tailed macaque. Yue Liu, Yongqun He immortal pig-tailed macaque arm-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from pig-tailed macaque. Yue Liu, Yongqun He immortal pig-tailed macaque thoracic aorta-derived smooth muscle cell line cell An immortal mesonephros-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse mesonephros-derived cell line cell An immortal female gonad-derived cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster female gonad-derived cell line cell An immortal chorion-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human chorion-derived cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse thoracic aorta-derived smooth muscle cell line cell An immortal lymphoid follicle-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse lymphoid follicle-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster fetal membrane-derived cell line cell An immortal cell line cell that derives from vervet monkey. Yue Liu, Yongqun He immortal vervet monkey cell line cell An immortal kidney-derived cell line cell that derives from vervet monkey. Yue Liu, Yongqun He immortal vervet monkey kidney-derived cell line cell An immortal mast cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse mast cell line cell An immortal epithelial cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse epithelial cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal liver-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse liver-derived cell line cell An immortal embryo-derived cell line cell that derives from Drosophila melanogaster. Yue Liu, Yongqun He immortal Drosophila melanogaster embryo-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human fetal membrane-derived cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from fathead minnow. Yue Liu, Yongqun He immortal fathead minnow mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal multi-cellular organism-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human multi-cellular organism-derived cell line cell An immortal spleen-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse spleen-derived cell line cell An immortal kidney-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse kidney-derived cell line cell An immortal leg-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human leg-derived fibroblast cell line cell An immortal female gonad-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse female gonad-derived cell line cell An immortal limb/fin-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse limb/fin-derived cell line cell An immortal testis-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse testis-derived cell line cell An immortal arm-derived fibroblast cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque arm-derived fibroblast cell line cell An immortal stomach-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human stomach-derived cell line cell An immortal abdominal cavity-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human abdominal cavity-derived fibroblast cell line cell An immortal pancreas-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human pancreas-derived cell line cell An immortal thoracic aorta-derived endothelial cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse thoracic aorta-derived endothelial cell line cell An immortal thigh-derived fibroblast cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse thigh-derived fibroblast cell line cell An immortal lung-derived fibroblast cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse lung-derived fibroblast cell line cell An immortal endothelium-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse endothelium-derived cell line cell An immortal foreskin-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human foreskin-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque thoracic aorta-derived smooth muscle cell line cell An immortal lung-derived fibroblast cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque lung-derived fibroblast cell line cell An immortal achilles tendon-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human achilles tendon-derived fibroblast cell line cell An immortal bone element-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human bone element-derived cell line cell An immortal cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat cell line cell An immortal thyroid gland-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat thyroid gland-derived cell line cell An immortal epithelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human epithelial cell line cell An immortal urinary bladder-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human urinary bladder-derived cell line cell An immortal liver-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human liver-derived cell line cell An immortal acetabular part of hip bone-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human acetabular part of hip bone-derived cell line cell An immortal cell line cell that derives from Ovis. Yue Liu, Yongqun He immortal Ovis cell line cell An immortal pair of lungs-derived cell line cell that derives from gray fox. Yue Liu, Yongqun He immortal gray fox pair of lungs-derived cell line cell An immortal breast-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse breast-derived cell line cell An immortal cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque cell line cell An immortal fetal membrane-derived cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque fetal membrane-derived cell line cell An immortal epithelium-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human epithelium-derived cell line cell An immortal kidney-derived cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog kidney-derived cell line cell An immortal kidney-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle kidney-derived cell line cell An immortal comma-shaped body-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human comma-shaped body-derived cell line cell An immortal kidney-derived cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep kidney-derived cell line cell An immortal lymphocyte cell line cell that derives from turkey. Yue Liu, Yongqun He immortal turkey lymphocyte cell line cell An immortal breast-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human breast-derived cell line cell An immortal spleen-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human spleen-derived cell line cell An immortal supra-orbital vein-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human supra-orbital vein-derived cell line cell An immortal muscle cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse muscle cell line cell An immortal ear-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human ear-derived fibroblast cell line cell An immortal inguinal region-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human inguinal region-derived fibroblast cell line cell An immortal mesothelium-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human mesothelium-derived cell line cell An immortal uterus-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human uterus-derived cell line cell An immortal endometrium-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human endometrium-derived cell line cell An immortal kidney-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human kidney-derived cell line cell An immortal fibroblast cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster fibroblast cell line cell An immortal fibroblast cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat fibroblast cell line cell An immortal pair of lungs-derived cell line cell that derives from Mustelinae. Yue Liu, Yongqun He immortal Mustelinae pair of lungs-derived cell line cell An immortal brain-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse brain-derived cell line cell An immortal cell line cell that derives from chicken. Yue Liu, Yongqun He immortal chicken cell line cell An immortal cell line cell that derives from Mus musculus x Rattus norvegicus. Yue Liu, Yongqun He immortal Mus musculus x Rattus norvegicus cell line cell An immortal kidney-derived cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig kidney-derived cell line cell An immortal peripheral neuron cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat peripheral neuron cell line cell An immortal uterine cervix-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human uterine cervix-derived cell line cell An immortal heart-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human heart-derived cell line cell An immortal pituitary gland-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat pituitary gland-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from Mongolian gerbil. Yue Liu, Yongqun He immortal Mongolian gerbil pair of lungs-derived cell line cell An immortal cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep cell line cell An immortal pair of lungs-derived cell line cell that derives from gecko. Yue Liu, Yongqun He immortal gecko pair of lungs-derived cell line cell An immortal urinary bladder-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse urinary bladder-derived cell line cell An immortal gill-derived cell line cell that derives from walking catfish. Yue Liu, Yongqun He immortal walking catfish gill-derived cell line cell An immortal tongue-derived cell line cell that derives from bullfrog. Yue Liu, Yongqun He immortal bullfrog tongue-derived cell line cell An immortal follicular fluid-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human follicular fluid-derived cell line cell An immortal female gonad-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human female gonad-derived cell line cell An immortal thyroid gland-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human thyroid gland-derived cell line cell An immortal eye-derived cell line cell that derives from torafugu. Yue Liu, Yongqun He immortal torafugu eye-derived cell line cell An immortal spermatocyte cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse spermatocyte cell line cell An immortal embryo-derived cell line cell that derives from chicken. Yue Liu, Yongqun He immortal chicken embryo-derived cell line cell An immortal brain-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat brain-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse fetal membrane-derived cell line cell An immortal organism part-derived plasma cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse organism part-derived plasma cell line cell An immortal floating rib-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human floating rib-derived cell line cell An immortal urinary bladder-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat urinary bladder-derived cell line cell An immortal mammary gland-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse mammary gland-derived cell line cell An immortal blood cell line cell that derives from human. Yue Liu, Yongqun He immortal human blood cell line cell An immortal megakaryocyte-erythroid progenitor cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse megakaryocyte-erythroid progenitor cell line cell An immortal septum of telencephalon-derived cell line cell that derives from Mustelinae. Yue Liu, Yongqun He immortal Mustelinae septum of telencephalon-derived cell line cell An immortal colon-derived cell line cell that derives from guinea pig. Yue Liu, Yongqun He immortal guinea pig colon-derived cell line cell An immortal thorax-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human thorax-derived fibroblast cell line cell An immortal paired fin-derived cell line cell that derives from bluestriped grunt. Yue Liu, Yongqun He immortal bluestriped grunt paired fin-derived cell line cell An immortal neural nucleus-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat neural nucleus-derived cell line cell An immortal Ammon's horn-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat Ammon's horn-derived cell line cell An immortal organism part-derived fibroblast cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep organism part-derived fibroblast cell line cell An immortal brain-derived cell line cell that derives from ferret. Yue Liu, Yongqun He immortal ferret brain-derived cell line cell An immortal bone marrow-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse bone marrow-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse septum of telencephalon-derived cell line cell An immortal islet of Langerhans-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse islet of Langerhans-derived cell line cell An immortal kidney-derived cell line cell that derives from Miopithecus talapoin. Yue Liu, Yongqun He immortal Miopithecus talapoin kidney-derived cell line cell An immortal kidney-derived cell line cell that derives from budgerigar. Yue Liu, Yongqun He immortal budgerigar kidney-derived cell line cell An immortal thyroid gland-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse thyroid gland-derived cell line cell An immortal pyramid of medulla oblongata-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human pyramid of medulla oblongata-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from squamate. Yue Liu, Yongqun He immortal squamate pair of lungs-derived cell line cell An immortal aorta-derived cell line cell that derives from mouse. Yongqun He immortal mouse aorta-derived cell line cell An immortal uterine cervix-derived epithelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human uterine cervix-derived epithelial cell line cell An immortal ileocecal junction-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human ileocecal junction-derived cell line cell An immortal compact bone-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human compact bone-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat septum of telencephalon-derived cell line cell An immortal abdominal aorta-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human abdominal aorta-derived cell line cell An immortal bronchus-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human bronchus-derived cell line cell An immortal kidney-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster kidney-derived cell line cell An immortal pancreas-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster pancreas-derived cell line cell An immortal cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse cell line cell An immortal organism part-derived keratinocyte cell line cell that derives from human. Yue Liu, Yongqun He immortal human organism part-derived keratinocyte cell line cell An immortal iliac artery-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human iliac artery-derived cell line cell An immortal synovial membrane of synovial joint-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit synovial membrane of synovial joint-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster septum of telencephalon-derived cell line cell An immortal female gonad-derived cell line cell that derives from Himalayan Tahr. Yue Liu, Yongqun He immortal Himalayan Tahr female gonad-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from Himalayan Tahr. Yue Liu, Yongqun He immortal Himalayan Tahr fetal membrane-derived cell line cell An immortal iliac vein-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human iliac vein-derived cell line cell An immortal B cell line cell that derives from human. Yue Liu, Yongqun He immortal human B-cell line cell immortal human B cell line cell An immortal vagina-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human vagina-derived cell line cell An immortal larynx-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human larynx-derived cell line cell An immortal inferior cervical ganglion-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human inferior cervical ganglion-derived cell line cell An immortal esophagus-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human esophagus-derived cell line cell An immortal femoral artery-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human femoral artery-derived cell line cell An immortal prepuce of penis-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human prepuce of penis-derived cell line cell An immortal gingival epithelium-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human gingival epithelium-derived cell line cell An immortal gingiva-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human gingiva-derived cell line cell An immortal muscle cell line cell that derives from human. Yue Liu, Yongqun He immortal human muscle cell line cell An immortal thymus-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human thymus-derived cell line cell An immortal mouth-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human mouth-derived cell line cell An immortal neuron cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat neuron cell line cell An immortal limb/fin-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human limb/fin-derived cell line cell An immortal leukocyte cell line cell that derives from marmoset. Yue Liu, Yongqun He immortal marmoset leukocyte cell line cell An immortal peritoneal macrophage cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster peritoneal macrophage cell line cell An immortal peritoneum-derived cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster peritoneum-derived cell line cell An immortal peripheral vein-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human peripheral vein-derived cell line cell An immortal brain-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat brain-derived cell line cell An immortal exocrine cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat exocrine cell line cell An immortal kidney-derived cell line cell that derives from Atlantic salmon. Yue Liu, Yongqun He immortal Atlantic salmon kidney-derived cell line cell An immortal round window-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse round window-derived cell line cell An immortal female gonad-derived cell line cell that derives from moth. Yue Liu, Yongqun He immortal moth female gonad-derived cell line cell An immortal female gonad-derived cell line cell that derives from Antheraea. Yue Liu, Yongqun He immortal Antheraea female gonad-derived cell line cell An immortal conjunctiva structure-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human conjunctiva structure-derived fibroblast cell line cell An immortal pancreas-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat pancreas-derived cell line cell An immortal dento-alveolar joint-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human dento-alveolar joint-derived cell line cell An immortal testis-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human testis-derived cell line cell An immortal intestine-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human intestine-derived cell line cell An immortal rectum-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human rectum-derived cell line cell An immortal pulmonary vein-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human pulmonary vein-derived cell line cell An immortal islet of Langerhans-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster islet of Langerhans-derived cell line cell An immortal buttock-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human buttock-derived fibroblast cell line cell An immortal tonsil-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human tonsil-derived cell line cell An immortal thymus-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse thymus-derived cell line cell An immortal umbilicus-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human umbilicus-derived fibroblast cell line cell An immortal larva-derived cell line cell that derives from mosquito. Yue Liu, Yongqun He immortal mosquito larva-derived cell line cell An immortal thoracic aorta-derived endothelial cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig thoracic aorta-derived endothelial cell line cell An immortal kidney-derived cell line cell that derives from African clawed frog. Yue Liu, Yongqun He immortal African clawed frog kidney-derived cell line cell An immortal cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog cell line cell An immortal dento-alveolar joint-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse dento-alveolar joint-derived cell line cell An immortal posterior commissure-derived cell line cell that derives from zebra fish. Yue Liu, Yongqun He immortal zebra fish posterior commissure-derived cell line cell An immortal soft palate-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human soft palate-derived cell line cell An immortal cell line cell that derives from silk moth. Yue Liu, Yongqun He immortal silk moth cell line cell An immortal kidney-derived cell line cell that derives from hamster. Yue Liu, Yongqun He immortal hamster kidney-derived cell line cell An immortal adrenal gland-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human adrenal gland-derived cell line cell An immortal pronephros-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse pronephros-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat fetal membrane-derived cell line cell An immortal organism part-derived smooth muscle cell line cell that derives from human. Yue Liu, Yongqun He immortal human organism part-derived smooth muscle cell line cell An immortal blood cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse blood cell line cell An immortal placenta-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human placenta-derived cell line cell An immortal posterior commissure-derived cell line cell that derives from bluegill sunfish. Yue Liu, Yongqun He immortal bluegill sunfish posterior commissure-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle septum of telencephalon-derived cell line cell An immortal embryo-derived cell line cell that derives from gastropod. Yue Liu, Yongqun He immortal gastropod embryo-derived cell line cell An immortal ON-bipolar cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse ON-bipolar cell line cell An immortal pair of lungs-derived cell line cell that derives from kusimanse. Yue Liu, Yongqun He immortal kusimanse pair of lungs-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from Oryx. Yue Liu, Yongqun He immortal Oryx pair of lungs-derived cell line cell An immortal kidney-derived cell line cell that derives from Burchell's zebra. Yue Liu, Yongqun He immortal Burchell's zebra kidney-derived cell line cell An immortal embryo-derived cell line cell that derives from plantain squirrel. Yue Liu, Yongqun He immortal plantain squirrel embryo-derived cell line cell An immortal fetal membrane-derived cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep fetal membrane-derived cell line cell An immortal brain-derived cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep brain-derived cell line cell An immortal kidney-derived cell line cell that derives from Silvery marmoset. Yue Liu, Yongqun He immortal Silvery marmoset kidney-derived cell line cell An immortal kidney-derived cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque kidney-derived cell line cell An immortal monocyte cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse monocyte cell line cell An immortal neural nucleus-derived cell line cell that derives from Mus musculus x Rattus norvegicus. Yue Liu, Yongqun He immortal Mus musculus x Rattus norvegicus neural nucleus-derived cell line cell An immortal sublingual artery-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat sublingual artery-derived cell line cell An immortal female gonad-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat female gonad-derived cell line cell An immortal round window-derived cell line cell that derives from Mus musculus x Rattus norvegicus. Yue Liu, Yongqun He immortal Mus musculus x Rattus norvegicus round window-derived cell line cell An immortal thyrotroph cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse thyrotroph cell line cell An immortal pair of lungs-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat pair of lungs-derived cell line cell An immortal kidney-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat kidney-derived cell line cell An immortal aorta-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle aorta-derived cell line cell An immortal cell line cell that derives from Chinese oak silkmoth. Yue Liu, Yongqun He immortal Chinese oak silkmoth cell line cell An immortal endothelium-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle endothelium-derived cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from brown bullhead. Yue Liu, Yongqun He immortal brown bullhead mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal bone marrow-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle bone marrow-derived cell line cell An immortal macrophage cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse macrophage cell line cell An immortal ligament-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse ligament-derived cell line cell An immortal uterus-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human uterus-derived fibroblast cell line cell An immortal uterus-derived cell line cell that derives from northern raccoon. Yue Liu, Yongqun He immortal northern raccoon uterus-derived cell line cell An immortal thyroid gland-derived cell line cell that derives from sheep. Yue Liu, Yongqun He immortal sheep thyroid gland-derived cell line cell An immortal peripheral neuron cell line cell that derives from channel catfish. Yue Liu, Yongqun He immortal channel catfish peripheral neuron cell line cell An immortal animal ovary-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human ovary-derived fibroblast cell line cell An immortal kidney-derived cell line cell that derives from Aotus. Yue Liu, Yongqun He immortal Aotus kidney-derived cell line cell An immortal cerebral lobe-derived cell line cell that derives from crayfish. Yue Liu, Yongqun He immortal crayfish cerebral lobe-derived cell line cell An immortal B cell line cell that derives from chicken. Yongqun He immortal chicken B cell line cell An immortal septum of telencephalon-derived cell line cell that derives from American opossum. Yue Liu, Yongqun He immortal American opossum septum of telencephalon-derived cell line cell An immortal kidney-derived cell line cell that derives from black-tailed deer. Yue Liu, Yongqun He immortal black-tailed deer kidney-derived cell line cell An immortal liver-derived cell line cell that derives from black-tailed deer. Yue Liu, Yongqun He immortal black-tailed deer liver-derived cell line cell An immortal mixed endoderm/mesoderm-derived structure-derived cell line cell that derives from black-tailed deer. Yue Liu, Yongqun He immortal black-tailed deer mixed endoderm/mesoderm-derived structure-derived cell line cell An immortal vasculature-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse vasculature-derived cell line cell An immortal larva-derived cell line cell that derives from Pacific herring. Yue Liu, Yongqun He immortal Pacific herring larva-derived cell line cell An immortal cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig cell line cell An immortal kidney-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit kidney-derived cell line cell An immortal liver-derived cell line cell that derives from topminnow. Yue Liu, Yongqun He immortal topminnow liver-derived cell line cell An immortal thyroid gland-derived cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig thyroid gland-derived cell line cell An immortal prostate gland-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human prostate gland-derived cell line cell An immortal squamous part of temporal bone-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human squamous part of temporal bone-derived cell line cell An immortal kidney-derived cell line cell that derives from peccary. Yue Liu, Yongqun He immortal peccary kidney-derived cell line cell An immortal female gonad-derived cell line cell that derives from northern pike. Yue Liu, Yongqun He immortal northern pike female gonad-derived cell line cell An immortal pronephros-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human pronephros-derived fibroblast cell line cell An immortal adrenal gland-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat adrenal gland-derived cell line cell An immortal precursor B cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse precursor B cell line cell An immortal mucosa-derived cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig mucosa-derived cell line cell An immortal kidney-derived cell line cell that derives from Potoroo. Yue Liu, Yongqun He immortal Potoroo kidney-derived cell line cell An immortal embryo-derived cell line cell that derives from swordtail platyfish. Yue Liu, Yongqun He immortal swordtail platyfish embryo-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster pair of lungs-derived cell line cell An immortal epidermis-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human epidermis-derived cell line cell An immortal submandibular gland-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human submandibular gland-derived cell line cell An immortal lung-derived mesothelial cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat lung-derived mesothelial cell line cell An immortal lung-derived mesothelial cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle lung-derived mesothelial cell line cell An immortal eye structure-derived epithelial cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit eye structure-derived epithelial cell line cell An immortal hip-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human hip-derived fibroblast cell line cell An immortal parietal cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse parietal cell line cell An immortal prostate epithelium-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human prostate epithelium-derived cell line cell An immortal retinal neural layer-derived cell line cell that derives from Japanese quail. Yue Liu, Yongqun He immortal Japanese quail retinal neural layer-derived cell line cell An immortal fibroblast cell line cell that derives from Japanese quail. Yue Liu, Yongqun He immortal Japanese quail fibroblast cell line cell An immortal testis-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat testis-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit pair of lungs-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque septum of telencephalon-derived cell line cell An immortal ureter-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human ureter-derived cell line cell An immortal pyramid of medulla oblongata-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat pyramid of medulla oblongata-derived cell line cell An immortal iliac vein-derived smooth muscle cell line cell that derives from human. Yue Liu, Yongqun He immortal human iliac vein-derived smooth muscle cell line cell An immortal common iliac artery-derived smooth muscle cell line cell that derives from human. Yue Liu, Yongqun He immortal human common iliac artery-derived smooth muscle cell line cell An immortal mammary gland-derived keratinocyte cell line cell that derives from human. Yue Liu, Yongqun He immortal human mammary gland-derived keratinocyte cell line cell An immortal skin-derived fibroblast cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig skin-derived fibroblast cell line cell An immortal lung-derived fibroblast cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig lung-derived fibroblast cell line cell An immortal organism part-derived fibroblast cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster organism part-derived fibroblast cell line cell An immortal umbilical vein-derived endothelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human umbilical vein-derived endothelial cell line cell An immortal scalp-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human scalp-derived fibroblast cell line cell An immortal organism part-derived cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee organism part-derived cell line cell An immortal skeletal muscle-derived myoblast cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee skeletal muscle-derived myoblast cell line cell An immortal organism part-derived endothelial cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee organism part-derived endothelial cell line cell An immortal embryo-derived fibroblast cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse embryo-derived fibroblast cell line cell An immortal sacrum-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human sacrum-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from hamadryas baboon. Yue Liu, Yongqun He immortal hamadryas baboon skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from vervet monkey. Yue Liu, Yongqun He immortal vervet monkey skin-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from siamang. Yue Liu, Yongqun He immortal siamang peripheral vein-derived B cell line cell An immortal skin-derived fibroblast cell line cell that derives from king colobus. Yue Liu, Yongqun He immortal king colobus skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from South American squirrel monkey. Yue Liu, Yongqun He immortal South American squirrel monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Francois's langur. Yue Liu, Yongqun He immortal Francois's langur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from agile mangabey. Yue Liu, Yongqun He immortal agile mangabey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from gray-cheeked mangabey. Yue Liu, Yongqun He immortal gray-cheeked mangabey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from cotton-top tamarin. Yue Liu, Yongqun He immortal cotton-top tamarin skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from black-cheeked white-nosed monkey. Yue Liu, Yongqun He immortal black-cheeked white-nosed monkey skin-derived fibroblast cell line cell An immortal shoulder-derived fibroblast cell line cell that derives from Midas tamarin. Yue Liu, Yongqun He immortal Midas tamarin shoulder-derived fibroblast cell line cell An immortal hip-derived fibroblast cell line cell that derives from Midas tamarin. Yue Liu, Yongqun He immortal Midas tamarin hip-derived fibroblast cell line cell An immortal thigh-derived fibroblast cell line cell that derives from golden-crowned sifaka. Yue Liu, Yongqun He immortal golden-crowned sifaka thigh-derived fibroblast cell line cell An immortal arm-derived fibroblast cell line cell that derives from Midas tamarin. Yue Liu, Yongqun He immortal Midas tamarin arm-derived fibroblast cell line cell An immortal placenta-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human placenta-derived fibroblast cell line cell An immortal dermis-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster dermis-derived cell line cell An immortal embryo-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster embryo-derived cell line cell An immortal cornea-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit cornea-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit septum of telencephalon-derived cell line cell An immortal mammalian vulva-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human mammalian vulva-derived cell line cell An immortal spherical lensed eye-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human spherical lensed eye-derived cell line cell An immortal aorta-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat aorta-derived cell line cell An immortal skeletal muscle-derived myoblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human skeletal muscle-derived myoblast cell line cell An immortal ileum-derived cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig ileum-derived cell line cell An immortal larva-derived cell line cell that derives from gypsy moth. Yue Liu, Yongqun He immortal gypsy moth larva-derived cell line cell An immortal female gonad-derived cell line cell that derives from gypsy moth. Yue Liu, Yongqun He immortal gypsy moth female gonad-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from African buffalo. Yue Liu, Yongqun He immortal African buffalo lung-derived cell line cell An immortal fibroblast cell line cell that derives from Mongolian gerbil. Yue Liu, Yongqun He immortal Mongolian gerbil fibroblast cell line cell An immortal skin-derived cell line cell that derives from Muntjacs. Yue Liu, Yongqun He immortal Muntjacs skin-derived cell line cell An immortal cervix-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human cervix-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from brown lemur. Yue Liu, Yongqun He immortal brown lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Wolf's monkey. Yue Liu, Yongqun He immortal Wolf's monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from mandrill. Yue Liu, Yongqun He immortal mandrill skin-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from Red-cheeked gibbon. Yue Liu, Yongqun He immortal Red-cheeked gibbon peripheral vein-derived B cell line cell An immortal skin-derived fibroblast cell line cell that derives from red-crowned mangabey. Yue Liu, Yongqun He immortal red-crowned mangabey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Bolivian squirrel monkey. Yue Liu, Yongqun He immortal Bolivian squirrel monkey skin-derived fibroblast cell line cell An immortal abdominal cavity-derived fibroblast cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque abdominal cavity-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from brown woolly monkey. Yue Liu, Yongqun He immortal brown woolly monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from moustached monkey. Yue Liu, Yongqun He immortal moustached monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Moholi bushbaby. Yue Liu, Yongqun He immortal Moholi bushbaby skin-derived fibroblast cell line cell An immortal thigh-derived fibroblast cell line cell that derives from Celebes crested macaque. Yue Liu, Yongqun He immortal Celebes crested macaque thigh-derived fibroblast cell line cell An immortal rhomboid-derived myoblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human rhomboid-derived myoblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from crowned lemur. Yue Liu, Yongqun He immortal crowned lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from white sifaka. Yue Liu, Yongqun He immortal white sifaka skin-derived fibroblast cell line cell An immortal thorax-derived fibroblast cell line cell that derives from drill. Yue Liu, Yongqun He immortal drill thorax-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from white-faced saki. Yue Liu, Yongqun He immortal white-faced saki skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from aye-aye. Yue Liu, Yongqun He immortal aye-aye skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from bamboo lemur. Yue Liu, Yongqun He immortal bamboo lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Goeldi's monkey. Yue Liu, Yongqun He immortal Goeldi's monkey skin-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from Bornean orangutan. Yue Liu, Yongqun He immortal Bornean orangutan peripheral vein-derived B cell line cell An immortal peripheral vein-derived B cell line cell that derives from pileated gibbon. Yue Liu, Yongqun He immortal pileated gibbon peripheral vein-derived B cell line cell An immortal organism part-derived fibroblast cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog organism part-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Bolivian red howler monkey. Yue Liu, Yongqun He immortal Bolivian red howler monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Miopithecus talapoin. Yue Liu, Yongqun He immortal Miopithecus talapoin skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Pere David's macaque. Yue Liu, Yongqun He immortal Pere David's macaque skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from White-cheeked Gibbon. Yue Liu, Yongqun He immortal White-cheeked Gibbon skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from saddlebacked tamarin. Yue Liu, Yongqun He immortal saddlebacked tamarin skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from L'Hoest's monkey. Yue Liu, Yongqun He immortal L'Hoest's monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from proboscis monkey. Yue Liu, Yongqun He immortal proboscis monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from pygmy marmoset. Yue Liu, Yongqun He immortal pygmy marmoset skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Spix's night monkey. Yue Liu, Yongqun He immortal Spix's night monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Nancy Ma's night monkey. Yue Liu, Yongqun He immortal Nancy Ma's night monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from slow loris. Yue Liu, Yongqun He immortal slow loris skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Lesser dwarf lemur. Yue Liu, Yongqun He immortal Lesser dwarf lemur skin-derived fibroblast cell line cell An immortal abdominal cavity-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human abdominal cavity-derived cell line cell An immortal skin-derived fibroblast cell line cell that derives from Red-bellied titi. Yue Liu, Yongqun He immortal Red-bellied titi skin-derived fibroblast cell line cell An immortal vasculature-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human vasculature-derived cell line cell An immortal umbilical vein-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human umbilical vein-derived cell line cell An immortal duodenum-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human duodenum-derived cell line cell An immortal blood cell line cell that derives from marmoset. Yue Liu, Yongqun He immortal marmoset blood cell line cell An immortal skin-derived fibroblast cell line cell that derives from Coquerel's mouse lemur. Yue Liu, Yongqun He immortal Coquerel's mouse lemur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from lesser white-nosed monkey. Yue Liu, Yongqun He immortal lesser white-nosed monkey skin-derived fibroblast cell line cell An immortal ileum-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat ileum-derived cell line cell An immortal skin-derived fibroblast cell line cell that derives from Yellow baboon. Yue Liu, Yongqun He immortal Yellow baboon skin-derived fibroblast cell line cell An immortal embryo-derived cell line cell that derives from Neobatrachia. Yue Liu, Yongqun He immortal Neobatrachia embryo-derived cell line cell An immortal skin-derived fibroblast cell line cell that derives from blue monkey. Yue Liu, Yongqun He immortal blue monkey skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Celebes crested macaque. Yue Liu, Yongqun He immortal Celebes crested macaque skin-derived fibroblast cell line cell An immortal peripheral vein-derived B cell line cell that derives from agile gibbon. Yue Liu, Yongqun He immortal agile gibbon peripheral vein-derived B cell line cell An immortal skin-derived fibroblast cell line cell that derives from Hanuman langur. Yue Liu, Yongqun He immortal Hanuman langur skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from Geoffroy's marmoset. Yue Liu, Yongqun He immortal Geoffroy's marmoset skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from coppery titi. Yue Liu, Yongqun He immortal coppery titi skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from slender loris. Yue Liu, Yongqun He immortal slender loris skin-derived fibroblast cell line cell An immortal skin-derived fibroblast cell line cell that derives from liontail macaque. Yue Liu, Yongqun He immortal liontail macaque skin-derived fibroblast cell line cell An immortal connective tissue-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human connective tissue-derived cell line cell An immortal bone marrow-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human bone marrow-derived cell line cell An immortal parotid gland-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human parotid gland-derived cell line cell An immortal cell line cell that derives from true toad. Yue Liu, Yongqun He immortal true toad cell line cell An immortal skin-derived cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster skin-derived cell line cell An immortal follicular fluid-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat follicular fluid-derived cell line cell An immortal eye-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human eye-derived cell line cell An immortal ischium-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human ischium-derived fibroblast cell line cell An immortal embryo-derived cell line cell that derives from zebra fish. Yue Liu, Yongqun He immortal zebra fish embryo-derived cell line cell An immortal parenchymal cell line cell that derives from zebra fish. Yue Liu, Yongqun He immortal zebra fish parenchymal cell line cell An immortal buttock-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human buttock-derived cell line cell An immortal anatomical cluster-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human anatomical cluster-derived cell line cell An immortal thigh-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human thigh-derived cell line cell An immortal heart-derived cell line cell that derives from Iguana. Yue Liu, Yongqun He immortal Iguana heart-derived cell line cell An immortal chordate pharynx-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human chordate pharynx-derived cell line cell An immortal retina-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human retina-derived cell line cell An immortal skin-derived cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee skin-derived cell line cell An immortal fibroblast cell line cell that derives from walleye. Yue Liu, Yongqun He immortal walleye fibroblast cell line cell An immortal neural nucleus-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse neural nucleus-derived cell line cell An immortal yolk sac-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse yolk sac-derived cell line cell An immortal nasal concha-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle nasal concha-derived cell line cell An immortal cell line cell that derives from tick. Yue Liu, Yongqun He immortal tick cell line cell An immortal female gonad-derived cell line cell that derives from silk moth. Yue Liu, Yongqun He immortal silk moth female gonad-derived cell line cell An immortal arm-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human arm-derived cell line cell An immortal peripheral vein-derived B cell line cell that derives from Kenya baboon. Yue Liu, Yongqun He immortal Kenya baboon peripheral vein-derived B cell line cell An immortal sacrum-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human sacrum-derived cell line cell An immortal conjunctiva-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human conjunctiva-derived cell line cell An immortal epithelial cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat epithelial cell line cell An immortal submandibular gland-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse submandibular gland-derived cell line cell An immortal single nucleate cell line cell that derives from human. Yue Liu, Yongqun He immortal human single nucleate cell line cell An immortal trachea-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human trachea-derived cell line cell An immortal tongue-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human tongue-derived cell line cell An immortal thigh-derived fibroblast cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig thigh-derived fibroblast cell line cell An immortal trachea-derived cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog trachea-derived cell line cell An immortal thymus-derived cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog thymus-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from bat. Yue Liu, Yongqun He immortal bat lung-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from free-tailed bat. Yue Liu, Yongqun He immortal free-tailed bat pair of lungs-derived cell line cell An immortal urinary bladder-derived cell line cell that derives from Bufo. Yue Liu, Yongqun He immortal Bufo urinary bladder-derived cell line cell An immortal dento-alveolar joint-derived cell line cell that derives from white-tufted-ear marmoset. Yue Liu, Yongqun He immortal white-tufted-ear marmoset dento-alveolar joint-derived cell line cell An immortal skin-derived cell line cell that derives from anteater. Yue Liu, Yongqun He immortal anteater skin-derived cell line cell An immortal aorta-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human aorta-derived cell line cell An immortal lymphoid follicle-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human lymphoid follicle-derived cell line cell An immortal bone element-derived cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog bone element-derived cell line cell An immortal respiration organ-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse respiration organ-derived cell line cell An immortal fusion competent myoblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human fusion competent myoblast cell line cell An immortal female gonad-derived cell line cell that derives from channel catfish. Yue Liu, Yongqun He immortal channel catfish female gonad-derived cell line cell An immortal muscle spindle-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse muscle spindle-derived cell line cell An immortal testis-derived cell line cell that derives from pig. Yue Liu, Yongqun He immortal pig testis-derived cell line cell An immortal embryo-derived cell line cell that derives from sockeye salmon. Yue Liu, Yongqun He immortal sockeye salmon embryo-derived cell line cell An immortal renal glomerulus-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse renal glomerulus-derived cell line cell An immortal liver-derived cell line cell that derives from rainbow trout. Yue Liu, Yongqun He immortal rainbow trout liver-derived cell line cell An immortal nephron tubule-derived cell line cell that derives from Bolivian squirrel monkey. Yue Liu, Yongqun He immortal Bolivian squirrel monkey nephron tubule-derived cell line cell An immortal larva-derived cell line cell that derives from silk moth. Yue Liu, Yongqun He immortal silk moth larva-derived cell line cell An immortal sternum-derived cell line cell that derives from geese. Yue Liu, Yongqun He immortal geese sternum-derived cell line cell An immortal neuron cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse neuron cell line cell An immortal esophagus-derived cell line cell that derives from goat. Yue Liu, Yongqun He immortal goat esophagus-derived cell line cell An immortal hypodermis-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human hypodermis-derived cell line cell An immortal skin-derived cell line cell that derives from goat. Yue Liu, Yongqun He immortal goat skin-derived cell line cell An immortal embryo-derived cell line cell that derives from Chinook salmon. Yue Liu, Yongqun He immortal Chinook salmon embryo-derived cell line cell An immortal embryo-derived cell line cell that derives from Salmonidae. Yue Liu, Yongqun He immortal Salmonidae embryo-derived cell line cell An immortal neuroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human neuroblast cell line cell An immortal embryo-derived cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster embryo-derived cell line cell An immortal leukocyte cell line cell that derives from carp. Yue Liu, Yongqun He immortal carp leukocyte cell line cell An immortal B cell line cell that derives from human. Yongqun He immortal mouse B cell line cell An immortal heart-derived cell line cell that derives from chum salmon. Yue Liu, Yongqun He immortal chum salmon heart-derived cell line cell An immortal bone element-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat bone element-derived cell line cell An immortal monocyte cell line cell that derives from human. Yue Liu, Yongqun He immortal human monocyte cell line cell An immortal thorax-derived fibroblast cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog thorax-derived fibroblast cell line cell An immortal proximal tubule-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit proximal tubule-derived cell line cell An immortal cell line cell that derives from Chinese hamster. Yue Liu, Yongqun He immortal Chinese hamster cell line cell An immortal fibroblast cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit fibroblast cell line cell An immortal kidney-derived cell line cell that derives from African green monkey polyomavirus. Yue Liu, Yongqun He immortal African green monkey polyomavirus kidney-derived cell line cell An immortal aorta-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit aorta-derived cell line cell An immortal dermis-derived cell line cell that derives from hagfish. Yue Liu, Yongqun He immortal hagfish dermis-derived cell line cell An immortal embryo-derived cell line cell that derives from white bass. Yue Liu, Yongqun He immortal white bass embryo-derived cell line cell An immortal colon-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat colon-derived cell line cell An immortal liver-derived cell line cell that derives from woodchuck. Yue Liu, Yongqun He immortal woodchuck liver-derived cell line cell An immortal mucosa of vagina-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human mucosa of vagina-derived cell line cell An immortal heart-derived cell line cell that derives from Russell's viper. Yue Liu, Yongqun He immortal Russell's viper heart-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from Russell's viper. Yue Liu, Yongqun He immortal Russell's viper septum of telencephalon-derived cell line cell An immortal fusion competent myoblast cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat fusion competent myoblast cell line cell An immortal heart-derived cell line cell that derives from Terrapene. Yue Liu, Yongqun He immortal Terrapene heart-derived cell line cell An immortal cell line cell that derives from cabbage looper. Yue Liu, Yongqun He immortal cabbage looper cell line cell An immortal larva-derived cell line cell that derives from cabbage looper. Yue Liu, Yongqun He immortal cabbage looper larva-derived cell line cell An immortal multi-cellular organism-derived cell line cell that derives from mosquito. Yue Liu, Yongqun He immortal mosquito multi-cellular organism-derived cell line cell An immortal dento-alveolar joint-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat dento-alveolar joint-derived cell line cell An immortal kidney-derived cell line cell that derives from rainbow trout. Yue Liu, Yongqun He immortal rainbow trout kidney-derived cell line cell An immortal prostate gland-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse prostate gland-derived cell line cell An immortal embryo-derived cell line cell that derives from rat. Yue Liu, Yongqun He immortal rat embryo-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from deer. Yue Liu, Yongqun He immortal deer pair of lungs-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse septum of telencephalon-derived cell line cell An immortal dermis-derived cell line cell that derives from horse. Yue Liu, Yongqun He immortal horse dermis-derived cell line cell An immortal epithelial cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog epithelial cell line cell An immortal skin-derived cell line cell that derives from camel. Yue Liu, Yongqun He immortal camel skin-derived cell line cell An immortal embryo-derived cell line cell that derives from duck. Yue Liu, Yongqun He immortal duck embryo-derived cell line cell An immortal fibroblast cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog fibroblast cell line cell An immortal hematopoietic cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse hematopoietic cell line cell An immortal skin-derived cell line cell that derives from European rabbit, rabbit. Yue Liu, Yongqun He immortal European rabbit, rabbit skin-derived cell line cell An immortal blood cell line cell that derives from Gorilla. Yue Liu, Yongqun He immortal Gorilla blood cell line cell An immortal trachea-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle trachea-derived cell line cell An immortal blood cell line cell that derives from chimpanzee. Yue Liu, Yongqun He immortal chimpanzee blood cell line cell An immortal blood cell line cell that derives from Sumatran orangutan. Yue Liu, Yongqun He immortal Sumatran orangutan blood cell line cell An immortal larva-derived cell line cell that derives from Acrea moth. Yue Liu, Yongqun He immortal Acrea moth larva-derived cell line cell An immortal endocervix-derived cell line cell that derives from human. Yue Liu, Yongqun He immortal human endocervix-derived cell line cell An immortal adrenal gland-derived cell line cell that derives from cattle. Yue Liu, Yongqun He immortal cattle adrenal gland-derived cell line cell An immortal cell line cell that derives from Dzhungarian hamster. Yue Liu, Yongqun He immortal Dzhungarian hamster cell line cell An immortal testis-derived cell line cell that derives from dolphin. Yue Liu, Yongqun He immortal dolphin testis-derived cell line cell An immortal cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster cell line cell An immortal pair of lungs-derived cell line cell that derives from vervet monkey. Yue Liu, Yongqun He immortal vervet monkey pair of lungs-derived cell line cell An immortal pair of lungs-derived cell line cell that derives from rhesus macaque. Yue Liu, Yongqun He immortal rhesus macaque pair of lungs-derived cell line cell An immortal embryo-derived cell line cell that derives from Drosophila hydei. Yue Liu, Yongqun He immortal Drosophila hydei embryo-derived cell line cell An immortal macrophage cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog macrophage cell line cell An immortal fetal membrane-derived cell line cell that derives from Bolivian squirrel monkey. Yue Liu, Yongqun He immortal Bolivian squirrel monkey fetal membrane-derived cell line cell An immortal trachea-derived cell line cell that derives from nine-banded armadillo. Yue Liu, Yongqun He immortal nine-banded armadillo trachea-derived cell line cell An immortal arm-derived fibroblast cell line cell that derives from Ring-tailed lemur. Yue Liu, Yongqun He immortal Ring-tailed lemur arm-derived fibroblast cell line cell An immortal organism part-derived mesothelial cell line cell that derives from human. Yue Liu, Yongqun He immortal human organism part-derived mesothelial cell line cell An immortal arm-derived fibroblast cell line cell that derives from Celebes crested macaque. Yue Liu, Yongqun He immortal Celebes crested macaque arm-derived fibroblast cell line cell An immortal embryo-derived cell line cell that derives from fruit fly. Yue Liu, Yongqun He immortal fruit fly embryo-derived cell line cell An immortal septum of telencephalon-derived cell line cell that derives from dog. Yue Liu, Yongqun He immortal dog septum of telencephalon-derived cell line cell An immortal cell line cell that derives from long-tailed macaque. Yue Liu, Yongqun He immortal long-tailed macaque cell line cell An immortal cell line cell that derives from gold fish. Yue Liu, Yongqun He immortal gold fish cell line cell An immortal cell line cell that derives from turnip moth. Yue Liu, Yongqun He immortal turnip moth cell line cell An immortal skin-derived cell line cell that derives from Cottontail rabbit. Yue Liu, Yongqun He immortal Cottontail rabbit skin-derived cell line cell An immortal colon-derived cell line cell that derives from mouse. Yue Liu, Yongqun He immortal mouse colon-derived cell line cell An immortal fibroblast cell line cell that derives from coho salmon. Yue Liu, Yongqun He immortal coho salmon fibroblast cell line cell An immortal septum of telencephalon-derived cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat septum of telencephalon-derived cell line cell An immortal shoulder-derived fibroblast cell line cell that derives from human. Yue Liu, Yongqun He immortal human shoulder-derived fibroblast cell line cell An immortal thoracic aorta-derived smooth muscle cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster thoracic aorta-derived smooth muscle cell line cell An immortal abdominal cavity-derived fibroblast cell line cell that derives from Syrian golden hamster. Yue Liu, Yongqun He immortal Syrian golden hamster abdominal cavity-derived fibroblast cell line cell An immortal organism part-derived fibroblast cell line cell that derives from cat. Yue Liu, Yongqun He immortal cat organism part-derived fibroblast cell line cell 35 35 cell HyperCLDB: cl59 81.3 81.3 cell HyperCLDB: cl131 162 162 cell HyperCLDB: cl18 163 163 cell HyperCLDB: cl19 167.2 167.2 cell HyperCLDB: cl20 182.1 182.1 cell HyperCLDB: cl26 311 311 cell HyperCLDB: cl56 380 disease: leukemia, pre-B cell 380 cell HyperCLDB: cl4977 LCL-1042 697 697 cell CHEMBL: CHEMBL3308147 CVCL: CVCL_0079 HyperCLDB: cl117 Sanger: COSMIC ID:906800 1221 1221 cell HyperCLDB: cl3 1301 1301 cell HyperCLDB: cl5401 1306 1306 cell HyperCLDB: cl4 2211 2211 cell HyperCLDB: cl37 4647 4647 cell HyperCLDB: cl97 9229 9229 cell HyperCLDB: cl139 9923 9923 cell HyperCLDB: cl141 37868 disease: hybridoma 37868 cell HyperCLDB: cl5121 94022802 94022802 cell HyperCLDB: cl5167 #490 disease: hybridoma #490 cell ATCC: HB-12029 (BF1) 8A3.31 (BF1) 8A3.31 cell ATCC: HB-9283 +/+ (A) +/+ (A) cell ATCC: CRL-6470 +/+ (B) +/+ (B) cell ATCC: CRL-6471 +/+ Li +/+ Li cell ATCC: CRL-6467 +/+ MGT +/+ MGT cell ATCC: CRL-6468 +/+ SCT +/+ SCT cell ATCC: CRL-6469 022HU-NSO disease: transfected 022HU-NSO cell ATCC: CRL-11177 10.014 pRSV-T https://www.atcc.org/en/Products/Cells_and_Microorganisms/By_Tissue/Eye/CRL-11515.aspx 10.014 pRSV-T cell ATCC: CRL-11515 10-1.D.2 disease: hybridoma 10-1.D.2 cell ATCC: TIB-165 10-2.16 disease: hybridoma 10-2.16 cell ATCC: TIB-93 10-3.6.2 disease: hybridoma 10-3.6.2 cell ATCC: TIB-92 104C1 104C1 cell ATCC: CRL-1405 10B9 10B9 cell ATCC: HB-172 10C4.1.3 disease: hybridoma 10C4.1.3 cell ATCC: HB-11029 10C7 10C7 cell ATCC: CRL-2430 10D2F6 disease: hybridoma 10D2F6 cell ATCC: HB-11103 10E5 10E5 cell ATCC: HB-8513 10F7MN disease: hybridoma 10F7MN cell ATCC: HB-8162 10H2.12.1 10H2.12.1 cell ATCC: HB-11494 10P12 disease: AMLV-induced tumor 10P12 cell ATCC: CRL-2036 10P2 disease: AMLV-induced tumor 10P2 cell ATCC: CRL-2034 110-5 disease: hybridoma 110-5 cell ATCC: HB-8984 1116-NS-19-9 1116-NS-19-9 cell ATCC: HB-8059 1116NS-3d disease: hybridoma 1116NS-3d cell ATCC: CRL-8019 11-26c 11-26c cell ATCC: HB-250 11-4.1 disease: hybridoma 11-4.1 cell ATCC: TIB-95 11-5.2.1.9 11-5.2.1.9 cell ATCC: TIB-94 116 116 cell ATCC: HB-9367 116-13.1 116-13.1 cell ATCC: HB-129 1184 1184 cell HyperCLDB: cl2 11B11 11B11 cell ATCC: HB-188 11E10 11E10 cell ATCC: CRL-1907 11F11 disease: hybridoma 11F11 cell ATCC: CRL-1908 11P0-1 11P0-1 cell ATCC: CRL-2037 12.1 12.1 cell ATCC: HB-228 12/44 disease: hybridoma 12/44 cell ATCC: HB-9070 12/49 12/49 cell ATCC: HB-9071 LCL-1236 1205Lu disease: primary superficial spreading melanoma in vertical growth phase; from lung metastases in mice 1205Lu cell ATCC: CRL-2812 121-19B10 disease: hybridoma 121-19B10 cell ATCC: CRL-2652 12-2-2S (clone 5F11) 12-2-2S (clone 5F11) cell ATCC: HB-50 123-10 disease: hybridoma 123-10 cell ATCC: CRL-1707 123-28 disease: hybridoma 123-28 cell ATCC: CRL-1713 127H 127H cell ATCC: HB-11911 127TAg disease: immortalized with SV40 large T antigen 127TAg cell ATCC: CRL-2817 129A3/1 disease: hybridoma 129A3/1 cell ATCC: HB-8087 12-A-3 12-A-3 cell ATCC: CRL-6476 12A5B7 disease: hybridoma 12A5B7 cell ATCC: HB-8328 12MBr6 12MBr6 cell ATCC: CRL-1576 13.90.2 disease: hybridoma 13.90.2 cell ATCC: HB-8337 130-3-F7-5 disease: hybridoma 130-3-F7-5 cell ATCC: HB-8326 130C3/2B/8 disease: hybridoma 130C3/2B/8 cell ATCC: HB-8088 131-94H4 131-94H4 cell ATCC: CRL-2739 132-1C8 disease: hybridoma 132-1C8 cell ATCC: CRL-2737 LCL-1393 1321N1 1321N1 cell ECACC: 86030402 HyperCLDB: cl5 132C4A/4 disease: hybridoma 132C4A/4 cell ATCC: HB-8086 133-10F6 disease: hybridoma 133-10F6 cell ATCC: CRL-2738 13-5-9-6-2 13-5-9-6-2 cell ATCC: HB-8934 13762 MAT B III 13762 MAT B III cell ATCC: CRL-1666 13C4 disease: hybridoma 13C4 cell ATCC: CRL-1794 14.012.8.1 14.012.8.1 cell HyperCLDB: cl8 14.8 14.8 cell ATCC: TIB-164 1410 KG7 1410 KG7 cell ATCC: HB-43 141PF11 141PF11 cell ATCC: HB-45 142-24E5 disease: hybridoma 142-24E5 cell ATCC: CRL-2649 142BR 142BR cell HyperCLDB: cl9 143 B 143 B cell HyperCLDB: cl10 143.98.2 143.98.2 cell ATCC: CRL-11226 143-2-A6-11 disease: hybridoma 143-2-A6-11 cell ATCC: HB-8325 143-4-2 143-4-2 cell ATCC: CRL-1970 LCL-1417 143B 143B cell ATCC: CRL-8303 CHEMBL: CHEMBL3307382 CVCL: CVCL_2270 LCL-1418 ZN 143B PML BK TK 143B PML BK TK cell ATCC: CRL-8304 14-4-4S 14-4-4S cell ATCC: HB-32 145-2C11 145-2C11 cell ATCC: CRL-1975 146-03E04 disease: hybridoma 146-03E04 cell ATCC: CRL-2650 147-67C6 disease: hybridoma 147-67C6 cell ATCC: CRL-2654 149BR 149BR cell HyperCLDB: cl12 14E5 disease: hybridoma 14E5 cell ATCC: HB-174 151-5-G2-12 disease: hybridoma 151-5-G2-12 cell ATCC: HB-8322 151-5-G3-5 disease: hybridoma 151-5-G3-5 cell ATCC: HB-8323 15-1-5P disease: hybridoma 15-1-5P cell ATCC: HB-53 151-6-A7-9 151-6-A7-9 cell ATCC: HB-8324 151TAg 151TAg cell ATCC: CRL-2823 15-3-1S disease: hybridoma 15-3-1S cell ATCC: HB-13 153BR 153BR cell HyperCLDB: cl13 15-5-5S disease: hybridoma 15-5-5S cell ATCC: HB-24 155BR 155BR cell HyperCLDB: cl16 15-79-2 disease: liver/pre-B lymphoblast hybridoma 15-79-2 cell ATCC: HB-34 158.2 158.2 cell ATCC: HB-8466 15B2 disease: hybridoma 15B2 cell ATCC: HB-8510 15C6 15C6 cell ATCC: CRL-2431 15C6 disease: hybridoma 15C6 cell ATCC: HB-326 15F3-1 15F3-1 cell ATCC: HB-47 15F7 15F7 cell ATCC: HB-322 15P-1 15P-1 cell ATCC: CRL-2618 16-10A1 16-10A1 cell ATCC: HB-301 16-1-11N 16-1-11N cell ATCC: HB-16 16-1-2N 16-1-2N cell ATCC: HB-14 161BR 161BR cell HyperCLDB: cl17 162-21.2 disease: hybridoma 162-21.2 cell ATCC: HB-241 162-46.2 162-46.2 cell ATCC: HB-187 16-3-1N disease: hybridoma 16-3-1N cell ATCC: HB-25 16-3-22S 16-3-22S cell ATCC: HB-5 166-ME SK disease: hereditary adenomatosis (Gardner's variant) 166-ME SK cell ATCC: CRL-1533 16H3 16H3 cell ATCC: CRL-2385 16M3F10 disease: hybridoma 16M3F10 cell ATCC: HB-8363 17/14 17/14 cell ATCC: HB-8153 171-11B9 disease: hybridoma 171-11B9 cell ATCC: CRL-2661 171-4 disease: hybridoma 171-4 cell ATCC: HB-296 171BR 171BR cell HyperCLDB: cl21 172-12A4 disease: hybridoma 172-12A4 cell ATCC: CRL-2660 173-1C11 disease: hybridoma 173-1C11 cell ATCC: CRL-2659 17-3-3S disease: hybridoma 17-3-3S cell ATCC: HB-6 174BR 174BR cell HyperCLDB: cl22 175BR 175BR cell HyperCLDB: cl23 17aba disease: hybridoma 17aba cell ATCC: HB-248 17D disease: hybridoma 17D cell ATCC: HB-262 180BR 180BR cell HyperCLDB: cl24 182-PF SK disease: hereditary adenomatosis 182-PF SK cell ATCC: CRL-1532 LCL-2080 184A1 184A1 cell ATCC: CRL-8798 CRL-8798 LCL-2081 184B5 184B5 cell ATCC: CRL-8799 CRL-8799 187.1 disease: hybridoma 187.1 cell ATCC: HB-58 18C2.8.3 18C2.8.3 cell ATCC: HB-9571 1939-3G5 disease: hybridoma 1939-3G5 cell ATCC: HB-8133 1939-8G2 1939-8G2 cell ATCC: HB-8134 19F8 19F8 cell ATCC: HB-321 19X14 19X14 cell HyperCLDB: cl27 1A subscript(3) 1A subscript(3) cell ATCC: HB-8563 1A2 1A2 cell ATCC: CRL-8119 1A3.1 disease: hybridoma 1A3.1 cell ATCC: CRL-1961 1A3.3.13 disease: hybridoma 1A3.3.13 cell ATCC: HB-11894 LCL-1703 1A6 disease: carcinoma; produces p-CSF 1A6 cell ATCC: CRL-2742 1B2-1B7 disease: hybridoma 1B2-1B7 cell ATCC: TIB-189 1B2A3 1B2A3 cell ATCC: CRL-1965 1B7.11 1B7.11 cell ATCC: TIB-191 1B8-F11 disease: hybridoma 1B8-F11 cell ATCC: CRL-1852 1BR.3.G 1BR.3.G cell HyperCLDB: cl28 1BR.3.GN 1BR.3.GN cell HyperCLDB: cl29 1BR.3.N 1BR.3.N cell HyperCLDB: cl30 1BR3 1BR3 cell HyperCLDB: cl31 1C3 disease: hybridoma 1C3 cell ATCC: CRL-2441 1C6 1C6 cell ATCC: HB-12330 1D11.16.8 disease: hybridoma 1D11.16.8 cell ATCC: HB-9849 1D3 disease: hybridoma 1D3 cell ATCC: HB-305 1D4 disease: hybridoma 1D4 cell ATCC: HB-8068 1F5 disease: hybridoma 1F5 cell ATCC: HB-9645 1G1 disease: hybridoma 1G1 cell ATCC: HB-12624 1G10 disease: hybridoma 1G10 cell ATCC: CRL-2223 1G12 1G12 cell ATCC: CRL-2827 1G2 disease: somatic cell hybrid; Burkitt's lymphoma 1G2 cell ATCC: CRL-13005 1G3 1G3 cell ATCC: CRL-2434 1G8 1G8 cell ATCC: CRL-2756 1H10-6 1H10-6 cell ATCC: HB-48 1H11 1H11 cell ATCC: HB-10611 1H3 1H3 cell ATCC: HB-284 2 BD4 E4 K99 disease: hybridoma 2 BD4 E4 K99 cell HyperCLDB: cl5027 2.03.7 2.03.7 cell ATCC: HB-8389 2.040 pRSV-T disease: immortalized with SV40 early region 2.040 pRSV-T cell ATCC: CRL-11516 2.2.15 2.2.15 cell HyperCLDB: cl33 2.28 M1 disease: hybridoma 2.28 M1 cell ATCC: HB-166 2.43 2.43 cell ATCC: TIB-210 2.4G2 disease: hybridoma 2.4G2 cell ATCC: HB-197 20.3 20.3 cell ATCC: CRL-2655 200-3-G6-4 disease: hybridoma 200-3-G6-4 cell ATCC: HB-8737 200D 200D cell HyperCLDB: cl34 20-10-5S 20-10-5S cell ATCC: HB-23 201-45E9 disease: hybridoma 201-45E9 cell ATCC: CRL-2670 2018 2018 cell ATCC: CRL-10907 202-11A8 disease: hybridoma 202-11A8 cell ATCC: CRL-2669 203-7D10 203-7D10 cell ATCC: CRL-2651 204-4 disease: hybridoma 204-4 cell ATCC: HB-185 20-8-4S disease: hybridoma 20-8-4S cell ATCC: HB-11 208F 208F cell HyperCLDB: cl36 20B8 disease: Burkitts lymphoma 20B8 cell ATCC: CRL-12582 20C2 disease: hybridoma 20C2 cell ATCC: CRL-2382 20H11 disease: EBV transformed 20H11 cell ATCC: CRL-9300 20H2 20H2 cell ATCC: HB-323 219 disease: hybridoma 219 cell ATCC: HB-9371 225 225 cell ATCC: HB-8508 2254-62.2 2254-62.2 cell ATCC: CRL-8544 226H disease: hybridoma 226H cell ATCC: HB-12592 LCL-1145 22RV1 22RV1 cell ATCC: CRL-2505 HyperCLDB: cl7072 22Rv1 22Rv1 cell ATCC: CRL-2505 23 ScCr 23 ScCr cell ATCC: CRL-2751 LCL-1532 23132/87 23132/87 cell DSMZ: ACC 201 HyperCLDB: cl38 232 232 cell ATCC: HB-9372 236L disease: hybridoma 236L cell ATCC: HB-12593 23A-5-21S 23A-5-21S cell ATCC: HB-36 23B6 disease: hybridoma 23B6 cell ATCC: HB-8521 23CLN 23CLN cell HyperCLDB: cl39 240-13D10 disease: hybridoma 240-13D10 cell ATCC: CRL-2672 24IA subscript(2) E subscript(2) E subscript(10) D subscript(5) disease: hybridoma 24IA subscript(2) E subscript(2) E subscript(10) D subscript(5) cell ATCC: HB-8049 253D 253D cell HyperCLDB: cl41 25-5-16S 25-5-16S cell ATCC: HB-37 25-9-17S II 25-9-17S II cell ATCC: HB-26 25-9-3S 25-9-3S cell ATCC: HB-38 26 CB1 26 CB1 cell HyperCLDB: cl42 260-33C4 260-33C4 cell ATCC: CRL-2667 266-6 disease: acinar cell tumor 266-6 cell ATCC: CRL-2151 26-7-11S 26-7-11S cell ATCC: HB-15 26-8-16S disease: hybridoma 26-8-16S cell ATCC: HB-42 26CB-1 disease: HVS transformed 26CB-1 cell ATCC: CRL-1495 26ic disease: hybridoma 26ic cell ATCC: HB-246 28-11-5S 28-11-5S cell ATCC: HB-19 28-13-3S disease: hybridoma 28-13-3S cell ATCC: HB-41 28-14-8S 28-14-8S cell ATCC: HB-27 28-16-8S disease: hybridoma 28-16-8S cell ATCC: HB-35 283TAg 283TAg cell ATCC: CRL-2822 28-8-6S disease: hybridoma 28-8-6S cell ATCC: HB-51 28S.3 28S.3 cell ATCC: CRL-2758 29.0.C.27 29.0.C.27 cell HyperCLDB: cl43 290-4E10 290-4E10 cell ATCC: CRL-2662 293 293 HEK 293 cell HEK 293 HEK-293 Human Embryonic Kidney 293 WEB: http://hek293.com/ WEB: http://web.expasy.org/cellosaurus/CVCL_0045 WEB: https://www.atcc.org/Products/All/CRL-1573.aspx HEK293 ATCC: CRL-1573 BTO: BTO_0000007 EFO: EFO_0001182) RRID: CVCL_0045 293 c18 WEB: https://www.atcc.org/Products/All/CRL-10852.aspx#characteristics 293 c18 cell ATCC: CRL-10852 293 EcR Shh This ATCC number has been discontinued. disease: transformed with adenovirus 5 DNA 293 EcR Shh cell ATCC: CRL-2782 293 N3S 293 N3S cell HyperCLDB: cl48 A 293-derived cell line that is stably transfected to secrete the chimeric protein (CHE-Fc), a recombinant soluble chirmeric protein useful as a probe to detect 9-O-Acetylated sialic acids. 293/CHE-Fc WEB: http://web.expasy.org/cellosaurus/CVCL_6352 WEB: https://www.atcc.org/Products/All/CRL-2368.aspx 293/CHE-Fc was established by cotransfecting human embryonic 293 cell (ATCC CRL-1573) with the plasmid pCHE-Fc and a plasmid encoding Genetic (G418) resistance. The cell line is stably transfected to secrete the chimeric protein (CHE-Fc), a recombinant soluble chirmeric protein useful as a probe to detect 9-O-Acetylated sialic acids. CHE-Fc is a bifunctional molecule that can be used either to cleave acetyl groups at the ninth position of sialic acids or as a binding probe for 9-O-sialic acids. https://www.atcc.org/Products/All/CRL-2368.aspx 293/CHE-Fc cell ATCC: CRL-2368 RRID: CVCL_6352 293T/17 WEB: https://www.atcc.org/Products/All/CRL-11268.aspx 293T/17 cell ATCC: CRL-11268 2A disease: amphotropic retroviral packaging line 2A cell ATCC: CRL-12013 2A1 2A1 cell HyperCLDB: cl5009 2A11 disease: hybridoma 2A11 cell ATCC: CRL-2442 2A2-6E10-1D8 2A2-6E10-1D8 cell ATCC: HB-12465 2A3A1H disease: hybridoma 2A3A1H cell ATCC: HB-8555 2A5 2A5 cell ATCC: CRL-2444 2AB1-IA10 disease: hybridoma 2AB1-IA10 cell ATCC: HB-8210 2B5 2B5 cell ATCC: HB-8963 2B5.3 disease: hybridoma 2B5.3 cell ATCC: CRL-1960 2B7 2B7 cell ATCC: CRL-2443 LCL-2015 2B8 2B8 cell 2BD4E4 K99 2BD4E4 K99 cell ATCC: HB-8178 2C1H7 disease: hybridoma 2C1H7 cell ATCC: CRL-2746 2C4 2C4 cell ATCC: CRL-1760 2C5-6 2C5-6 cell ATCC: HB-8995 2D10 2D10 cell ATCC: CRL-2226 2D12 2D12 cell ATCC: CRL-1689 2D4 disease: hybridoma 2D4 cell ATCC: TIB-185 2D-7 disease: hybridoma 2D-7 cell ATCC: HB-9667 2D7F10 disease: hybridoma 2D7F10 cell ATCC: CRL-2025 2E.6 2E.6 cell ATCC: HB-128 2E10-H2 disease: hybridoma 2E10-H2 cell ATCC: CRL-1812 2E6 disease: hybridoma 2E6 cell ATCC: HB-226 2E8 2E8 cell ATCC: TIB-239 2F.11.15 2F.11.15 cell ATCC: TIB-194 2F-2B disease: SV40 transformed 2F-2B cell ATCC: CRL-2168 2F7 2F7 cell ATCC: CRL-10237 2FLB.Ln disease: leukemia 2FLB.Ln cell ATCC: CRL-6045 2G3 2G3 cell ATCC: CRL-2435 2G8.D6 disease: hybridoma 2G8.D6 cell ATCC: HB-8190 2H-11 2H-11 cell ATCC: CRL-2163 2H6-C2 disease: hybridoma 2H6-C2 cell ATCC: CRL-1853 2Hx-2 2Hx-2 cell ATCC: HB-8117 HyperCLDB: cl51 2LBLN 2LBLN cell ATCC: CRL-6047 2M6 2M6 cell HyperCLDB: cl373 2PK-3 2PK-3 cell ATCC: TIB-203 2T 2T cell HyperCLDB: cl53 2T8-3E10 2T8-3E10 cell ATCC: HB-8213 2V6.11 2V6.11 cell ATCC: CRL-2784 3 C9-D11-H11 3 C9-D11-H11 cell HyperCLDB: cl5095 3 E 1 3 E 1 cell HyperCLDB: cl5098 3.155 3.155 cell ATCC: TIB-211 3.334 SC5/8 3.334 SC5/8 cell HyperCLDB: cl54 30/15 disease: hybridoma 30/15 cell ATCC: HB-8152 30-5-7S 30-5-7S cell ATCC: HB-31 308TAg 308TAg cell ATCC: CRL-2819 30-C7 30-C7 cell ATCC: TIB-106 30-H12 30-H12 cell ATCC: TIB-107 310-29F7 disease: hybridoma 310-29F7 cell ATCC: CRL-2656 311-3D4 311-3D4 cell ATCC: CRL-2657 312-13E8 disease: hybridoma 312-13E8 cell ATCC: CRL-2658 31-3-4S 31-3-4S cell ATCC: HB-77 31-42-19 31-42-19 cell ATCC: HB-9726 317G5.C1D3 317G5.C1D3 cell ATCC: HB-8691 31-90-25 disease: hybridoma 31-90-25 cell ATCC: HB-9725 3197-3 3197-3 cell ATCC: CRL-1568 31E9 disease: produces GIF 31E9 cell ATCC: HB-11052 31F4L 31F4L cell HyperCLDB: cl57 32.2 disease: hybridoma 32.2 cell ATCC: HB-9469 32B11 32B11 cell ATCC: CRL-2559 32D 32D cell HyperCLDB: cl5010 32D Clone 3 32D Clone 3 cell ATCC: CRL-11346 331.12 331.12 cell ATCC: TIB-129 339-1 disease: hybridoma 339-1 cell ATCC: HB-186 33B disease: oligodendroglioma 33B cell HyperCLDB: cl58 33D1 33D1 cell ATCC: TIB-227 34 34 cell ATCC: CRL-1889 34-1-2S 34-1-2S cell ATCC: HB-79 34-2-12S 34-2-12S cell ATCC: HB-87 34-4-20S disease: hybridoma 34-4-20S cell ATCC: HB-75 34-4-21S 34-4-21S cell ATCC: HB-76 34-5-3S 34-5-3S cell ATCC: HB-85 34-5-8S 34-5-8S cell ATCC: HB-102 HyperCLDB: cl5138 34-7-23S disease: hybridoma 34-7-23S cell ATCC: HB-101 35.1 disease: hybridoma 35.1 cell ATCC: HB-222 35.6 disease: produces human CR1 35.6 cell ATCC: CRL-10052 356-1 356-1 cell ATCC: HB-181 36 disease: hybridoma fusion partner 36 cell ATCC: CRL-8193 36.5 (CD8+) 36.5 (CD8+) cell ATCC: CRL-11116 3611 MSV (4070A) 3611 MSV (4070A) cell HyperCLDB: cl60 36F-18C disease: hybridoma 36F-18C cell ATCC: HB-285 37 RC 37 RC cell HyperCLDB: cl61 37.04.12 disease: hybridoma 37.04.12 cell ATCC: HB-9312 372 disease: hybridoma 372 cell ATCC: CRL-1893 38.1 disease: hybridoma 38.1 cell ATCC: HB-231 38-1 disease: hybridoma 38-1 cell ATCC: HB-182 3-83P disease: hybridoma 3-83P cell ATCC: HB-20 39-S disease: hybridoma 39-S cell ATCC: HB-8180 3A sub E 3A sub E cell HyperCLDB: cl64 3A(tPA-30-1) 3A(tPA-30-1) cell ATCC: CRL-1583 3A5 3A5 cell ATCC: CRL-2440 3A8 disease: hybridoma 3A8 cell ATCC: HB-12024 3A-sub E [post crisis of 3A(tPA-30-1)] 3A-sub E [post crisis of 3A(tPA-30-1)] cell ATCC: CRL-1584 3B11 3B11 cell ATCC: CRL-2757 3B-11 disease: SV40 transformed 3B-11 cell ATCC: CRL-2160 3B18 3B18 cell ATCC: HB-8654 3C10 disease: hybridoma 3C10 cell ATCC: TIB-228 3C11 3C11 cell ATCC: HB-8511 3C5.1 disease: hybridoma 3C5.1 cell ATCC: CRL-2284 3C7.2 3C7.2 cell ATCC: CRL-1959 3C9-D11-H11 disease: hybridoma 3C9-D11-H11 cell ATCC: CRL-1745 3E1 disease: hybridoma 3E1 cell ATCC: HB-8067 3F6 disease: hybridoma 3F6 cell ATCC: HB-8512 3G3 disease: hybridoma 3G3 cell ATCC: HB-8516 3G5 disease: hybridoma 3G5 cell ATCC: CRL-1814 3G9F3 3G9F3 cell ATCC: CRL-1843 3H5-1 3H5-1 cell ATCC: HB-46 3LBLN 3LBLN cell ATCC: CRL-6048 3Pt12B8 3Pt12B8 cell ATCC: HB-8136 3T3 3T3 cell HyperCLDB: cl65 MeSH: D016475 3T3 clone A31 3T3 clone A31 cell HyperCLDB: cl389 3T3 MEFs KO 3T3 MEFs KO cell ATCC: CRL-2753 3T3 MEFs WT disease: Cav-1 (+/+) 3T3 MEFs WT cell ATCC: CRL-2752 3T3 NIH TK- 3T3 NIH TK- cell HyperCLDB: cl68 3T3(+3) 3T3(+3) cell HyperCLDB: cl69 3T3B-SV40 3T3B-SV40 cell HyperCLDB: cl85 3T3-L1 3T3-L1 cell HyperCLDB: cl71 HyperCLDB: cl72 MeSH: D041721 3T3-MSV 3T3-MSV cell HyperCLDB: cl74 3T3-SV40 3T3-SV40 cell HyperCLDB: cl75 3T3-Swiss albino disease: feeder layer cell 3T3-Swiss albino cell ATCC: CCL-92 HyperCLDB: cl83 HyperCLDB: cl86 3T6-Swiss albino 3T6-Swiss albino cell ATCC: CCL-96 HyperCLDB: cl89 4/4 R.M.-4 4/4 R.M.-4 cell ATCC: CCL-216 HyperCLDB: cl91 40.10.09 disease: hybridoma 40.10.09 cell ATCC: HB-9311 411-14E10 411-14E10 cell ATCC: CRL-2663 41-2 disease: hybridoma 41-2 cell ATCC: CRL-2695 41-3.48 41-3.48 cell ATCC: HB-130 413-15D12 disease: hybridoma 413-15D12 cell ATCC: CRL-2653 416B 416B cell HyperCLDB: cl92 42.08.07 disease: hybridoma 42.08.07 cell ATCC: HB-9313 424 MPSV ts 424 MPSV ts cell HyperCLDB: cl94 424 MPSV wt 424 MPSV wt cell HyperCLDB: cl95 LCL-1347 42-MG-BA 42-MG-BA cell DSMZ: ACC 431 HyperCLDB: cl5011 42TA 42TA cell ATCC: CRL-2759 443-15D3-2F12 disease: hybridoma 443-15D3-2F12 cell ATCC: HB-11342 448-D 100, 10, 1 disease: hybridoma 448-D 100, 10, 1 cell ATCC: HB-10895 44aacb 44aacb cell ATCC: HB-249 45.6.TG1.7 disease: hybridoma fusion partner 45.6.TG1.7 cell ATCC: CRL-1608 451Lu 451Lu cell ATCC: CRL-2813 454C11 disease: hybridoma 454C11 cell ATCC: HB-8484 455 455 cell ATCC: HB-8507 46/4 46/4 cell ATCC: HB-67 46-2 disease: hybridoma 46-2 cell ATCC: CRL-2186 46-4 disease: hybridoma 46-4 cell ATCC: CRL-2178 46-5 46-5 cell ATCC: CRL-2184 46Br.1G1 46Br.1G1 cell HyperCLDB: cl100 46BR.1N 46BR.1N cell HyperCLDB: cl101 48 48 cell ATCC: CRL-1913 4A4B11 disease: hybridoma 4A4B11 cell ATCC: HB-8327 4A6 disease: hybridoma 4A6 cell ATCC: CRL-1928 4B2 4B2 cell ATCC: HB-196 4B2-6C3-1C9 disease: hybridoma 4B2-6C3-1C9 cell ATCC: HB-12466 4C 4C cell ATCC: HB-8311 4C2.4A7.5H11 4C2.4A7.5H11 cell ATCC: CRL-2744 4C4 disease: hybridoma 4C4 cell ATCC: HB-327 4C5G 4C5G cell ATCC: CRL-2538 4C9 disease: hybridoma 4C9 cell ATCC: CRL-2437 4D1.5.7 4D1.5.7 cell ATCC: HB-11495 4D11 4D11 cell ATCC: HB-240 4D12 disease: hybridoma 4D12 cell ATCC: HB-178 4D9D4 4D9D4 cell ATCC: CRL-1818 4E11 disease: hybridoma 4E11 cell ATCC: HB-9259 4E8C12 4E8C12 cell ATCC: HB-10452 4F2C13 disease: hybridoma 4F2C13 cell ATCC: HB-22 4H1-A7 4H1-A7 cell ATCC: CRL-1813 4MBr-5 4MBr-5 cell ATCC: CCL-208 4T1 4T1 cell ATCC: CRL-2539 5 C 9 disease: hybridoma 5 C 9 cell HyperCLDB: cl5099 5/9 m a3-18 5/9 m a3-18 cell ATCC: CRL-10154 50-6 50-6 cell ATCC: CRL-2696 51.1 disease: hybridoma 51.1 cell ATCC: HB-230 514 disease: hybridoma 514 cell ATCC: CRL-1914 52 52 cell ATCC: HB-9361 520C9 disease: hybridoma 520C9 cell ATCC: HB-8696 528 disease: hybridoma 528 cell ATCC: HB-8509 52-S 52-S cell ATCC: HB-8181 53-6.72 disease: hybridoma 53-6.72 cell ATCC: TIB-105 53-7.313 53-7.313 cell ATCC: TIB-104 53-S disease: hybridoma 53-S cell ATCC: HB-8182 548 disease: hybridoma 548 cell ATCC: CRL-1890 55-2 55-2 cell ATCC: CRL-2155 55-36 disease: hybridoma 55-36 cell ATCC: CRL-2153 55-6 disease: hybridoma 55-6 cell ATCC: CRL-2156 55-83 55-83 cell ATCC: CRL-2185 558-D 100, 10, 1 disease: hybridoma 558-D 100, 10, 1 cell ATCC: HB-10894 559/64-D 100, 10, 1 559/64-D 100, 10, 1 cell ATCC: HB-10893 LCL-1702 5637 5637 cell ATCC: HTB-9 CHEMBL: CHEMBL3308352 CVCL: CVCL_0126 EFO: EFO_0002096 56B3 56B3 cell ATCC: CRL-2542 579 disease: hybridoma 579 cell ATCC: HB-8506 58967 NRK 58967 NRK cell HyperCLDB: cl107 58D3C9 58D3C9 cell HyperCLDB: cl108 58-S 58-S cell ATCC: HB-8183 598_81H 598_81H cell HyperCLDB: cl109 59M 59M cell HyperCLDB: cl110 5A1 disease: hybridoma 5A1 cell ATCC: CRL-2702 5C6 Clone 1 disease: hybridoma 5C6 Clone 1 cell ATCC: CRL-1969 5c8 5c8 cell ATCC: HB-10916 5C9 disease: hybridoma 5C9 cell ATCC: HB-8371 5D4-11 5D4-11 cell ATCC: HB-49 5D5.11.6 disease: hybridoma 5D5.11.6 cell ATCC: HB-11895 5E4 disease: hybridoma 5E4 cell ATCC: CRL-2635 5E9C11 5E9C11 cell ATCC: HB-21 5F12 AD3 disease: hybridoma 5F12 AD3 cell ATCC: HB-8209 5G3 5G3 cell HyperCLDB: cl5108 5G5 disease: hybridoma 5G5 cell ATCC: CRL-2633 5H8 5H8 cell ATCC: CRL-2646 5LBLN 5LBLN cell ATCC: CRL-6049 6.12 6.12 cell ATCC: CRL-13006 60bca disease: hybridoma 60bca cell ATCC: HB-247 60H9(9)D10.E6 60H9(9)D10.E6 cell HyperCLDB: cl112 61/7 61/7 cell ATCC: HB-8154 6-23 (clone 6) 6-23 (clone 6) cell HyperCLDB: cl5109 6-23 (Clone 6) 6-23 (Clone 6) cell ATCC: CRL-1607 LCL-1943 639-V disease: carcinoma, transitional cell 639-V cell CHEMBL: CHEMBL3308703 CVCL: CVCL_1048 DSMZ: ACC 413 EFO: EFO_0002097 HyperCLDB: cl5012 63D3 63D3 cell ATCC: HB-44 LCL-1708 647-V 647-V cell CHEMBL: CHEMBL3308704 CVCL: CVCL_1049 DSMZ: ACC 414 EFO: EFO_0002098 HyperCLDB: cl5254 650E2-2B12 650E2-2B12 cell ATCC: HB-10812 663 + N 663 + N cell HyperCLDB: cl113 665/2 665/2 cell HyperCLDB: cl114 67j25D 67j25D cell HyperCLDB: cl116 68-1-2 68-1-2 cell ATCC: CRL-1712 6A7M disease: hybridoma 6A7M cell ATCC: HB-8159 6A8.6F10.1A6 6A8.6F10.1A6 cell ATCC: CRL-2743 6D8MB4 6D8MB4 cell ATCC: CRL-1842 6E6 6E6 cell ATCC: CRL-11398 6F4C5 disease: hybridoma 6F4C5 cell ATCC: CRL-1869 6G4.2.5 6G4.2.5 cell ATCC: HB-11722 6LBLN 6LBLN cell ATCC: CRL-6050 7 D4 disease: hybridoma 7 D4 cell HyperCLDB: cl5110 7/8 (clone G3) 7/8 (clone G3) cell HyperCLDB: cl120 703D4 disease: hybridoma 703D4 cell ATCC: HB-8301 707 DAP10 disease: leukemia, Friend 707 DAP10 cell HyperCLDB: cl121 707B1011C3 707B1011C3 cell HyperCLDB: cl122 70Z/3 disease: methylnitrosourea-induced lymphoma 70Z/3 cell ATCC: TIB-158 71A7 71A7 cell ATCC: TIB-147 72A1 disease: hybridoma 72A1 cell ATCC: HB-168 HyperCLDB: cl5143 73/1 disease: hybridoma 73/1 cell ATCC: HB-66 7-34-1 disease: hybridoma 7-34-1 cell ATCC: CRL-1945 74-11-10 74-11-10 cell ATCC: HB-139 74-12-4 disease: hybridoma 74-12-4 cell ATCC: HB-147 74-22-15 disease: hybridoma 74-22-15 cell ATCC: HB-142 74-22-15A 74-22-15A cell ATCC: HB-142.1 745C2 disease: erythroleukemia, lymphoblast 745C2 cell HyperCLDB: cl125 74-9-3 disease: hybridoma 74-9-3 cell ATCC: HB-156 75e7vg2 75e7vg2 cell HyperCLDB: cl126 75j23pe34 75j23pe34 cell HyperCLDB: cl127 76-2-11 76-2-11 cell ATCC: HB-143 76-5-28 76-5-28 cell ATCC: HB-153 76-6-7 76-6-7 cell ATCC: HB-141 76-7-4 76-7-4 cell ATCC: HB-140 LCL-1772 769-P 769-P cell ATCC: CRL-1933 CHEMBL: CHEMBL3308705 CVCL: CVCL_1050 EFO: EFO_0002099 LCL-1773 786-O 786-O cell ATCC: CRL-1932 79f7Dv3g 79f7Dv3g cell HyperCLDB: cl130 7A9 7A9 cell ATCC: HB-10135 7AC5/EYFP disease: embryonic stem cell 7AC5/EYFP cell ATCC: SCRC-1033 7C subscript(2) C subscript(5) C subscript(12) disease: hybridoma 7C subscript(2) C subscript(5) C subscript(12) cell ATCC: HB-8678 HyperCLDB: cl5111 7C6.5.4 disease: hybridoma 7C6.5.4 cell ATCC: HB-9574 7C8 7C8 cell ATCC: HB-8465 7D2-1.4.1.5 disease: hybridoma 7D2-1.4.1.5 cell ATCC: HB-92 7D3A.2 disease: hybridoma 7D3A.2 cell ATCC: CRL-1886 7D4 7D4 cell ATCC: CRL-1698 7E11C5 7E11C5 cell ATCC: HB-10494 7E12H12 7E12H12 cell ATCC: HB-9397 7E3 disease: hybridoma 7E3 cell ATCC: HB-8832 7F2 disease: osteoblast; inducible adipocyte differentiation model 7F2 cell ATCC: CRL-12557 7F2-6D4-8E7 disease: hybridoma 7F2-6D4-8E7 cell ATCC: HB-11945 7G7B6 7G7B6 cell ATCC: HB-8784 7TD1 7TD1 cell HyperCLDB: cl119 7-TD-1 7-TD-1 cell HyperCLDB: cl118 80 V 5B4 80 V 5B4 cell ATCC: TIB-132 803-15.6 disease: hybridoma 803-15.6 cell ATCC: CRL-2395 807.15 807.15 cell ATCC: CRL-2287 807.31 disease: hybridoma 807.31 cell ATCC: CRL-2282 807.33 disease: hybridoma 807.33 cell ATCC: CRL-2290 80T 80T cell ATCC: CRL-7901 LCL-1685 8305C disease: carcinoma, undifferentiated 8305C cell CHEMBL: CHEMBL3308706 CVCL: CVCL_1053 DSMZ: ACC 133 HyperCLDB: cl132 83-12-5 disease: hybridoma 83-12-5 cell ATCC: CRL-1971 84BR 84BR cell HyperCLDB: cl134 LCL-1686 8505C disease: carcinoma, undifferentiated 8505C cell CHEMBL: CHEMBL3308353 CVCL: CVCL_1054 DSMZ: ACC 219 HyperCLDB: cl135 86D 86D cell ATCC: HB-286 88B disease: hybridoma 88B cell ATCC: CRL-1967 88TAg 88TAg cell ATCC: CRL-2820 89MS30 89MS30 cell ATCC: HB-11300 8A2N disease: hybridoma 8A2N cell ATCC: HB-8161 8A3B.6 disease: hybridoma 8A3B.6 cell ATCC: CRL-1875 8B1B.1 disease: hybridoma 8B1B.1 cell ATCC: CRL-1877 8E5 8E5 cell ATCC: CRL-8993 8E7 disease: B lymphoblast; EBV transformed 8E7 cell ATCC: CRL-8795 LCL-1365 8-MG-BA 8-MG-BA cell CHEMBL: CHEMBL3308251 CVCL: CVCL_1052 HyperCLDB: cl5013 Sanger: COSMIC ID:687562 9 BG 5 disease: hybridoma 9 BG 5 cell HyperCLDB: cl5129 9.0.4.C43 9.0.4.C43 cell HyperCLDB: cl138 9.3F10 9.3F10 cell ATCC: HB-180 9.4 disease: hybridoma 9.4 cell ATCC: HB-10508 90.74 90.74 cell ATCC: CRL-11654 90196B disease: macrophage; monocyte 90196B cell ATCC: CRL-9853 91MS441 disease: hybridoma 91MS441 cell ATCC: HB-11301 92BR 92BR cell HyperCLDB: cl140 92TAg 92TAg cell ATCC: CRL-2816 9-4-3 disease: hybridoma 9-4-3 cell ATCC: HB-8935 9-A5 9-A5 cell ATCC: CRL-1844 9AE10 disease: hybridoma 9AE10 cell ATCC: CRL-1761 9-B1 9-B1 cell ATCC: CRL-1845 9BG5 9BG5 cell ATCC: HB-167 9D10 9D10 cell ATCC: CRL-8752 9D9 disease: hybridoma 9D9 cell ATCC: CRL-1703 9F12 disease: hybridoma 9F12 cell ATCC: HB-8177 9L/lacZ 9L/lacZ cell ATCC: CRL-2200 9TR#1 9TR#1 cell ATCC: CRL-11379 A 172 A 172 cell HyperCLDB: cl143 A 375 A 375 cell HyperCLDB: cl198 A 72 A 72 cell HyperCLDB: cl171 A.704 A.704 cell HyperCLDB: cl168 A.P. A.P. cell ATCC: CRL-6295 A09194 A09194 cell HyperCLDB: cl182 A1 ATH disease: lymphomas-leukemias A1 ATH cell HyperCLDB: cl183 A-10 A-10 cell ATCC: CRL-1476 LCL-1267 A101D A101D cell ATCC: CRL-7898 ATCC: CRL-7898,COSMIC ID:910921; ATCC CRL-7898 CHEMBL: CHEMBL3308182 CVCL: CVCL_1057 EFO: EFO_0002100 A10-85 A10-85 cell HyperCLDB: cl185 A11 A11 cell HyperCLDB: cl186 A11.1 M A11.1 M cell ATCC: HB-164 A123 disease: hybridoma A123 cell ATCC: HB-8451 A124 disease: hybridoma A124 cell ATCC: HB-8452 A15 A15 cell HyperCLDB: cl187 A1594 A1594 cell HyperCLDB: cl188 A-172 A-172 cell HyperCLDB: cl142 LCL-1348 ZN A172 A172 cell ATCC: CRL-1620 A1G3 disease: hybridoma A1G3 cell ATCC: HB-177 A2 A2 cell HyperCLDB: cl189 A-2 A-2 cell HyperCLDB: cl5015 A20 disease: reticulum cell sarcoma A20 cell ATCC: TIB-208 LCL-1409 ZN A-204 A-204 cell ATCC: HTB-82 CHEMBL: CHEMBL3308354 CVCL: CVCL_1058 EFO: EFO_0002102 LCL-1237 A2058 disease: malignant melanoma (skin primary) A2058 cell ATCC: CRL-11147 CHEMBL: CHEMBL3308030 CVCL: CVCL_1059 A238 A238 cell HyperCLDB: cl191 A24 A24 cell HyperCLDB: cl192 LCL-2034 A253 A253 cell ATCC: CRL-7902 Sanger: COSMIC ID:906794 A-253 disease: epidermoid carcinoma A-253 cell ATCC: HTB-41 LCL-1518 A2780 A2780 cell CHEMBL: CHEMBL3308421 CVCL: CVCL_0134 ECACC: 93112519 HyperCLDB: cl193 LCL-1694 A2780ADR A2780ADR cell ECACC: 93112520 HyperCLDB: cl5047 LCL-1696 ZN A2780cis A2780cis cell ECACC: 93112517 HyperCLDB: cl195 A2B5 clone 105 disease: hybridoma A2B5 clone 105 cell ATCC: CRL-1520 A2E11 disease: hybridoma A2E11 cell ATCC: CRL-1846 A2H A2H cell HyperCLDB: cl196 LCL-1026 A3 A3 cell ATCC: CRL-2570 A3 AAL A3 AAL cell HyperCLDB: cl197 A3.4H2 disease: hybridoma A3.4H2 cell ATCC: HB-12319 A3.6B10 disease: hybridoma A3.6B10 cell ATCC: HB-12318 A375 Comment: this term is obsolete because it is duplicated with another term 'A-375 cell' (CLO_0001582). -- Oliver He obsolete: A375 cell HyperCLDB: cl199 LCL-1235 A-375 A375 A375 cell WEB: http://bioinformatics.hsanmartino.it/hypercldb/cl199.html disease: malignant melanoma A-375 cell ATCC: CRL-1619 CHEMBL: CHEMBL3308077 CVCL: CVCL_0132 EFO: EFO_0002103 HyperCLDB: cl199 LCL-1231 JX, YH A375.S2 WEB: http://www.atcc.org/products/all/CRL-1872 disease: malignant melanoma A375.S2 cell ATCC: CRL-1872 LCL-1342 A388 disease: carcinoma A388 cell ATCC: COSMIC ID:910697; ATCC CRL-7905,CRL-7905 ATCC: CRL-7905 CHEMBL: CHEMBL3308159 CVCL: CVCL_1063 A4.74 disease: hybridoma A4.74 cell ATCC: CRL-2041 A4.840 disease: hybridoma A4.840 cell ATCC: CRL-2043 A4.951 A4.951 cell ATCC: CRL-2046 A4-1025 A4-1025 cell HyperCLDB: cl5016 A4-1077 A4-1077 cell HyperCLDB: cl5017 LCL-1600 A-427 A-427 cell ATCC: HTB-53 CHEMBL: CHEMBL3307775 CVCL: CVCL_1055 EFO: EFO_0002104 LCL-1404 ZN A431 A431 cell ECACC: 85090402 HyperCLDB: cl160 A-431 A-431 cell ATCC: CRL-1555 A431NS disease: epidermoid carcinoma A431NS cell ATCC: CRL-2592 A4-840 disease: hybridoma A4-840 cell HyperCLDB: cl49 A4-951 A4-951 cell HyperCLDB: cl5018 A-498 A-498 cell ATCC: HTB-44 A4xL A4xL cell HyperCLDB: cl200 A5.12.14 disease: hybridoma A5.12.14 cell ATCC: HB-11553 A5.4 disease: hybridoma A5.4 cell ATCC: CRL-2275 A52m/pSG1 A52m/pSG1 cell HyperCLDB: cl201 LCL-1601 A549 A549 cell ATCC: CCL-185 CHEMBL: CHEMBL3307651 CVCL: CVCL_0023 EFO: EFO_0001086 HyperCLDB: cl207 A6 A6 cell ATCC: CRL-8192 A6 disease: hybridoma fusion partner A6 cell ATCC: CCL-102 A6 ATL A6 ATL cell HyperCLDB: cl210 LCL-1410 A673 A673 cell ECACC: 85111504 HyperCLDB: cl166 A-673 A-673 cell ATCC: CRL-1598 A68177 A68177 cell ATCC: CRL-7714 A7 A7 cell ATCC: CRL-2500 LCL-1762 A704 A704 cell ATCC: CRL-7911 Sanger: COSMIC ID:910920 A-704 A-704 cell ATCC: HTB-45 A717 disease: hybridoma A717 cell ATCC: HB-9596 A-72 A-72 cell ATCC: CRL-1542 A7573 A7573 cell HyperCLDB: cl213 A7r5 A7r5 cell ATCC: CRL-1444 A8/DI A8/DI cell HyperCLDB: cl218 A84M A84M cell HyperCLDB: cl216 A84P A84P cell HyperCLDB: cl217 A9 A9 cell ATCC: CCL-1.4 A9 disease: hybridoma A9 cell ATCC: CRL-1811 A-9 A-9 cell ATCC: CRL-6319 A9 L hD2 S.C. 18 A9 L hD2 S.C. 18 cell ATCC: CRL-10225 A94 A94 cell HyperCLDB: cl221 A94M A94M cell HyperCLDB: cl222 A94P A94P cell HyperCLDB: cl223 A95 A95 cell HyperCLDB: cl224 A9HT A9HT cell HyperCLDB: cl225 Aa Aa cell HyperCLDB: cl226 AA224 disease: hybridoma AA224 cell ATCC: HB-10183 AA5 AA5 cell ATCC: CRL-2637 AA8 AA8 cell ATCC: CRL-1859 AA84F AA84F cell HyperCLDB: cl228 A-A94 A-A94 cell HyperCLDB: cl173 AAA95M AAA95M cell HyperCLDB: cl229 Ab 21.1 disease: hybridoma Ab 21.1 cell ATCC: HB-11601 Ab 23.1 disease: hybridoma Ab 23.1 cell ATCC: HB-11602 AB.9 AB.9 cell ATCC: CRL-2298 AB1-2 AB1-2 cell ATCC: HB-33 A-B92a A-B92a cell HyperCLDB: cl174 A-B92f A-B92f cell HyperCLDB: cl175 A-B92v A-B92v cell HyperCLDB: cl176 LCL-1634 ZN ABC-1 ABC-1 cell CHEMBL: CHEMBL3308707 CVCL: CVCL_1066 EFO: EFO_0002813 HyperCLDB: cl230 JHSF: JCRB0815 ABE-8.1/2 disease: lymphoma; AMLV transformed lymphoblast ABE-8.1/2 cell ATCC: TIB-205 AC133.1 AC133.1 cell ATCC: HB-12346 AC-1M32 disease: choriocarcinoma AC-1M32 cell HyperCLDB: cl7073 AC-1M46 disease: choriocarcinoma AC-1M46 cell HyperCLDB: cl7074 AC-1M59 AC-1M59 cell HyperCLDB: cl7075 AC-1M81 AC-1M81 cell HyperCLDB: cl7076 AC-1M88 disease: choriocarcinoma AC-1M88 cell HyperCLDB: cl7077 AC2 AC2 cell HyperCLDB: cl233 AC84 AC84 cell HyperCLDB: cl234 A-C88 A-C88 cell HyperCLDB: cl177 AC95 AC95 cell HyperCLDB: cl235 ACH1P disease: choriocarcinoma ACH1P cell HyperCLDB: cl7078 LCL-1756 ACHN ACHN cell ATCC: CRL-1611 CHEMBL: CHEMBL3307633 CVCL: CVCL_1067 EFO: EFO_0002108 LCL-1982 ACN ACN cell CHEMBL: CHEMBL3308148 CVCL: CVCL_1068 HyperCLDB: cl239 Sanger: COSMIC ID:906803 ACT 1 ACT 1 cell HyperCLDB: cl5131 ACT I disease: hybridoma ACT I cell ATCC: HB-80 ACT IV ACT IV cell ATCC: HB-81 Ad Hot disease: Ehlers-Danlos syndrome, type II Ad Hot cell ATCC: CRL-1227 AD94IL2 AD94IL2 cell HyperCLDB: cl240 AD94LEBV AD94LEBV cell HyperCLDB: cl241 ADF ADF cell HyperCLDB: cl243 AE 1 disease: carcinoma, small cell AE 1 cell HyperCLDB: cl244 AE 2 disease: carcinoma, small cell AE 2 cell HyperCLDB: cl245 AE 3 disease: carcinoma, small cell AE 3 cell HyperCLDB: cl246 AE-1 disease: hybridoma AE-1 cell ATCC: HB-72 AE-2 AE-2 cell ATCC: HB-73 AE84S AE84S cell HyperCLDB: cl247 AE9D6 AE9D6 cell ATCC: HB-125 Aedes aegypti Aedes aegypti cell ATCC: CCL-125 Aedes albopictus Aedes albopictus cell ATCC: CCL-126 Aedes albopictus clone C6/36 Aedes albopictus clone C6/36 cell ATCC: CRL-1660 AF-1 (MHV) AF-1 (MHV) cell HyperCLDB: cl251 AF-2 clone 9B5 AF-2 clone 9B5 cell HyperCLDB: cl252 AF3-12.1.3 disease: hybridoma AF3-12.1.3 cell ATCC: HB-160 AF4-73.3.1 AF4-73.3.1 cell ATCC: HB-201 AF6-120.1.2 disease: hybridoma AF6-120.1.2 cell ATCC: HB-163 AF6-122.2.5 AF6-122.2.5 cell ATCC: HB-199 AF6-78.25.4 disease: hybridoma AF6-78.25.4 cell ATCC: HB-162 AF6-88.5.3 disease: hybridoma AF6-88.5.3 cell ATCC: HB-158 AFA95M AFA95M cell HyperCLDB: cl254 AFT024 disease: feeder layer AFT024 cell ATCC: SCRC-1007 AG 5025 AG 5025 cell HyperCLDB: cl255 AG95P AG95P cell HyperCLDB: cl256 AGLCL AGLCL cell HyperCLDB: cl257 LCL-1893 AGS AGS cell ATCC: CRL-1739 CHEMBL: CHEMBL3308078 CVCL: CVCL_0139 EFO: EFO_0002109 A-HER2 disease: hybridoma A-HER2 cell ATCC: CRL-10463 AHH-1 AHH-1 cell ATCC: CRL-8146 AHL-1 AHL-1 cell ATCC: CCL-195 Ainv15 Ainv15 cell ATCC: SCRC-1029 AJ95 AJ95 cell HyperCLDB: cl262 AK-D AK-D cell ATCC: CCL-150 AKR/11-D AKR/11-D cell HyperCLDB: cl4924 AKR/12B-1 AKR/12B-1 cell HyperCLDB: cl4939 AKR/12B-2 AKR/12B-2 cell HyperCLDB: cl4925 AKR/12B-3 AKR/12B-3 cell HyperCLDB: cl4926 AKR/13B AKR/13B cell HyperCLDB: cl4927 AKR/14C AKR/14C cell HyperCLDB: cl4928 AKR/JA.Sp AKR/JA.Sp cell ATCC: CRL-6320 AKR1.G.1.OVAR.1.26 disease: hybridoma fusion partner,T cell AKR1.G.1.OVAR.1.26 cell ATCC: TIB-232 AKR-2B AKR-2B cell HyperCLDB: cl264 AL 1-27 disease: hybridoma AL 1-27 cell ATCC: HB-8441 Al Ke Al Ke cell ATCC: CRL-1325 AL/N AL/N cell ATCC: CRL-6506 LCL-1043 ALL-PO ALL-PO cell CHEMBL: CHEMBL3308227 CVCL: CVCL_1069 HyperCLDB: cl5399 Sanger: COSMIC ID:910944 ALM86M ALM86M cell HyperCLDB: cl265 Am Coo Am Coo cell ATCC: CRL-1286 Am Ric Am Ric cell ATCC: CRL-1129 AM85 AM85 cell HyperCLDB: cl267 AM86 AM86 cell HyperCLDB: cl268 AM95 AM95 cell HyperCLDB: cl269 AM-C6SC8 AM-C6SC8 cell HyperCLDB: cl266 Amdur II Amdur II cell ATCC: CCL-124 AMJ2-C11 disease: alveolar macrophage AMJ2-C11 cell ATCC: CRL-2456 AMJ2-C8 AMJ2-C8 cell ATCC: CRL-2455 AML12 AML12 cell ATCC: CRL-2254 AML14.3D10/CCCKR3 Clone 16 AML14.3D10/CCCKR3 Clone 16 cell ATCC: CRL-12079 AML-193 AML-193 cell ATCC: CRL-9589 HyperCLDB: cl272 Ampli-GPE Ampli-GPE cell HyperCLDB: cl273 AMS 9.1.1.1 AMS 9.1.1.1 cell ATCC: HB-161 An Zan An Zan cell ATCC: CRL-1266 AN3 CA AN3 CA cell ATCC: HTB-111 HyperCLDB: cl5019 AN86P AN86P cell HyperCLDB: cl275 ANJOU 65 disease: highly transfective ANJOU 65 cell ATCC: CRL-11269 ANN-1 ANN-1 cell HyperCLDB: cl276 Anr4 Anr4 cell HyperCLDB: cl277 Antheraea cells Antheraea cells cell HyperCLDB: cl278 Antheraea cells, adapted Antheraea cells, adapted cell ATCC: CCL-80 anti-130-kDa Mesothelial-Ciliated Cells disease: hybridoma anti-130-kDa Mesothelial-Ciliated Cells cell ATCC: CRL-2401 Antibody 2.06 Antibody 2.06 cell ATCC: HB-104 Anti-My-10 clone 28/8/8/ disease: hybridoma Anti-My-10 clone 28/8/8/ cell ATCC: HB-8483 Anti-SC35 disease: hybridoma Anti-SC35 cell ATCC: CRL-2031 anti-SR disease: hybridoma anti-SR cell ATCC: CRL-2383 anti-SRp20 disease: hybridoma anti-SRp20 cell ATCC: CRL-2384 AP.6 AP.6 cell ATCC: CRL-2227 AP-3 disease: hybridoma AP-3 cell ATCC: HB-242 A-P92 A-P92 cell HyperCLDB: cl178 AP95 AP95 cell HyperCLDB: cl279 Ar Ke-2 disease: Ehlers-Danlos syndrome, presumed heterozygote Ar Ke-2 cell ATCC: CRL-1324 AR42J disease: tumor AR42J cell ATCC: CRL-1492 AR4IP disease: pancreatic tumor AR4IP cell HyperCLDB: cl282 AR84S AR84S cell HyperCLDB: cl283 AR91 AR91 cell HyperCLDB: cl284 ARH 77 disease: leukemia, plasma cell ARH 77 cell HyperCLDB: cl285 LCL-2041 ARH-77 ARH-77 cell ATCC: CRL-1621 ARIP disease: tumor ARIP cell ATCC: CRL-1674 ARL-6 disease: hepatoma ARL-6 cell HyperCLDB: cl286 ARLJ 301-3 ARLJ 301-3 cell HyperCLDB: cl287 ARPE-19 ARPE-19 cell ATCC: CRL-2302 ARPE-19/HPV-16 ARPE-19/HPV-16 cell ATCC: CRL-2502 AS 33 disease: hybridoma AS 33 cell ATCC: HB-8779 A-S-30D A-S-30D cell HyperCLDB: cl179 As4.1 disease: intraparenchymal As4.1 cell ATCC: CRL-2193 A-S91 A-S91 cell HyperCLDB: cl181 ASK ASK cell ATCC: CRL-2747 LCL-1730 AsPC-1 AsPC-1 cell ATCC: CRL-1682 CHEMBL: CHEMBL3307994 CVCL: CVCL_0152 EFO: EFO_0002112 AT-1 AT-1 cell HyperCLDB: cl290 AT2.1 AT2.1 cell HyperCLDB: cl5048 AT-3.1 AT-3.1 cell HyperCLDB: cl291 AT3B-1 AT3B-1 cell ATCC: CRL-2375 AT6.1 AT6.1 cell HyperCLDB: cl292 AT95 AT95 cell HyperCLDB: cl293 ATHOS ATHOS cell HyperCLDB: cl294 ATRFLOX disease: colorectal carcinoma ATRFLOX cell ATCC: CRL-2780 AtT20 AtT20 cell HyperCLDB: cl296 AtT-20 AtT-20 cell ATCC: CCL-89 AtT-20/D16v-F2 AtT-20/D16v-F2 cell ATCC: CRL-1795 AtT-20ins (CGT-6) AtT-20ins (CGT-6) cell ATCC: CRL-11285 LCL-1462 ZN AU565 AU565 cell CHEMBL: CHEMBL3308095 CVCL: CVCL_1074 EFO: EFO_0001087 AUBEK AUBEK cell HyperCLDB: cl297 AV 3 AV 3 cell HyperCLDB: cl298 AV subscript(3) AV subscript(3) cell ATCC: CCL-21 AV3 AV3 cell HyperCLDB: cl299 AVE-115 AVE-115 cell ATCC: CRL-6507 Aw3.18.14 disease: hybridoma Aw3.18.14 cell ATCC: CRL-2826 B 95.8 B 95.8 cell HyperCLDB: cl365 b.End3 disease: endothelioma b.End3 cell HyperCLDB: cl5049 b.End5 disease: endothelioma b.End5 cell HyperCLDB: cl5050 B/C.Sk B/C.Sk cell HyperCLDB: cl329 B/C3T3.We B/C3T3.We cell ATCC: CRL-6327 B/CMBA.Ov B/CMBA.Ov cell ATCC: CRL-6331 B/CWE B/CWE cell ATCC: CRL-6334 B104 B104 cell HyperCLDB: cl4955 B104-1-1 disease: expresses her2/neu B104-1-1 cell ATCC: CRL-1887 B11 disease: hybridoma B11 cell ATCC: HB-8372 B12 B12 cell HyperCLDB: cl331 B13-24 disease: produces 23FG2; anti CD18 Mab B13-24 cell ATCC: CRL-11397 B14-150 disease: fibrosarcoma B14-150 cell HyperCLDB: cl332 B14FAF28-G3 B14FAF28-G3 cell ATCC: CCL-14 B16 melanoma 4A5 B16 melanoma 4A5 cell HyperCLDB: cl335 B16-A B16-A cell HyperCLDB: cl336 B16-F0 B16-F0 cell ATCC: CRL-6322 B16-F1 B16-F1 cell ATCC: CRL-6323 B16-F10 B16-F10 cell ATCC: CRL-6475 B16V B16V cell HyperCLDB: cl341 HyperCLDB: cl5020 B16VDxR B16VDxR cell HyperCLDB: cl342 B18 B18 cell HyperCLDB: cl343 B19 B19 cell HyperCLDB: cl344 B192 B192 cell HyperCLDB: cl345 B1B3 disease: hybridoma B1B3 cell ATCC: CRL-2249 B1B6 B1B6 cell ATCC: CRL-2248 B2.Ln B2.Ln cell ATCC: CRL-6022 B2.Sp B2.Sp cell ATCC: CRL-6023 B2.Sp/Thy B2.Sp/Thy cell ATCC: CRL-6024 B2-1 disease: thymidine kinase negative (TK) B2-1 cell ATCC: CRL-8085 B21-2 disease: hybridoma B21-2 cell ATCC: TIB-229 B2195 B2195 cell HyperCLDB: cl348 B25.2 B25.2 cell ATCC: HB-8107 B27M1 B27M1 cell ATCC: HB-157 B27M2 B27M2 cell ATCC: HB-165 B29 B29 cell ATCC: HB-9746 B-3 B-3 cell ATCC: CRL-11421 B3/25 B3/25 cell ATCC: CRL-8034 B3/AN B3/AN cell HyperCLDB: cl350 B35 disease: nitrosoethylurea-induced neuroblastoma B35 cell ATCC: CRL-2754 B38.1 disease: hybridoma B38.1 cell ATCC: HB-8110 B3D B3D cell ATCC: CRL-2634 B5 disease: hybridoma B5 cell ATCC: HB-8453 B5 NIH B5 NIH cell ATCC: HB-10569 B50 disease: nervous tissue glial tumor B50 cell HyperCLDB: cl351 B505 B505 cell ATCC: HB-12000 B6.2 disease: hybridoma B6.2 cell ATCC: HB-8106 B6/FA B6/FA cell HyperCLDB: cl353 B-63 B-63 cell HyperCLDB: cl5136 B65 B65 cell HyperCLDB: cl352 B69 B69 cell ATCC: HB-9437 B6H12.2 B6H12.2 cell ATCC: HB-9771 B72.3 B72.3 cell ATCC: HB-8108 B7-24-E1G4 B7-24-E1G4 cell ATCC: HB-11341 B78H1 B78H1 cell HyperCLDB: cl355 B82 B82 cell HyperCLDB: cl356 B8-24-3 B8-24-3 cell ATCC: TIB-139 B84 B84 cell HyperCLDB: cl357 B85 B85 cell HyperCLDB: cl358 B86M B86M cell HyperCLDB: cl359 B9 B9 cell HyperCLDB: cl360 B92 B92 cell HyperCLDB: cl361 B95-8 B95-8 cell HyperCLDB: cl366 HyperCLDB: cl368 B95a B95a cell HyperCLDB: cl5156 BA 93 BA 93 cell HyperCLDB: cl370 Ba Pot disease: osteogenesis imperfecta (congenita) Ba Pot cell ATCC: CRL-1280 BA/F3 BA/F3 cell HyperCLDB: cl5028 BA193 BA193 cell HyperCLDB: cl374 BA7.3C.9 BA7.3C.9 cell ATCC: HB-10716 B-A95 B-A95 cell HyperCLDB: cl302 BA96 BA96 cell HyperCLDB: cl375 BA-D5 BA-D5 cell ATCC: HB-287 BAE BAE cell HyperCLDB: cl377 BAE-1 BAE-1 cell HyperCLDB: cl5253 BAEC BAEC cell HyperCLDB: cl381 BAEC-1 BAEC-1 cell HyperCLDB: cl382 BA-F8 BA-F8 cell HyperCLDB: cl372 BAG-12G2 BAG-12G2 cell HyperCLDB: cl7079 BA-G5 BA-G5 cell ATCC: HB-276 BAG-85D10 BAG-85D10 cell HyperCLDB: cl7080 BALB 3T12-3 BALB 3T12-3 cell HyperCLDB: cl383 BALB SFME Serum Free Mouse Embryo BALB SFME Serum Free Mouse Embryo cell ATCC: CRL-9392 BALB/3T12-3 BALB/3T12-3 cell ATCC: CCL-164 BALB/3T3 clone A31 BALB/3T3 clone A31 cell ATCC: CCL-163 HyperCLDB: cl386 MeSH: D041702 BALB/B 0.75BAE A.1R.1 HD A.8 disease: chemically transformed BALB/B 0.75BAE A.1R.1 HD A.8 cell ATCC: TIB-84 BALB/c 10CrMCA A.2R.1 disease: chemically transformed BALB/c 10CrMCA A.2R.1 cell ATCC: TIB-86 BALB/c 10ME HD A.5R.1 BALB/c 10ME HD A.5R.1 cell ATCC: TIB-85 BALB/c AMuLV A.3R.1 disease: AMLV transformed BALB/c AMuLV A.3R.1 cell ATCC: TIB-87 BALB/c AMuLV A.6R.1 BALB/c AMuLV A.6R.1 cell ATCC: TIB-90 BALB/c CL.7 BALB/c CL.7 cell ATCC: TIB-80 Balb/C MSV (AP129) Balb/C MSV (AP129) cell HyperCLDB: cl390 BAOEC BAOEC cell HyperCLDB: cl391 Bat lung Bat lung cell HyperCLDB: cl392 BB BB cell ATCC: CCL-59 Bb(ApMC1) Possible typographic error in 'Organism' field (value 'Antheraea perny') to be considered as 'Antheraea pernyi' (NCBI_Taxon: 7119) [SS] Bb(ApMC1) cell HyperCLDB: cl396 BB7.1 disease: hybridoma BB7.1 cell ATCC: HB-56 BB7.2 BB7.2 cell ATCC: HB-82 BB7.5 BB7.5 cell ATCC: HB-120 BB7.6 disease: hybridoma BB7.6 cell ATCC: HB-115 BB7.7 BB7.7 cell ATCC: HB-94 B-B87 B-B87 cell HyperCLDB: cl303 BB88 BB88 cell ATCC: TIB-55 B-B88a B-B88a cell HyperCLDB: cl304 B-B88f B-B88f cell HyperCLDB: cl305 B-B92c B-B92c cell HyperCLDB: cl306 B-B92s B-B92s cell HyperCLDB: cl307 BB96P BB96P cell HyperCLDB: cl397 BBm BBm cell ATCC: CRL-6016 BBM disease: virus transformed BBM cell ATCC: CRL-9482 BBM.1 disease: hybridoma BBM.1 cell ATCC: HB-28 BBM.1 clone E9 BBM.1 clone E9 cell HyperCLDB: cl5158 LCL-1956 BC-1 BC-1 cell ATCC: CRL-2230 BC16A BC16A cell ATCC: TIB-59 LCL-1957 BC-2 BC-2 cell ATCC: CRL-2231 BC3 BC3 cell ATCC: HB-10166 LCL-1948 BC-3 BC-3 cell ATCC: CRL-2277 CHEMBL: CHEMBL3308890 CVCL: CVCL_1080 EFO: EFO_0002046 BC3A disease: leukemia BC3A cell ATCC: TIB-60 BC-3C disease: carcinoma, transitional cell BC-3C cell HyperCLDB: cl7081 BC3H1 disease: methylnitrosourea-induced smooth muscle-like tumor BC3H1 cell ATCC: CRL-1443 B-C86 B-C86 cell HyperCLDB: cl308 BC87IL2 BC87IL2 cell HyperCLDB: cl400 BC87ls BC87ls cell HyperCLDB: cl401 B-C89 B-C89 cell HyperCLDB: cl309 BC96 BC96 cell HyperCLDB: cl402 BC9-E5 BC9-E5 cell ATCC: CRL-1670 bcd mab23 bcd mab23 cell ATCC: CRL-2107 BCE C/D-1b BCE C/D-1b cell ATCC: CRL-2048 BCL subscript(1) clone 5B11b BCL subscript(1) clone 5B11b cell ATCC: TIB-197 BCL1 Clone CW13.20-3B3 disease: leukemia, B cell BCL1 Clone CW13.20-3B3 cell HyperCLDB: cl404 BCP-1 BCP-1 cell ATCC: CRL-2294 LCL-1687 ZN B-CPAP B-CPAP cell CHEMBL: CHEMBL3308356 CVCL: CVCL_0153 DSMZ: ACC 273 HyperCLDB: cl5021 BD-215 BD-215 cell HyperCLDB: cl5029 BD5-2d disease: hybridoma BD5-2d cell ATCC: HB-9689 B-D93 B-D93 cell HyperCLDB: cl310 LCL-1049 BDCM BDCM cell ATCC: CRL-2740 B-DP85 B-DP85 cell HyperCLDB: cl311 Be Ar Be Ar cell ATCC: CRL-1167 Be Sal disease: osteoporosis Be Sal cell ATCC: CRL-1140 Be Tim disease: xeroderma pigmentosum, presumed heterozygote Be Tim cell ATCC: CRL-1254 LCL-1963 BE(2)-C BE(2)-C cell ATCC: CRL-2268 LCL-1972 BE(2)-M17 BE(2)-M17 cell ATCC: CRL-2267 BE10-7 BE10-7 cell HyperCLDB: cl408 BE10-Intermediate disease: premalignant BE10-Intermediate cell HyperCLDB: cl409 BE10-Late BE10-Late cell HyperCLDB: cl410 BE11 (Early) BE11 (Early) cell HyperCLDB: cl411 LCL-1044 BE-13 BE-13 cell CHEMBL: CHEMBL3308184 CVCL: CVCL_1081 HyperCLDB: cl5030 Sanger: COSMIC ID:906763 BE2 BE2 cell ATCC: TIB-182 BE29G1 BE29G1 cell ATCC: HB-233 BE3F9 BE3F9 cell ATCC: HB-133 BEAS-2B disease: virus transformed BEAS-2B cell ATCC: CRL-9609 LCL-1602 ZN BEN BEN cell CHEMBL: CHEMBL3308709 CVCL: CVCL_1082 DSMZ: ACC 254 HyperCLDB: cl414 BEND BEND cell ATCC: CRL-2398 bEnd.3 disease: endothelioma; polyoma middle T antigen transformed bEnd.3 cell ATCC: CRL-2299 Ber Lin disease: osteoporosis Ber Lin cell ATCC: CRL-1132 Bet-1 Bet-1 cell ATCC: HB-100 Bet-2 Bet-2 cell ATCC: HB-88 BETA-TC-3 disease: insulinoma BETA-TC-3 cell HyperCLDB: cl5255 Beta-TC-6 Beta-TC-6 cell ATCC: CRL-11506 BEWO BEWO cell HyperCLDB: cl7082 LCL-1293 BeWo BeWo cell ATCC: CCL-98 CHEMBL: CHEMBL3308359 CVCL: CVCL_0044 EFO: EFO_0002050 BF-11 BF-11 cell ATCC: CRL-8164 BF-2 BF-2 cell ATCC: CCL-91 BF-32 BF-32 cell HyperCLDB: cl5256 BF-34 BF-34 cell HyperCLDB: cl419 BF-45 BF-45 cell ATCC: HB-278 B-F91 B-F91 cell HyperCLDB: cl312 BF93 BF93 cell HyperCLDB: cl423 BF95 BF95 cell HyperCLDB: cl424 BF96 BF96 cell HyperCLDB: cl425 BFA BFA cell HyperCLDB: cl426 BF-F3 disease: hybridoma BF-F3 cell ATCC: HB-283 BF-G6 BF-G6 cell HyperCLDB: cl5257 LCL-1710 ZN BFTC-905 BFTC-905 cell CHEMBL: CHEMBL3308470 CVCL: CVCL_1083 DSMZ: ACC 361 EFO: EFO_0002115 HyperCLDB: cl5031 LCL-1921 BFTC-909 disease: carcinoma, transitional cell BFTC-909 cell CHEMBL: CHEMBL3308710 CVCL: CVCL_1084 DSMZ: ACC 367 HyperCLDB: cl5032 BG194 BG194 cell HyperCLDB: cl429 B-G92 B-G92 cell HyperCLDB: cl313 BGC-823 BGC-823 cell HyperCLDB: cl4930 Bge Bge cell ATCC: CRL-1494 BGF96M BGF96M cell HyperCLDB: cl431 BGM BGM cell HyperCLDB: cl432 BGP94 BGP94 cell HyperCLDB: cl438 BHK 21 (clone 13) BHK 21 (clone 13) cell HyperCLDB: cl447 BHK 21 CL13(IZS) BHK 21 CL13(IZS) cell HyperCLDB: cl439 BHK 21 clone 13 BHK 21 clone 13 cell HyperCLDB: cl444 BHK 21 STRAIN 31 BHK 21 STRAIN 31 cell HyperCLDB: cl440 BHK 21 STRAIN 35 BHK 21 STRAIN 35 cell HyperCLDB: cl441 BHK 21 STRAIN 38 BHK 21 STRAIN 38 cell HyperCLDB: cl442 BHK TK- BHK TK- cell HyperCLDB: cl443 BHK/AC9 BHK/AC9 cell HyperCLDB: cl451 BHK-21 BHK-21 cell HyperCLDB: cl448 BHK-21 (C-13) BHK-21 (C-13) cell ATCC: CCL-10 BHK-21 clone 13 BHK-21 clone 13 cell HyperCLDB: cl445 BHK21C13-2P BHK21C13-2P cell HyperCLDB: cl452 BHK21C13-3P BHK21C13-3P cell HyperCLDB: cl453 BHK21-pcDNA3.1-HC disease: expresses human erythropoietin BHK21-pcDNA3.1-HC cell ATCC: CRL-13001 BHK570 BHK570 cell ATCC: CRL-10314 BHK-BS BHK-BS cell HyperCLDB: cl449 BHK-HVJ BHK-HVJ cell HyperCLDB: cl450 LCL-1688 BHT-101 BHT-101 cell CHEMBL: CHEMBL3308096 CVCL: CVCL_1085 DSMZ: ACC 279 EFO: EFO_0002116 HyperCLDB: cl5033 LCL-1208 BHY BHY cell CHEMBL: CHEMBL3308711 CVCL: CVCL_1086 DSMZ: ACC 404 HyperCLDB: cl5034 Bi Fin Bi Fin cell ATCC: CRL-1219 BI96 BI96 cell HyperCLDB: cl454 BICR/M1Rk BICR/M1Rk cell HyperCLDB: cl5112 Bing disease: amphotropic retroviral packaging line Bing cell ATCC: CRL-11554 BJ BJ cell ATCC: CRL-2522 BJ-5ta disease: immortalized with hTERT BJ-5ta cell ATCC: CRL-4001 B-K88 B-K88 cell HyperCLDB: cl314 BL-20 BL-20 cell HyperCLDB: cl457 BL2-8G-E6 BL2-8G-E6 cell HyperCLDB: cl461 BL-3 disease: leukemia BL-3 cell ATCC: CRL-8037 BL3.1 disease: lymphosarcoma BL3.1 cell ATCC: CRL-2306 LCL-2028 BL-41 BL-41 cell CHEMBL: CHEMBL3308526 CVCL: CVCL_1087 DSMZ: ACC 160 HyperCLDB: cl459 LCL-2016 BL-70 BL-70 cell CHEMBL: CHEMBL3308185 CVCL: CVCL_1088 DSMZ: ACC 233 HyperCLDB: cl460 B-L94 B-L94 cell HyperCLDB: cl315 BL95 BL95 cell HyperCLDB: cl462 BLE96 BLE96 cell HyperCLDB: cl463 BLK CL.4 BLK CL.4 cell ATCC: TIB-81 BLK SV HD.2 A.5R.1 A.3R.1 BLK SV HD.2 A.5R.1 A.3R.1 cell ATCC: TIB-88 BLn BLn cell ATCC: CRL-6017 BLN96M BLN96M cell HyperCLDB: cl464 BLO-11 disease: lysyl oxidase deficiency BLO-11 cell ATCC: CCL-198 Bm Bm cell HyperCLDB: cl466 B-M 92a B-M 92a cell HyperCLDB: cl316 B-M 92f B-M 92f cell HyperCLDB: cl317 Bm N Bm N cell HyperCLDB: cl467 BM-1604 BM-1604 cell HyperCLDB: cl5258 BM87 BM87 cell HyperCLDB: cl468 B-M91a B-M91a cell HyperCLDB: cl318 B-M91f B-M91f cell HyperCLDB: cl319 B-M93 B-M93 cell HyperCLDB: cl320 BM95 BM95 cell HyperCLDB: cl469 BME/CTVM 4 BME/CTVM 4 cell HyperCLDB: cl470 BM-N BM-N cell ATCC: CRL-8910 BNL 1ME A.7R.1 disease: chemically transformed BNL 1ME A.7R.1 cell ATCC: TIB-75 BNL 1NG A.2 BNL 1NG A.2 cell ATCC: TIB-76 BNL CL.2 disease: embryonic BNL CL.2 cell ATCC: TIB-73 BNL SV A.8 disease: SV40 transformed BNL SV A.8 cell ATCC: TIB-74 Bo Gin disease: Ehlers-Danlos syndrome, type I (autosomal dominant type) Bo Gin cell ATCC: CRL-1180 BONNA-12 disease: leukemia, hairy cell BONNA-12 cell HyperCLDB: cl473 BP107.2.2 disease: hybridoma BP107.2.2 cell ATCC: TIB-154 BP86 BP86 cell HyperCLDB: cl475 B-P91 B-P91 cell HyperCLDB: cl321 B-P94 B-P94 cell HyperCLDB: cl322 BP96 BP96 cell HyperCLDB: cl476 BPAEC BPAEC cell HyperCLDB: cl477 BPE BPE cell HyperCLDB: cl478 LCL-2095 BPH-1 WEB: http://capcelllines.ca/details.asp?id=132 Web: http://www.ncbi.nlm.nih.gov/pubmed/7535634 disease: hyperplasia,benign BPH-1 cell HyperCLDB: cl5259 BpRcl disease: hepatoma BpRcl cell ATCC: CRL-2217 B-R92 B-R92 cell HyperCLDB: cl323 B-R93a B-R93a cell HyperCLDB: cl324 B-R93f B-R93f cell HyperCLDB: cl325 BR96P BR96P cell HyperCLDB: cl479 BRISTOL 8 BRISTOL 8 cell HyperCLDB: cl480 BRL 3A BRL 3A cell ATCC: CRL-1442 BRL-1 BRL-1 cell HyperCLDB: cl483 BRL-3A BRL-3A cell HyperCLDB: cl4989 BS/BEK BS/BEK cell HyperCLDB: cl488 BS1-B4 BS1-B4 cell HyperCLDB: cl489 B-S95 B-S95 cell HyperCLDB: cl326 BSC1 BSC1 cell HyperCLDB: cl487 BSC-1 BSC-1 cell HyperCLDB: cl484 BS-C-1 BS-C-1 cell ATCC: CCL-26 BSC40 BSC40 cell ATCC: CRL-2761 BSp BSp cell ATCC: CRL-6019 BT BT cell ATCC: CRL-1390 LCL-1476 ZN BT-20 BT20 BT-20 cell ATCC: HTB-19 CHEMBL: CHEMBL3307766 CVCL: CVCL_0178 EFO: EFO_0001092 LCL-1308 BT-474 disease: ductal carcinoma BT-474 cell ATCC: HTB-20 CHEMBL: CHEMBL3307636 CVCL: CVCL_0179 EFO: EFO_0001093 LCL-1309 BT-483 BT-483 cell ATCC: HTB-121 LCL-1310 BT-549 disease: ductal carcinoma BT-549 cell ATCC: HTB-122 CHEMBL: CHEMBL3308490 CVCL: CVCL_1092 EFO: EFO_0001096 BT-B BT-B cell HyperCLDB: cl500 BThy BThy cell ATCC: CRL-6020 BTI-EAA Possible typographic error in 'Organism' field (value 'insect - Estigmene agrea') to be considered as 'Estigmene agreai' (NCBI_Taxon: 56594) [SS] BTI-EAA cell HyperCLDB: cl502 BTV10XSp2/0-Ag-14-10D4.90 disease: hybridoma BTV10XSp2/0-Ag-14-10D4.90 cell ATCC: HB-8377 Bu (IMR-31) Bu (IMR-31) cell HyperCLDB: cl504 Bu25 TK- disease: carcinoma, cervical Bu25 TK- cell HyperCLDB: cl506 BUD-8 BUD-8 cell ATCC: CRL-1554 LCL-1111 BV-173 BV-173 cell CHEMBL: CHEMBL3308228 CVCL: CVCL_0181 HyperCLDB: cl510 Sanger: COSMIC ID:910710 B-V92 B-V92 cell HyperCLDB: cl327 BVD2-21C11.3 BVD2-21C11.3 cell ATCC: HB-9569 BVD2-23B6.4 disease: hybridoma BVD2-23B6.4 cell ATCC: HB-9568 BW1J BW1J cell HyperCLDB: cl511 BW5147 BW5147 cell HyperCLDB: cl512 BW5147(T200–a) 5.2 BW5147(T200–a) 5.2 cell ATCC: TIB-233 BW5147.3 BW5147.3 cell ATCC: TIB-47 BW5147.3(Thy-1-e).10 BW5147.3(Thy-1-e).10 cell ATCC: TIB-234 BW5147.G.1.4 BW5147.G.1.4 cell ATCC: TIB-48 BW5147.G.1.4.OUA/R.1 BW5147.G.1.4.OUA/R.1 cell HyperCLDB: cl513 BW5147.G.1.4.OUAR.1 BW5147.G.1.4.OUAR.1 cell ATCC: CRL-1588 BWTG3 BWTG3 cell HyperCLDB: cl515 LCL-1731 BxPC-3 BxPC-3 cell ATCC: CRL-1687 CHEMBL: CHEMBL3307637 CVCL: CVCL_0186 EFO: EFO_0002709 HyperCLDB: cl516 HyperCLDB: cl518 B-Z94 B-Z94 cell HyperCLDB: cl328 BZR disease: virus transformed BZR cell ATCC: CRL-9483 C 108 C 108 cell HyperCLDB: cl519 C 1271 disease: mammary tumor C 1271 cell HyperCLDB: cl548 C 211 disease: Cri du Chat syndrome C 211 cell ATCC: CCL-123 C subscript(2) C subscript(12) C subscript(2) C subscript(12) cell ATCC: CRL-1772 HyperCLDB: cl563 C subscript(6) C subscript(6) cell ATCC: CCL-107 C0092 C0092 cell HyperCLDB: cl540 C0994IL2 C0994IL2 cell HyperCLDB: cl541 c1 (B6NLxv1c2) c1 (B6NLxv1c2) cell ATCC: CRL-2716 C1.18.4 disease: plasmacytoma; myeloma C1.18.4 cell ATCC: TIB-11 C1191f C1191f cell HyperCLDB: cl542 C1191v C1191v cell HyperCLDB: cl543 C1192 C1192 cell HyperCLDB: cl544 C1195 C1195 cell HyperCLDB: cl545 C11C1 disease: hybridoma C11C1 cell ATCC: HB-8964 c12 (B15ECiii2) disease: hepatoma c12 (B15ECiii2) cell ATCC: CRL-2710 C127 C127 cell HyperCLDB: cl546 C127 ts C127 ts cell HyperCLDB: cl547 C127:LT C127:LT cell ATCC: CRL-1804 C127I C127I cell ATCC: CRL-1616 C129 C129 cell ATCC: HB-9516 C1293 C1293 cell HyperCLDB: cl551 C1294a C1294a cell HyperCLDB: cl552 C1294f C1294f cell HyperCLDB: cl553 C1300 CLONE NA C1300 CLONE NA cell HyperCLDB: cl554 C13589 C13589 cell ATCC: CRL-2704 C1498 disease: acute myeloid C1498 cell ATCC: TIB-49 C1595a C1595a cell HyperCLDB: cl555 C1595f C1595f cell HyperCLDB: cl556 C16 C16 cell HyperCLDB: cl557 C166 disease: endothelial cell differentiation model; stem cell feeder layer C166 cell ATCC: CRL-2581 C166-GFP disease: GFP-expressing version of C166 C166-GFP cell ATCC: CRL-2583 C171 disease: hybridoma C171 cell ATCC: HB-9515 C180 C180 cell ATCC: HB-9517 C1PV C1PV cell HyperCLDB: cl558 C1R-B7 C1R-B7 cell ATCC: CRL-2371 C1R-neo C1R-neo cell ATCC: CRL-2369 C1R-sB7 C1R-sB7 cell ATCC: CRL-2370 C2 disease: hepatoma C2 cell HyperCLDB: cl559 C211 C211 cell HyperCLDB: cl562 C273 disease: hybridoma C273 cell ATCC: HB-9303 LCL-1296 C2BBe1 C2BBe1 cell ATCC: CRL-2102 CHEMBL: CHEMBL3308231 CVCL: CVCL_1096 C2PV C2PV cell HyperCLDB: cl565 C2-Rev 7 C2-Rev 7 cell HyperCLDB: cl560 HyperCLDB: cl561 C305 disease: hybridoma C305 cell ATCC: CRL-2424 C3-124 disease: hybridoma C3-124 cell ATCC: HB-60 LCL-1238 C32 C32 cell ATCC: CRL-1585 CHEMBL: CHEMBL3308713 CVCL: CVCL_1097 C32TG disease: amelanotic melanoma C32TG cell ATCC: CRL-1579 LCL-1300 C-33 A C-33 A cell ATCC: HTB-31 c35 (B16GBi1c3) disease: hepatoma c35 (B16GBi1c3) cell ATCC: CRL-2715 c37 (B7IFi1) disease: hepatoma c37 (B7IFi1) cell ATCC: CRL-2711 C38 disease: cystic fibrosis; immortalized with Ad12-SV40 hybrid C38 cell ATCC: CRL-2779 LCL-1927 C3A C3A cell ATCC: CRL-10741 CHEMBL: CHEMBL3308377 CVCL: CVCL_1098 EFO: EFO_0002121 C3H/10T1/2, Clone 8 C3H/10T1/2, Clone 8 cell ATCC: CCL-226 HyperCLDB: cl567 C3H/MCA clone 15 C3H/MCA clone 15 cell ATCC: CRL-1411 C3H/MCA clone 16 C3H/MCA clone 16 cell ATCC: CRL-1412 C3PV C3PV cell HyperCLDB: cl570 c4 (B13NBii1) c4 (B13NBii1) cell ATCC: CRL-2717 LCL-1301 C-4 I C-4 I cell ATCC: CRL-1594 LCL-1302 C-4 II C-4 II cell ATCC: CRL-1595 C-433 C-433 cell HyperCLDB: cl520 C44 C44 cell ATCC: CRL-1943 C-4I disease: carcinoma, cervical C-4I cell HyperCLDB: cl521 C4PV C4PV cell HyperCLDB: cl573 C5 C5 cell ATCC: HB-8669 C5/MJ C5/MJ cell ATCC: CRL-8293 C57/B1 C57/B1 cell HyperCLDB: cl574 C57L/J.We C57L/J.We cell ATCC: CRL-6336 C57SV C57SV cell HyperCLDB: cl576 C58(NT)D.1.G.OVAR.1 disease: T cell C58(NT)D.1.G.OVAR.1 cell ATCC: TIB-236 C5B7 C5B7 cell ATCC: CRL-8753 C5MJ C5MJ cell HyperCLDB: cl577 C5PV C5PV cell HyperCLDB: cl578 C6 disease: glial tumor C6 cell HyperCLDB: cl581 C6/CH C6/CH cell HyperCLDB: cl586 C6/LacZ disease: gliosarcoma; expresses beta-galactosidase C6/LacZ cell ATCC: CRL-2199 C6/lacZ7 C6/lacZ7 cell ATCC: CRL-2303 C6-BU-1 disease: tumor C6-BU-1 cell HyperCLDB: cl584 C6PV C6PV cell HyperCLDB: cl587 C6-Russian C6-Russian cell HyperCLDB: cl585 C7 C7 cell ATCC: CRL-1691 C7PV C7PV cell HyperCLDB: cl588 LCL-1011 C8166 C8166 cell CHEMBL: CHEMBL3307638 CVCL: CVCL_1099 ECACC: 88051601 HyperCLDB: cl589 C83 C83 cell HyperCLDB: cl590 C86M C86M cell HyperCLDB: cl591 C86P C86P cell HyperCLDB: cl592 C87 C87 cell HyperCLDB: cl593 C8-B4 C8-B4 cell ATCC: CRL-2540 C8-D1A C8-D1A cell ATCC: CRL-2541 C8-D30 C8-D30 cell ATCC: CRL-2534 C8PV C8PV cell HyperCLDB: cl594 C8-S C8-S cell ATCC: CRL-2535 C91 C91 cell HyperCLDB: cl595 C91PL C91PL cell HyperCLDB: cl596 C92 C92 cell HyperCLDB: cl597 C93 C93 cell HyperCLDB: cl598 C96 C96 cell HyperCLDB: cl600 C9PV C9PV cell HyperCLDB: cl601 LCL-1541 ZN Ca Ski Ca Ski cell ATCC: CRL-1550 ECACC: 87020501 CA295 CA295 cell HyperCLDB: cl607 CA3-F4 disease: hybridoma CA3-F4 cell ATCC: CRL-1667 LCL-2017 CA46 disease: Burkitts lymphoma CA46 cell ATCC: CRL-1648 CHEMBL: CHEMBL3308488 CVCL: CVCL_1101 EFO: EFO_0002124 HyperCLDB: cl609 CA95 CA95 cell HyperCLDB: cl611 CA96 CA96 cell HyperCLDB: cl612 CAB 117-12D10 CAB 117-12D10 cell ATCC: HB-10558 LCL-1170 Caco-2 disease: colorectal adenocarcinoma Caco-2 cell ATCC: HTB-37 CHEMBL: CHEMBL3307519 CVCL: CVCL_0025 EFO: EFO_0001099 HyperCLDB: cl618 MeSH: D018938 CADO-ES1 CADO-ES1 cell HyperCLDB: cl5036 CA-HPV-10 disease: adenocarcinoma; HPV-18 transfected CA-HPV-10 cell ATCC: CRL-2220 CAKI-1 CAKI-1 cell HyperCLDB: cl623 LCL-1774 Caki-1 disease: clear cell carcinoma (kidney primary) Caki-1 cell ATCC: HTB-46 CHEMBL: CHEMBL3307522 CVCL: CVCL_0234 EFO: EFO_0002149 Caki-2 Caki-2 cell ATCC: HTB-47 HyperCLDB: cl626 HyperCLDB: cl627 LCL-1215 CAL 27 CAL 27 cell ATCC: CRL-2095 LCL-1463 CAL-120 CAL-120 cell CHEMBL: CHEMBL3308577 CVCL: CVCL_1104 DSMZ: ACC 459 EFO: EFO_0005356 HyperCLDB: cl7083 LCL-1603 ZN CAL-12T CAL-12T cell CHEMBL: CHEMBL3308132 CVCL: CVCL_1105 DSMZ: ACC 443 HyperCLDB: cl7084 LCL-1464 ZN CAL-148 CAL-148 cell CHEMBL: CHEMBL3308794 CVCL: CVCL_1106 DSMZ: ACC 460 EFO: EFO_0005357 HyperCLDB: cl7085 CAL-27 CAL-27 cell HyperCLDB: cl7086 LCL-1216 CAL-33 CAL-33 cell CVCL: CVCL_1108 DSMZ: ACC 447 HyperCLDB: cl7087 LCL-1294 CAL-39 disease: carcinoma, squamous cell CAL-39 cell CHEMBL: CHEMBL3308716 CVCL: CVCL_1109 DSMZ: ACC 187 HyperCLDB: cl630 LCL-1472 CAL-51 CAL-51 cell CHEMBL: CHEMBL3308717 CVCL: CVCL_1110 DSMZ: ACC 302 EFO: EFO_0005358 HyperCLDB: cl5037 LCL-1757 CAL-54 CAL-54 cell CHEMBL: CHEMBL3308346 CVCL: CVCL_1111 DSMZ: ACC 365 EFO: EFO_0002125 HyperCLDB: cl5038 LCL-1683 CAL-62 disease: carcinoma, anaplastic CAL-62 cell CHEMBL: CHEMBL3308099 CVCL: CVCL_1112 DSMZ: ACC 448 EFO: EFO_0002126 HyperCLDB: cl7088 LCL-1419 ZN CAL-72 CAL-72 cell CHEMBL: CHEMBL3308718 CVCL: CVCL_1113 DSMZ: ACC 439 HyperCLDB: cl7089 LCL-1457 ZN CAL-78 CAL-78 cell DSMZ: ACC 449 HyperCLDB: cl7090 LCL-1465 CAL-85-1 CAL-85-1 cell CHEMBL: CHEMBL3308700 CVCL: CVCL_1114 DSMZ: ACC 440 EFO: EFO_0005359 HyperCLDB: cl7091 LCL-1580 ZN Calu-1 disease: epidermoid carcinoma (lung primary) Calu-1 cell ATCC: HTB-54 CHEMBL: CHEMBL3308031 CVCL: CVCL_0608 EFO: EFO_0002151 HyperCLDB: cl631 HyperCLDB: cl632 LCL-1631 ZN Calu-3 Calu-3 cell ATCC: HTB-55 CHEMBL: CHEMBL3307390 CVCL: CVCL_0609 EFO: EFO_0002819 LCL-1626 ZN Calu-6 disease: unknown, probably lung anaplastic carcinoma Calu-6 cell ATCC: HTB-56 CHEMBL: CHEMBL3307639 CVCL: CVCL_0236 EFO: EFO_0002152 Sanger: COSMIC ID:724859 LCL-1466 ZN CAMA-1 CAMA-1 cell ATCC: HTB-21 CHEMBL: CHEMBL3308719 CVCL: CVCL_1115 EFO: EFO_0001100 LCL-1519 ZN Caov-3 Caov-3 cell ATCC: HTB-75 LCL-1520 ZN Caov-4 Caov-4 cell CHEMBL: CHEMBL3308232 CVCL: CVCL_0202 LCL-1732 Capan-1 Capan-1 cell ATCC: HTB-79 CHEMBL: CHEMBL3307640 CVCL: CVCL_0237 EFO: EFO_0002153 HyperCLDB: cl639 HyperCLDB: cl640 LCL-1733 Capan-2 Capan-2 cell ATCC: HTB-80 CHEMBL: CHEMBL3308720 CVCL: CVCL_0026 EFO: EFO_0002154 HyperCLDB: cl642 HyperCLDB: cl644 CAR CAR cell ATCC: CCL-71 LCL-1369 ZN CAS-1 CAS-1 cell CHEMBL: CHEMBL3308187 CVCL: CVCL_1117 HyperCLDB: cl4963 Sanger: COSMIC ID:910943 CaSki disease: carcinoma, epidermoid, from metastatic site CaSki cell HyperCLDB: cl4940 CAT-13.0B10 CAT-13.0B10 cell HyperCLDB: cl7092 CAT-13.1E10 CAT-13.1E10 cell HyperCLDB: cl7093 CAT-13.6E12 CAT-13.6E12 cell HyperCLDB: cl7094 CAT-13.9C1 CAT-13.9C1 cell HyperCLDB: cl7095 Cates-1B disease: embryonal carcinoma Cates-1B cell ATCC: HTB-104 CATH.a CATH.a cell ATCC: CRL-11179 CB57/C91PL CB57/C91PL cell HyperCLDB: cl648 CB58/MT2 CB58/MT2 cell HyperCLDB: cl649 CB59/MT2 CB59/MT2 cell HyperCLDB: cl650 C-B94 C-B94 cell HyperCLDB: cl522 C-B95 C-B95 cell HyperCLDB: cl523 CBL-1 CBL-1 cell ATCC: HB-8214 CC 49 disease: hybridoma CC 49 cell ATCC: HB-9459 CC-1 CC-1 cell HyperCLDB: cl651 CC15 CC15 cell ATCC: HB-265 CC17 disease: hybridoma CC17 cell ATCC: HB-281 CC20 disease: hybridoma CC20 cell ATCC: HB-267 CC21 disease: hybridoma CC21 cell ATCC: HB-288 CC29 disease: hybridoma CC29 cell ATCC: HB-269 CC30 disease: hybridoma CC30 cell ATCC: HB-270 CC38 disease: hybridoma CC38 cell ATCC: HB-266 CC39 disease: hybridoma CC39 cell ATCC: HB-274 CC42 disease: hybridoma CC42 cell ATCC: HB-272 CC51 disease: hybridoma CC51 cell ATCC: HB-271 CC55 disease: hybridoma CC55 cell ATCC: HB-282 CC56 disease: hybridoma CC56 cell ATCC: HB-273 CC57 CC57 cell ATCC: HB-268 CC58 disease: hybridoma CC58 cell ATCC: HB-275 CC63 disease: hybridoma CC63 cell ATCC: HB-264 CC8 CC8 cell ATCC: HB-280 CC81 CC81 cell HyperCLDB: cl652 C-C87a C-C87a cell HyperCLDB: cl524 C-C87f C-C87f cell HyperCLDB: cl525 C-C90 C-C90 cell HyperCLDB: cl526 C-C91 C-C91 cell HyperCLDB: cl527 C-C95 C-C95 cell HyperCLDB: cl528 CC96 CC96 cell HyperCLDB: cl653 CC9C10 disease: hybridoma CC9C10 cell ATCC: HB-123 CCD 1102 KERTr disease: keratinocyte; HPV-16 E6/E7 transformed CCD 1102 KERTr cell ATCC: CRL-2310 CCD 1103 KIDTr CCD 1103 KIDTr cell ATCC: CRL-2304 CCD 1105 KIDTr disease: HPV-16 E6/E7 transformed CCD 1105 KIDTr cell ATCC: CRL-2305 CCD 1106 KERTr CCD 1106 KERTr cell ATCC: CRL-2309 CCD 1108Sk CCD 1108Sk cell ATCC: CRL-2352 CCD 13Lu CCD 13Lu cell HyperCLDB: cl654 CCD 16Lu CCD 16Lu cell HyperCLDB: cl655 CCD 18Lu CCD 18Lu cell ATCC: CCL-205 CCD 19Lu CCD 19Lu cell HyperCLDB: cl657 CCD 25Lu CCD 25Lu cell HyperCLDB: cl658 CCD 841 CoN CCD 841 CoN cell ATCC: CRL-1790 CCD 841 CoTr CCD 841 CoTr cell ATCC: CRL-1807 CCD 8Lu CCD 8Lu cell HyperCLDB: cl659 CCD-1037Sk CCD-1037Sk cell ATCC: CRL-2054 CCD-1058Sk CCD-1058Sk cell ATCC: CRL-2071 CCD-1059Sk CCD-1059Sk cell ATCC: CRL-2072 CCD-1064Sk CCD-1064Sk cell ATCC: CRL-2076 CCD-1065Sk CCD-1065Sk cell ATCC: CRL-2077 CCD-1068Sk CCD-1068Sk cell ATCC: CRL-2086 CCD-1069Sk CCD-1069Sk cell ATCC: CRL-2089 CCD-1070Sk CCD-1070Sk cell ATCC: CRL-2091 CCD-1072Sk CCD-1072Sk cell ATCC: CRL-2088 CCD-1074Sk CCD-1074Sk cell ATCC: CRL-2090 CCD-1076Sk CCD-1076Sk cell ATCC: CRL-2096 CCD-1077Sk CCD-1077Sk cell ATCC: CRL-2094 CCD-1079Sk CCD-1079Sk cell ATCC: CRL-2097 CCD-1086Sk CCD-1086Sk cell ATCC: CRL-2103 CCD-1087Sk CCD-1087Sk cell ATCC: CRL-2104 CCD-1090Sk CCD-1090Sk cell ATCC: CRL-2106 CCD-1092Sk CCD-1092Sk cell ATCC: CRL-2114 CCD-1093Sk CCD-1093Sk cell ATCC: CRL-2115 CCD-1094Sk CCD-1094Sk cell ATCC: CRL-2120 CCD-1095Sk CCD-1095Sk cell ATCC: CRL-2122 CCD-1096Sk CCD-1096Sk cell ATCC: CRL-2129 CCD-1097Sk CCD-1097Sk cell ATCC: CRL-2124 CCD-1098Sk CCD-1098Sk cell ATCC: CRL-2127 CCD-1099Sk CCD-1099Sk cell ATCC: CRL-2201 CCD-1100Sk CCD-1100Sk cell ATCC: CRL-2211 CCD-1101Sk CCD-1101Sk cell ATCC: CRL-2281 CCD-1109Sk CCD-1109Sk cell ATCC: CRL-2361 CCD-1112Sk https://www.atcc.org/products/all/CRL-2429 CCD-1112Sk cell ATCC: CRL-2429 CCD-1113Sk CCD-1113Sk cell ATCC: CRL-2439 CCD-1114Sk CCD-1114Sk cell ATCC: CRL-2450 CCD-1117Sk CCD-1117Sk cell ATCC: CRL-2465 CCD-1118Sk CCD-1118Sk cell ATCC: CRL-2466 CCD-112 CoN CCD-112 CoN cell ATCC: CRL-1541 CCD-1120Sk CCD-1120Sk cell ATCC: CRL-2510 CCD-1121Sk CCD-1121Sk cell ATCC: CRL-2511 CCD-1122Sk CCD-1122Sk cell ATCC: CRL-2513 CCD-1123Sk CCD-1123Sk cell ATCC: CRL-2524 CCD-1124Sk CCD-1124Sk cell ATCC: CRL-2529 CCD-1126Sk CCD-1126Sk cell ATCC: CRL-2564 CCD-1127Sk CCD-1127Sk cell ATCC: CRL-2565 CCD-1128Sk CCD-1128Sk cell ATCC: CRL-2566 CCD-1129SK CCD-1129SK cell ATCC: CRL-2575 CCD-1131Sk CCD-1131Sk cell ATCC: CRL-2617 CCD-1132Sk CCD-1132Sk cell ATCC: CRL-2622 CCD-1134Sk CCD-1134Sk cell ATCC: CRL-2673 CCD-1135Sk CCD-1135Sk cell ATCC: CRL-2691 CCD-1136Sk CCD-1136Sk cell ATCC: CRL-2697 CCD-1137Sk https://www.atcc.org/en/Products/Cells_and_Microorganisms/By_Tissue/Other_Tissues/Foreskin/CRL-2703.aspx CCD-1137Sk cell ATCC: CRL-2703 CCD-1138Sk CCD-1138Sk cell ATCC: CRL-2707 CCD-1139Sk CCD-1139Sk cell ATCC: CRL-2708 CCD-1140Sk CCD-1140Sk cell ATCC: CRL-2714 CCD-1141Sk CCD-1141Sk cell ATCC: CRL-2796 CCD-11Lu CCD-11Lu cell ATCC: CCL-202 CCD-13Lu CCD-13Lu cell ATCC: CCL-200 CCD-16Lu CCD-16Lu cell ATCC: CCL-204 CCD-186Sk CCD-186Sk cell ATCC: CRL-1563 CCD-18Co CCD-18Co cell ATCC: CRL-1459 CCD-19Lu CCD-19Lu cell ATCC: CCL-210 CCD-25Lu CCD-25Lu cell ATCC: CCL-215 CCD-25Sk CCD-25Sk cell ATCC: CRL-1474 CCD-27Sk CCD-27Sk cell ATCC: CRL-1475 CCD-29Lu disease: emphysema CCD-29Lu cell ATCC: CRL-1478 CCD-32Lu CCD-32Lu cell ATCC: CRL-1485 CCD-32Sk CCD-32Sk cell ATCC: CRL-1489 CCD-33Co CCD-33Co cell ATCC: CRL-1539 CCD-33Lu CCD-33Lu cell ATCC: CRL-1490 CCD-34Lu CCD-34Lu cell ATCC: CRL-1491 CCD-34Sk CCD-34Sk cell ATCC: CRL-1497 CCD-37Lu CCD-37Lu cell HyperCLDB: cl666 CCD-39Lu disease: hyaline membrane disease CCD-39Lu cell ATCC: CRL-1498 CCD-39Sk CCD-39Sk cell ATCC: CRL-1501 CCD-42Sk CCD-42Sk cell ATCC: CRL-1513 CCD-43Sk CCD-43Sk cell ATCC: CRL-1509 CCD-8Lu CCD-8Lu cell ATCC: CCL-201 CCD-944Sk CCD-944Sk cell ATCC: CRL-1836 CCD-986Sk CCD-986Sk cell ATCC: CRL-1947 LCL-1394 CCF-STTG1 CCF-STTG1 cell CHEMBL: CHEMBL3308795 CVCL: CVCL_1118 EFO: EFO_0002127 CCK061 disease: hybridoma CCK061 cell ATCC: HB-8786 CCM89M CCM89M cell HyperCLDB: cl670 CCO CCO cell ATCC: CRL-2772 CCRF S-180 II CCRF S-180 II cell ATCC: CCL-8 HyperCLDB: cl672 LCL-1012 CCRF-CEM CCRF-CEM cell ATCC: CCL-119 CHEMBL: CHEMBL3307641 CVCL: CVCL_0207 EFO: EFO_0002128 LCL-1914 CCRF-HSB-2 CCRF-HSB-2 cell ATCC: CCL-120.1 LCL-1006 JX, YH CCRF-SB CCRF-SB cell ATCC: CCL-120 CCL-120 CHEMBL: CHEMBL3307643 CVCL: CVCL_1860 CD86 CD86 cell HyperCLDB: cl683 CD88f CD88f cell HyperCLDB: cl684 CD88ls CD88ls cell HyperCLDB: cl685 CD89P CD89P cell HyperCLDB: cl686 C-D92 C-D92 cell HyperCLDB: cl529 CDC 1C42H11 disease: hybridoma CDC 1C42H11 cell ATCC: HB-216 CDM96 CDM96 cell HyperCLDB: cl687 CDR1 disease: hybridoma CDR1 cell ATCC: HB-213 CDR2 disease: hybridoma CDR2 cell ATCC: HB-214 C-E 92 C-E 92 cell HyperCLDB: cl530 Ce Ar disease: xeroderma pigmentosum, presumed heterozygote Ce Ar cell ATCC: CRL-1165 Ce Geg disease: Marfan syndrome Ce Geg cell ATCC: CRL-1173 Ce Wal disease: poikiloderma Ce Wal cell ATCC: CRL-1351 CE-1 disease: hygromycin resistant CE-1 cell ATCC: SCRC-1038 CE-3 disease: puromycin resistant CE-3 cell ATCC: SCRC-1039 CE9H9 disease: hybridoma CE9H9 cell ATCC: HB-127 CEF CEF cell HyperCLDB: cl689 CEINGE CLONE 3 CEINGE CLONE 3 cell HyperCLDB: cl690 LCL-1034 CEM/C1 CEM/C1 cell ATCC: CRL-2265 LCL-1035 CEM/C2 CEM/C2 cell ATCC: CRL-2264 CHEMBL: CHEMBL3307952 CVCL: CVCL_3497 CEM-CM3 disease: T cell CEM-CM3 cell ATCC: TIB-195 CEM-LAV-2 CEM-LAV-2 cell HyperCLDB: cl693 CER CER cell HyperCLDB: cl694 LCL-1050 CESS disease: myelomonocytic leukemia CESS cell ATCC: TIB-190 CHEMBL: CHEMBL3308863 CVCL: CVCL_0209 EFO: EFO_0002130 CF-1 MEF disease: feeder layer CF-1 MEF cell ATCC: SCRC-1040 CF-10H5 CF-10H5 cell HyperCLDB: cl7096 CF11.T disease: connective tissue; osteosarcoma CF11.T cell ATCC: CRL-6217 CF17.T CF17.T cell ATCC: CRL-6219 CF-1D12 CF-1D12 cell HyperCLDB: cl7097 CF21.T CF21.T cell ATCC: CRL-6220 CF24.T CF24.T cell ATCC: CRL-6221 CF28 CF28 cell ATCC: CRL-6223 CF2Th CF2Th cell HyperCLDB: cl698 Cf2Th Cf2Th cell ATCC: CRL-1430 CF3.Th CF3.Th cell ATCC: CRL-6575 CF30.Mg CF30.Mg cell ATCC: CRL-6225 CF33.MT CF33.MT cell ATCC: CRL-6227 CF34.Mg CF34.Mg cell ATCC: CRL-6228 CF35.Mg CF35.Mg cell ATCC: CRL-6229 CF37.Mg CF37.Mg cell ATCC: CRL-6230 CF38.Mg CF38.Mg cell ATCC: CRL-6231 CF41.Mg CF41.Mg cell ATCC: CRL-6232 CF43.Mg CF43.Mg cell ATCC: CRL-6234 CF44.Mg CF44.Mg cell ATCC: CRL-6235 CF45B.Mg CF45B.Mg cell ATCC: CRL-6237 CF46.Tr CF46.Tr cell ATCC: CRL-6238 CF47.Mg CF47.Mg cell ATCC: CRL-6239 CF48.Mg CF48.Mg cell ATCC: CRL-6240 CF49.Mg CF49.Mg cell ATCC: CRL-6241 CF4-C4 disease: hybridoma CF4-C4 cell ATCC: CRL-1716 CF52.Tr CF52.Tr cell ATCC: CRL-6244 CF8.Thy CF8.Thy cell ATCC: CRL-6211 CF84f CF84f cell HyperCLDB: cl700 CF84ls CF84ls cell HyperCLDB: cl701 C-F89 C-F89 cell HyperCLDB: cl531 CF89P CF89P cell HyperCLDB: cl702 CF96F CF96F cell HyperCLDB: cl703 CF96P CF96P cell HyperCLDB: cl704 LCL-1748 CFPAC-1 disease: ductal adenocarcinoma; cystic fibrosis CFPAC-1 cell ATCC: CRL-1918 CHEMBL: CHEMBL3308032 CVCL: CVCL_1119 CFZT(A) CFZT(A) cell ATCC: CRL-6338 CFZT(B) CFZT(B) cell ATCC: CRL-6339 CG5 CG5 cell HyperCLDB: cl707 CG7C7 disease: hybridoma CG7C7 cell ATCC: HB-126 C-G86 C-G86 cell HyperCLDB: cl532 CG89 CG89 cell HyperCLDB: cl708 CG94IL2 CG94IL2 cell HyperCLDB: cl710 CG96 CG96 cell HyperCLDB: cl711 CGBQ CGBQ cell ATCC: CCL-169 CGR8 CGR8 cell HyperCLDB: cl713 LCL-1691 CGTH-W-1 CGTH-W-1 cell CHEMBL: CHEMBL3308849 CVCL: CVCL_1120 DSMZ: ACC 360,COSMIC ID:910568; DSMZ ACC 360 HyperCLDB: cl5040 Ch 1 Es (NBL-8) Ch 1 Es (NBL-8) cell ATCC: CCL-73 CH1 CH1 cell ATCC: TIB-221 Ch1.Es Ch1.Es cell ATCC: CRL-6581 Ch13 disease: hybridoma Ch13 cell ATCC: HB-8573 Ch2.D Ch2.D cell ATCC: CRL-6270 CH26-1352 disease: hybridoma CH26-1352 cell ATCC: HB-8329 LCL-1579 ZN ChaGo-K-1 disease: bronchogenic carcinoma (bronchus primary) ChaGo-K-1 cell ATCC: HTB-168 CHEMBL: CHEMBL3308489 CVCL: CVCL_1121 EFO: EFO_0002155 Chang liver Chang liver cell HyperCLDB: cl715 Chang Liver Chang Liver cell ATCC: CCL-13 CH-EB6 disease: hybridoma CH-EB6 cell ATCC: HB-200 CHH-1 CHH-1 cell ATCC: CRL-1680 CHL CHL cell HyperCLDB: cl720 CHL/IU CHL/IU cell ATCC: CRL-1935 CHL-1 CHL-1 cell ATCC: CRL-9446 CHO Chinese Hamster Ovary cell CHO cell HyperCLDB: cl721 MeSH: D016466 CHO 1-15 subscript(500) disease: produces human t-PA CHO 1-15 subscript(500) cell ATCC: CRL-9606 CHO clone 13 CHO clone 13 cell HyperCLDB: cl725 CHO clone B CHO clone B cell HyperCLDB: cl726 CHO DP-12, clone#1934 alL8.92 NB 28605/14 disease: expresses IgG1 (kappa) against IL-8 CHO DP-12, clone#1934 alL8.92 NB 28605/14 cell ATCC: CRL-12445 CHO DP-12, clone#1993 alL8.92 NB 28605/12 disease: expresses IgG1 (kappa) against IL-8 CHO DP-12, clone#1993 alL8.92 NB 28605/12 cell ATCC: CRL-12444 CHO K1 CHO K1 cell HyperCLDB: cl731 CHO MT+ CHO MT+ cell HyperCLDB: cl727 CHO/dhFr– CHO/dhFr– cell ATCC: CRL-9096 HyperCLDB: cl728 CHO10PV CHO10PV cell HyperCLDB: cl743 CHO12RO CHO12RO cell HyperCLDB: cl744 CHO181PV CHO181PV cell HyperCLDB: cl745 CHO191PV CHO191PV cell HyperCLDB: cl746 CHO192PV CHO192PV cell HyperCLDB: cl747 CHO-1C6 disease: produces neuroleukin CHO-1C6 cell ATCC: CRL-1793 CHO201PV CHO201PV cell HyperCLDB: cl748 CHO202PV CHO202PV cell HyperCLDB: cl749 CHO203PV CHO203PV cell HyperCLDB: cl750 CHO204PV CHO204PV cell HyperCLDB: cl751 CHO205PV CHO205PV cell HyperCLDB: cl752 CHO211PV CHO211PV cell HyperCLDB: cl753 CHO23PV CHO23PV cell HyperCLDB: cl754 CHO2PV CHO2PV cell HyperCLDB: cl755 CHO302PV CHO302PV cell HyperCLDB: cl756 CHO30PV CHO30PV cell HyperCLDB: cl757 CHO33RO CHO33RO cell HyperCLDB: cl758 CHO3PV CHO3PV cell HyperCLDB: cl759 CHO40PV CHO40PV cell HyperCLDB: cl760 CHO421PV CHO421PV cell HyperCLDB: cl761 CHO423PV CHO423PV cell HyperCLDB: cl762 CHO43RO CHO43RO cell HyperCLDB: cl763 CHO4PV CHO4PV cell HyperCLDB: cl764 CHO50PV CHO50PV cell HyperCLDB: cl765 CHO51PV CHO51PV cell HyperCLDB: cl766 CHO5PV CHO5PV cell HyperCLDB: cl767 CHO60PV CHO60PV cell HyperCLDB: cl768 CHO7PV CHO7PV cell HyperCLDB: cl769 CHO9PV CHO9PV cell HyperCLDB: cl770 CHO-CD36 disease: produces human CD36 CHO-CD36 cell ATCC: CRL-2092 CHO-DHFR - CHO-DHFR - cell HyperCLDB: cl729 CHO-ICAM-1 disease: produces human ICAM-1 CHO-ICAM-1 cell ATCC: CRL-2093 CHO-K1 CHO-K1 cell ATCC: CCL-61 CHO-K1 CHO-K1 cell ATCC: CRL-9618 CHO-K1/SF CHO-K1/SF cell HyperCLDB: cl742 CHO-SSR1 CHO-SSR1 cell HyperCLDB: cl4905 CHO-SSR2 CHO-SSR2 cell HyperCLDB: cl4906 CHP 212 CHP 212 cell HyperCLDB: cl771 CHP 3 CHP 3 cell HyperCLDB: cl772 CHP 3 (M.W.) disease: galactosemia; galactose-1-phosphate uridyl transferase deficient CHP 3 (M.W.) cell ATCC: CCL-132 CHP 4 disease: galactosemia; galactose-1-phosphate uridyl transferase deficient CHP 4 cell ATCC: CCL-133 CHP 4 (W.W.) CHP 4 (W.W.) cell HyperCLDB: cl778 LCL-1973 CHP-126 CHP-126 cell CHEMBL: CHEMBL3308252 CVCL: CVCL_1123 DSMZ: ACC 304 HyperCLDB: cl776 LCL-1964 CHP-212 CHP-212 cell CHSE 214 CHSE 214 cell HyperCLDB: cl779 CHSE-214 CHSE-214 cell ATCC: CRL-1681 CIA-E-4.15 disease: hybridoma CIA-E-4.15 cell ATCC: HB-235 CIA-E-7.12 disease: hybridoma CIA-E-7.12 cell ATCC: HB-236 CII CII cell HyperCLDB: cl781 CII3 CII3 cell HyperCLDB: cl782 Citrullinemia Citrullinemia cell HyperCLDB: cl783 citrullinemia citrullinemia cell ATCC: CCL-76 CKMM 14.15 disease: hybridoma CKMM 14.15 cell ATCC: HB-9419 CKMM 14.5 disease: hybridoma CKMM 14.5 cell ATCC: HB-9420 CKMM 14.52 disease: hybridoma CKMM 14.52 cell ATCC: HB-9421 Cl. Ly1+2–/9 Cl. Ly1+2–/9 cell ATCC: CRL-8179 CL-1 CL-1 cell HyperCLDB: cl784 CL18/6 disease: hybridoma CL18/6 cell ATCC: CRL-2518 CL2 disease: hybridoma CL2 cell ATCC: CRL-2514 CL3 disease: hybridoma CL3 cell ATCC: CRL-2515 CL37 disease: hybridoma CL37 cell ATCC: CRL-2516 CL95 CL95 cell HyperCLDB: cl788 CL96f CL96f cell HyperCLDB: cl789 CL96IL2 CL96IL2 cell HyperCLDB: cl790 CLC CLC cell HyperCLDB: cl791 CLM96M CLM96M cell HyperCLDB: cl792 CLN CLN cell ATCC: CRL-6245 CLN H11.4 disease: hybridoma CLN H11.4 cell ATCC: HB-8307 CLNH5.5 disease: hybridoma CLNH5.5 cell ATCC: HB-8206 LCL-1081 Clone 15 HL-60 disease: promyeloblast; acute promyelocytic leukemia Clone 15 HL-60 cell ATCC: CRL-1964 CRL-1964 Clone 1-5c-4 Clone 1-5c-4 cell ATCC: CCL-20.2 Clone 1-5c-4 WKD of Chang Conjunctiva Clone 1-5c-4 WKD of Chang Conjunctiva cell HyperCLDB: cl793 Clone 707 disease: leukemia, Friend Clone 707 cell HyperCLDB: cl796 Clone 81 Clone 81 cell HyperCLDB: cl797 Clone 9 Clone 9 cell ATCC: CRL-1439 Clone C Clone C cell ATCC: CRL-2531 Clone C6/36 Clone C6/36 cell HyperCLDB: cl799 Clone D Clone D cell HyperCLDB: cl800 Clone H Clone H cell HyperCLDB: cl801 Clone I Clone I cell HyperCLDB: cl802 Clone L Clone L cell HyperCLDB: cl803 Clone M-3 Clone M-3 cell ATCC: CCL-53.1 CL-S1 disease: premalignant CL-S1 cell ATCC: CRL-1615 CLT 152 disease: hybridoma CLT 152 cell ATCC: HB-8244 CLT 85 disease: hybridoma CLT 85 cell ATCC: HB-8240 CM86 CM86 cell HyperCLDB: cl807 CM87 CM87 cell HyperCLDB: cl808 C-M87 C-M87 cell HyperCLDB: cl533 CM87IL2 CM87IL2 cell HyperCLDB: cl809 CM88M CM88M cell HyperCLDB: cl810 CM91IL2 CM91IL2 cell HyperCLDB: cl811 CM91ls CM91ls cell HyperCLDB: cl812 C-M92 C-M92 cell HyperCLDB: cl534 CM94 CM94 cell HyperCLDB: cl813 CM94P CM94P cell HyperCLDB: cl814 CMH1a CMH1a cell ATCC: CRL-8399 LCL-1051 CMK CMK cell CVCL: CVCL_0216 DSMZ: ACC 392 EFO: EFO_0003037 HyperCLDB: cl5042 CML-T1 disease: leukemia, T cell CML-T1 cell HyperCLDB: cl815 CMMT CMMT cell ATCC: CRL-6299 CMR94M CMR94M cell HyperCLDB: cl816 CMT 93 CMT 93 cell HyperCLDB: cl817 CMT64/61 CMT64/61 cell HyperCLDB: cl819 CMT-93 disease: polyploid carcinoma CMT-93 cell ATCC: CCL-223 CMT93/69 CMT93/69 cell HyperCLDB: cl820 C-N90 C-N90 cell HyperCLDB: cl535 C-N95 C-N95 cell HyperCLDB: cl536 CN96 CN96 cell HyperCLDB: cl821 CNC 127I disease: mammary tumor CNC 127I cell HyperCLDB: cl822 CO 88BV59-1 CO 88BV59-1 cell ATCC: CRL-10624 Co88BV59H21-2 Co88BV59H21-2 cell ATCC: CRL-11538 Co88BV59H21-2V67-66 Co88BV59H21-2V67-66 cell ATCC: CRL-11539 COL-10 COL-10 cell HyperCLDB: cl823 COL-7 COL-7 cell HyperCLDB: cl824 LCL-1172 COLO 201 disease: colorectal adenocarcinoma (colon primary) COLO 201 cell ATCC: CCL-224 ECACC: 87091201 LCL-1173 COLO 205 disease: colorectal adenocarcinoma (colon primary) COLO 205 cell ATCC: CCL-222 CHEMBL: CHEMBL3308348 CVCL: CVCL_0218 ECACC: 87061208 EFO: EFO_0003082 COLO 320 DMF COLO 320 DMF cell HyperCLDB: cl830 HyperCLDB: cl831 LCL-1197 COLO 320DM disease: colorectal adenocarcinoma COLO 320DM cell ATCC: CCL-220 CHEMBL: CHEMBL3307647 CVCL: CVCL_0219 EFO: EFO_0002136 COLO 320HSR disease: colorectal adenocarcinoma COLO 320HSR cell ATCC: CCL-220.1 COLO 357 COLO 357 cell HyperCLDB: cl5052 COLO 668 disease: carcinoma, oat cell COLO 668 cell HyperCLDB: cl835 COLO 677 COLO 677 cell HyperCLDB: cl837 HyperCLDB: cl838 LCL-1232 Derived from a melanoma of a 47 year old female. CHEMBL: CHEMBL3308723 COLO 679 COLO-679 COLO679 DSMZ: ACC 264 EFO: EFO_0006372 http://bioinformatics.hsanmartino.it/hypercldb/cl840.html http://www.sigmaaldrich.com/catalog/product/sigma/87061210?lang=en&region=US COLO 679 cell HyperCLDB: cl839 HyperCLDB: cl840 LINCS_HMS: 50011 RRID:CVCL_1130 LCL-1504 COLO 684 COLO 684 cell ECACC: 87061203 HyperCLDB: cl841 COLO 685 COLO 685 cell HyperCLDB: cl842 COLO 699 N disease: lung cancer COLO 699 N cell HyperCLDB: cl843 COLO 699N COLO 699N cell HyperCLDB: cl844 COLO 720 E disease: adenocarcinoma, ovary COLO 720 E cell HyperCLDB: cl845 COLO 720 L COLO 720 L cell HyperCLDB: Cl847 HyperCLDB: cl846 LCL-1158 COLO 741 disease: carcinoma, colon COLO 741 cell ECACC: 93052621 HyperCLDB: cl848 COLO 775 disease: leukemia COLO 775 cell HyperCLDB: cl850 LCL-1239 COLO 792 disease: malignant melanoma COLO 792 cell ECACC: 93052616 HyperCLDB: cl851 COLO 800 duplicate. See http://purl.obolibrary.org/obo/CLO_0037121 obsolete: COLO 800 cell HyperCLDB: cl852 HyperCLDB: cl853 COLO 818 COLO 818 cell HyperCLDB: cl169 HyperCLDB: cl855 COLO 829 disease: malignant melanoma COLO 829 cell ATCC: CRL-1974 COLO 829BL COLO 829BL cell ATCC: CRL-1980 COLO 832 COLO 832 cell HyperCLDB: cl857 COLO 839 COLO 839 cell HyperCLDB: cl858 LCL-1240 COLO 853 COLO 853 cell ECACC: 93052606 HyperCLDB: cl859 LCL-1241 COLO 857 COLO 857 cell ECACC: 93051120 HyperCLDB: cl861 LCL-1242 COLO 858 COLO 858 cell ECACC: 93052613 HyperCLDB: cl862 LCL-1159 COLO-206F COLO-206F cell DSMZ: ACC 21 HyperCLDB: cl864 LCL-1174 COLO-320 COLO-320 cell DSMZ: ACC 144 HyperCLDB: cl828 LCL-1160 COLO-678 COLO-678 cell CVCL: CVCL_1129 DSMZ: ACC 194 HyperCLDB: cl865 LCL-1551 COLO-680N disease: carcinoma, squamous cell COLO-680N cell CHEMBL: CHEMBL3308724 CVCL: CVCL_1131 DSMZ: ACC 182 HyperCLDB: cl866 COLO-699 COLO-699 cell HyperCLDB: cl868 LCL-1531 COLO-704 COLO-704 cell DSMZ: ACC 198 HyperCLDB: cl869 LCL-1243 COLO-783 COLO-783 cell DSMZ: ACC 257 HyperCLDB: cl5043 LCL-1477 COLO-824 COLO-824 cell CHEMBL: CHEMBL3308725 CVCL: CVCL_1136 DSMZ: ACC 200 HyperCLDB: cl870 LCL-1245 COLO-849 COLO-849 cell DSMZ: ACC 216 HyperCLDB: cl872 CON.1 disease: hybridoma CON.1 cell ATCC: CRL-2229 ConA-B1-VICK disease: T lymphocyte; transformed with REV-T; produces G-CSF ConA-B1-VICK cell ATCC: CRL-12357 ConA-C1-VICK disease: T lymphocyte; transformed with REV-T: produces G-CSF ConA-C1-VICK cell ATCC: CRL-12135 Cor Per Cor Per cell HyperCLDB: cl875 LCL-1779 COR-L 23/CPR disease: carcinoma, large cell COR-L 23/CPR cell ECACC: 96042336 HyperCLDB: cl5053 COR-L105 COR-L105 cell HyperCLDB: cl876 LCL-1780 COR-L23 disease: carcinoma, large cell COR-L23 cell CHEMBL: CHEMBL3308073 CVCL: CVCL_1139 ECACC: 92031919 EFO: EFO_0002142 HyperCLDB: cl877 COR-L23/5010 disease: carcinoma, large cell COR-L23/5010 cell HyperCLDB: cl5054 COR-L23/R disease: carcinoma, Lewis lung COR-L23/R cell HyperCLDB: cl5055 COR-L24 disease: carcinoma, small cell COR-L24 cell HyperCLDB: cl879 LCL-1825 COR-L279 disease: carcinoma, small cell COR-L279 cell CHEMBL: CHEMBL3308549 CVCL: CVCL_1140 ECACC: 96020724 HyperCLDB: cl880 COR-L283R COR-L283R cell HyperCLDB: cl5056 COR-L311 disease: carcinoma, small cell COR-L311 cell HyperCLDB: cl881 COR-L47 disease: carcinoma, lung small cell COR-L47 cell HyperCLDB: cl882 LCL-1826 COR-L51 disease: carcinoma, lung small cell COR-L51 cell ECACC: 92031916,92031916; COSMIC ID:910555 HyperCLDB: cl883 LCL-1827 COR-L88 disease: carcinoma, lung small cell COR-L88 cell CHEMBL: CHEMBL3308865 CVCL: CVCL_1141 ECACC: 92031917 HyperCLDB: cl884 LCL-1828 COR-L95 disease: carcinoma, small cell COR-L95 cell ECACC: 96020733 HyperCLDB: cl5057 COS-1 COS-1 cell ATCC: CRL-1650 MeSH: D019556 COS-7 COS-7 cell ATCC: CRL-1651 MeSH: D019556 CP132 CP132 cell HyperCLDB: cl894 CPA CPA cell HyperCLDB: cl895 CPA 47 disease: vascular endothelium CPA 47 cell ATCC: CRL-1733 CPAE CPAE cell ATCC: CCL-209 LCL-1829 CPC-N disease: carcinoma, small cell CPC-N cell CHEMBL: CHEMBL3308830 CVCL: CVCL_1146 DSMZ: ACC 306 HyperCLDB: cl5044 CR83 CR83 cell HyperCLDB: cl902 CR86 CR86 cell HyperCLDB: cl903 CR88P CR88P cell HyperCLDB: cl904 CR96 CR96 cell HyperCLDB: cl905 CRE BAG 2 disease: produces a retrovirus containing the beta-galactosidase gene CRE BAG 2 cell ATCC: CRL-1858 CRE BAG2 CRE BAG2 cell HyperCLDB: cl906 CRFK CRFK cell ATCC: CCL-94 CRFK (BVD Ag negative) CRFK (BVD Ag negative) cell HyperCLDB: cl909 Cri du Chat disease: Cri du Chat syndrome Cri du Chat cell ATCC: CCL-90 CRI-10P CRI-10P cell HyperCLDB: cl911 CRI-D11 disease: islet tumor CRI-D11 cell HyperCLDB: cl912 CRI-D2 CRI-D2 cell HyperCLDB: cl913 CRI-G1 disease: islet tumor CRI-G1 cell HyperCLDB: cl914 CRI-G5 disease: islet tumor CRI-G5 cell HyperCLDB: cl915 CRO-AP2 CRO-AP2 cell HyperCLDB: cl3486 CRO-AP3 CRO-AP3 cell HyperCLDB: cl5045 CRO-AP5 CRO-AP5 cell HyperCLDB: cl420 CS191 CS191 cell HyperCLDB: cl916 CS1PV CS1PV cell HyperCLDB: cl917 CS87 CS87 cell HyperCLDB: cl918 C-S91a C-S91a cell HyperCLDB: cl537 C-S95 C-S95 cell HyperCLDB: cl539 CS96 CS96 cell HyperCLDB: cl919 CSE 119 CSE 119 cell HyperCLDB: cl920 CSE-119 CSE-119 cell HyperCLDB: cl5058 CSMaß1H CSMaß1H cell ATCC: CRL-8401 CSMaß6C CSMaß6C cell ATCC: CRL-8400 CT26.CL25 disease: carcinoma; model for testing immunotherapy protocols in vivo CT26.CL25 cell ATCC: CRL-2639 CT26.WT disease: carcinoma; model for testing immunotherapy protocols in vivo CT26.WT cell ATCC: CRL-2638 CT6-1D7 disease: hybridoma CT6-1D7 cell ATCC: CRL-2438 CT96 CT96 cell HyperCLDB: cl923 CTLA4 Ig-24 disease: expresses CTLA4Ig fusion protein CTLA4 Ig-24 cell ATCC: CRL-10762 CTLL CTLL cell HyperCLDB: cl926 CTLL-2 disease: cytotoxic CTLL-2 cell ATCC: TIB-214 CTPS disease: papilloma CTPS cell ATCC: CRL-6496 LCL-1013 CTV-1 CTV-1 cell CHEMBL: CHEMBL3308189 CVCL: CVCL_1150 DSMZ: ACC 40 HyperCLDB: cl927 CTX TNA2 disease: SV40 transfected CTX TNA2 cell ATCC: CRL-2006 CV-1 CV-1 cell ATCC: CCL-70 HyperCLDB: cl929 CV-1 Clone B5 CV-1 Clone B5 cell HyperCLDB: cl935 CV-1/EBNA-1 disease: EBNA-1 expression CV-1/EBNA-1 cell ATCC: CRL-10478 CV96F CV96F cell HyperCLDB: cl937 CVC 7 Possible typographic error in 'Organism' field (value 'Agrothis segetum') to be considered as 'Agrotis segetum' (NCBI_Taxon: 47767) [SS] disease: hybridoma CVC 7 cell HyperCLDB: cl5180 CVC.1 disease: hybridoma CVC.1 cell ATCC: TIB-135 CVC.4 disease: hybridoma CVC.4 cell ATCC: TIB-137 CVC.7 disease: hybridoma CVC.7 cell ATCC: TIB-138 CVD89M CVD89M cell HyperCLDB: cl938 CW13.20-3B3 (clone of BCL 1) disease: leukemia CW13.20-3B3 (clone of BCL 1) cell ATCC: CRL-1669 CX-1 CX-1 cell HyperCLDB: cl939 Cy34.1.2 disease: hybridoma Cy34.1.2 cell ATCC: TIB-163 CYNOM-K1 CYNOM-K1 cell HyperCLDB: cl952 Cyt c–/– Cyt c–/– cell ATCC: CRL-2613 D 14 disease: hybridoma D 14 cell ATCC: HB-8439 D 17 disease: sarcoma, osteogenic D 17 cell HyperCLDB: cl954 D0994 D0994 cell HyperCLDB: cl967 D1 ORL UVA disease: multipotent stromal precursor D1 ORL UVA cell ATCC: CRL-12424 D1.1 disease: acute T cell leukemia; CD4 negative D1.1 cell ATCC: CRL-10915 D10.G4.1 D10.G4.1 cell ATCC: TIB-224 D-11 D-11 cell HyperCLDB: cl953 D12/DM disease: thymoma D12/DM cell HyperCLDB: cl970 D1-4G2-4-15 disease: hybridoma D1-4G2-4-15 cell ATCC: HB-112 D1589 D1589 cell HyperCLDB: cl971 D17 D17 cell ATCC: CRL-6248 D17 D17 cell ATCC: CRL-8468 D-17 disease: osteosarcoma (bone primary) D-17 cell ATCC: CCL-183 D1B disease: leukemia D1B cell ATCC: TIB-56 D2 D2 cell HyperCLDB: cl972 D2085 D2085 cell HyperCLDB: cl973 D2187 D2187 cell HyperCLDB: cl974 D22 D22 cell ATCC: CRL-6250 D24 disease: hybridoma D24 cell ATCC: CRL-2701 LCL-1577 ZN D283 Med disease: medulloblastoma (cerebellum primary) D283 Med cell ATCC: HTB-185 D2N disease: leukemia D2N cell ATCC: TIB-58 D3 D3 cell HyperCLDB: cl5046 D3-2H2-9-21 disease: hybridoma D3-2H2-9-21 cell ATCC: HB-114 D341 Med https://www.atcc.org/products/all/HTB-187.aspx disease: medulloblastoma D341 Med cell ATCC: HTB-187 D-36 D-36 cell HyperCLDB: cl956 D5 D5 cell HyperCLDB: cl975 D8/17 disease: hybridoma D8/17 cell ATCC: HB-8783 D94 D94 cell HyperCLDB: cl976 D96 D96 cell HyperCLDB: cl977 D98/AH2 Clone B disease: carcinoma, cervical D98/AH2 Clone B cell HyperCLDB: cl978 Da Bon disease: osteogenesis imperfecta (tarda) Da Bon cell ATCC: CRL-1251 Da Cav disease: stiff skin syndrome Da Cav cell ATCC: CRL-1388 Da Hol disease: Ehlers-Danlos syndrome, variant type Da Hol cell ATCC: CRL-1379 Da Mo disease: Ehlers-Danlos syndrome, type V Da Mo cell ATCC: CRL-1383 DA-1 DA-1 cell HyperCLDB: cl980 DA4-4 disease: hybridoma DA4-4 cell ATCC: HB-57 D-A92a D-A92a cell HyperCLDB: cl957 D-A92f D-A92f cell HyperCLDB: cl958 DA94 DA94 cell HyperCLDB: cl981 DAKIKI DAKIKI cell ATCC: TIB-206 DAL K20 disease: hybridoma DAL K20 cell ATCC: CRL-2288 DAL K29 disease: hybridoma DAL K29 cell ATCC: CRL-2291 DAL K45 disease: hybridoma DAL K45 cell ATCC: CRL-2292 DAN disease: amphotropic retroviral packaging line DAN cell ATCC: CRL-2130 LCL-1734 DAN-G DAN-G cell CHEMBL: CHEMBL3307281 CVCL: CVCL_0243 DSMZ: ACC 249 HyperCLDB: cl982 LCL-1576 ZN Daoy disease: desmoplastic cerebellar medulloblastoma Daoy cell ATCC: HTB-186 CHEMBL: CHEMBL3308510 CVCL: CVCL_1167 DAP-3 DR1 DAP-3 DR1 cell HyperCLDB: cl984 DAP-3 DR4 DAP-3 DR4 cell HyperCLDB: cl985 DAP-3DPw2 DAP-3DPw2 cell HyperCLDB: cl986 DAP-3DQ1 DAP-3DQ1 cell HyperCLDB: cl987 DAP-3DR2a DAP-3DR2a cell HyperCLDB: cl988 DAP-3DR2b DAP-3DR2b cell HyperCLDB: cl989 DAP-3DRw52b DAP-3DRw52b cell HyperCLDB: cl990 DATK32 disease: hybridoma DATK32 cell ATCC: HB-294 LCL-2018 Daudi Daudi cell ATCC: CCL-213 CHEMBL: CHEMBL3307579 CVCL: CVCL_0008 EFO: EFO_0002169 HyperCLDB: cl995 LCL-1119 DB disease: large cell lymphoma DB cell ATCC: CRL-2289 CHEMBL: CHEMBL3308866 CVCL: CVCL_1168 EFO: EFO_0002158 DB 9 G.8 disease: hybridoma DB 9 G.8 cell HyperCLDB: cl5182 DB1-Tes DB1-Tes cell HyperCLDB: cl5183 D-B87 D-B87 cell HyperCLDB: cl959 DB9G8 disease: hybridoma DB9G8 cell ATCC: HB-124 DBA A.Sp DBA A.Sp cell ATCC: CRL-6340 DBA C.Sp DBA C.Sp cell ATCC: CRL-6342 DBC95 DBC95 cell HyperCLDB: cl1001 DBM96 DBM96 cell HyperCLDB: cl1002 DB-R95 DB-R95 cell HyperCLDB: cl1000 DBS-FCL-1 DBS-FCL-1 cell ATCC: CCL-161 DBS-FCL-2 DBS-FCL-2 cell ATCC: CCL-162 DBS-FRhL-2 DBS-FRhL-2 cell ATCC: CL-160 DBTRG.05MG disease: glioblastoma multiforme DBTRG.05MG cell HyperCLDB: cl1005 LCL-1349 DBTRG-05MG disease: glioblastoma DBTRG-05MG cell ATCC: CRL-2020 CHEMBL: CHEMBL3308485 CVCL: CVCL_1169 EFO: EFO_0002159 DBV95 DBV95 cell HyperCLDB: cl1007 DC101 disease: hybridoma DC101 cell ATCC: HB-11534 D-C95 D-C95 cell HyperCLDB: cl960 DC96 DC96 cell HyperCLDB: cl1009 DCi96 DCi96 cell HyperCLDB: cl1010 DCo96 DCo96 cell HyperCLDB: cl1011 DCon96 DCon96 cell HyperCLDB: cl1012 DC-P87 DC-P87 cell HyperCLDB: cl1008 DD-4 disease: hybridoma DD-4 cell ATCC: HB-9743 DDC95 DDC95 cell HyperCLDB: cl1013 DDT subscript(1) MF-2 disease: leiomyosarcoma DDT subscript(1) MF-2 cell ATCC: CRL-1701 DDT subscript(1)-MF-2 disease: leiomyosarcoma DDT subscript(1)-MF-2 cell ATCC: CRL-12051 DDT1-MF2 disease: leiomyosarcoma DDT1-MF2 cell HyperCLDB: cl1014 De FOW De FOW cell HyperCLDB: cl1015 De Te disease: Marfan syndrome De Te cell ATCC: CRL-1249 DE96P DE96P cell HyperCLDB: cl1016 DEC-205 disease: hybridoma DEC-205 cell ATCC: HB-290 Dede Dede cell ATCC: CCL-39 HyperCLDB: cl1017 HyperCLDB: cl1018 DEL DEL cell HyperCLDB: cl5261 Dempsey disease: Klinefelter syndrome Dempsey cell ATCC: CCL-28 Detroit 510 Detroit 510 cell ATCC: CCL-72 Detroit 525 disease: Turner syndrome Detroit 525 cell ATCC: CCL-65 Detroit 529 disease: Down syndrome Detroit 529 cell ATCC: CCL-66 Detroit 532 disease: Down syndrome Detroit 532 cell ATCC: CCL-54 Detroit 539 disease: Down syndrome Detroit 539 cell ATCC: CCL-84 Detroit 548 Detroit 548 cell ATCC: CCL-116 Detroit 550 Detroit 550 cell HyperCLDB: cl1032 Detroit 551 Detroit 551 cell ATCC: CCL-110 LCL-1226 Detroit 562 https://www.atcc.org/products/all/CCL-138.aspx disease: carcinoma (pharynx primary) Detroit 562 cell ATCC: CCL-138 CHEMBL: CHEMBL3308486 CVCL: CVCL_1171 ECACC: 87042205 EFO: EFO_0002170 Detroit 573 Detroit 573 cell ATCC: CCL-117 Detroit 6 Detroit 6 cell HyperCLDB: cl1039 DF DF cell HyperCLDB: cl1041 D-F92 D-F92 cell HyperCLDB: cl961 D-F94 D-F94 cell HyperCLDB: cl962 DFA96M DFA96M cell HyperCLDB: cl1042 DFC96 DFC96 cell HyperCLDB: cl1043 DFF87 DFF87 cell HyperCLDB: cl1044 DFGe96 DFGe96 cell HyperCLDB: cl1045 DFGi96 DFGi96 cell HyperCLDB: cl1046 DFK3 DFK3 cell HyperCLDB: cl1047 DG 1 disease: carcinoma, bronchogenic large cell DG 1 cell HyperCLDB: cl1048 DG 2 disease: carcinoma, bronchogenic large cell DG 2 cell HyperCLDB: cl1049 DG 3 disease: carcinoma, bronchogenic large cell DG 3 cell HyperCLDB: cl1050 LCL-2019 DG-75 DG-75 cell ATCC: CRL-2625 CHEMBL: CHEMBL3308527 CVCL: CVCL_0244 HyperCLDB: cl1051 D-G92 D-G92 cell HyperCLDB: cl963 DG96 DG96 cell HyperCLDB: cl1052 Dh 14 Possible typographic error in 'Organism' field (value 'Drosophila, hydnei') to be considered as 'Drosophila hydnei' (NCBI_Taxon: 7224) [SS] Dh 14 cell HyperCLDB: cl1053 Dh 33 Possible typographic error in 'Organism' field (value 'Drosophila, hydnei') to be considered as 'Drosophila hydnei' (NCBI_Taxon: 7224) [SS] Dh 33 cell HyperCLDB: cl1054 DH14 DH14 cell HyperCLDB: cl1055 DH15 DH15 cell HyperCLDB: cl1056 DH33 DH33 cell HyperCLDB: cl1057 DH82 disease: malignant DH82 cell ATCC: CRL-10389 DH82ECOK disease: malignant DH82ECOK cell ATCC: CRL-10390 DHD/K12/TRb DHD/K12/TRb cell HyperCLDB: cl1060 DHFR-G8 disease: expresses her2/neu DHFR-G8 cell ATCC: CRL-1915 DI TNC subscript(1) disease: SV40 transfected DI TNC subscript(1) cell ATCC: CRL-2005 DII 33.1 disease: hybridoma DII 33.1 cell ATCC: CRL-1827 DK DK cell HyperCLDB: cl1061 LCL-1350 ZN DK-MG DK-MG cell CHEMBL: CHEMBL3308814 CVCL: CVCL_1173 DSMZ: ACC 277 EFO: EFO_0002161 HyperCLDB: cl5262 DL86 DL86 cell HyperCLDB: cl1063 DL87 DL87 cell HyperCLDB: cl1064 LCL-1175 DLD-1 disease: colorectal adenocarcinoma DLD-1 cell ATCC: CCL-221 CHEMBL: CHEMBL3307580 CVCL: CVCL_0248 DLF87 DLF87 cell HyperCLDB: cl1067 DLG96f DLG96f cell HyperCLDB: cl1068 DLG96IL2 DLG96IL2 cell HyperCLDB: cl1069 DLL87S DLL87S cell HyperCLDB: cl1070 DM-15 DM-15 cell HyperCLDB: cl1071 D-M89 D-M89 cell HyperCLDB: cl964 DM94 DM94 cell HyperCLDB: cl1074 DMBM-2 DMBM-2 cell HyperCLDB: cl1075 DMM87 DMM87 cell HyperCLDB: cl1077 LCL-1830 DMS 114 disease: carcinoma; small cell lung cancer DMS 114 cell ATCC: CRL-2066 LCL-1831 DMS 153 disease: carcinoma; small cell lung cancer (lung primary) DMS 153 cell ATCC: CRL-2064 LCL-1807 DMS 273 disease: carcinoma, small cell DMS 273 cell ECACC: 95062830 HyperCLDB: cl1079 DMS 454 disease: carcinoma, small cell DMS 454 cell HyperCLDB: cl1080 LCL-1808 DMS 53 disease: carcinoma; small cell lung cancer DMS 53 cell ATCC: CRL-2062 LCL-1832 DMS 79 disease: carcinoma; small cell lung cancer DMS 79 cell ATCC: CRL-2049 DMS 92 disease: carcinoma, small cell DMS 92 cell HyperCLDB: cl1083 DMS-79 disease: carcinoma, small cell DMS-79 cell HyperCLDB: cl4907 DNI.Tr DNI.Tr cell ATCC: CRL-6009 DoCl1 (S+L–) DoCl1 (S+L–) cell ATCC: CCL-34.1 HyperCLDB: cl1085 DOHH2 DOHH2 cell HyperCLDB: cl1086 HyperCLDB: cl4974 DOK DOK cell HyperCLDB: cl1087 Don Don cell ATCC: CCL-16 HyperCLDB: cl1088 LCL-1303 DoTc2 4510 DoTc2 4510 cell ATCC: CRL-7920 DP-LL95 DP-LL95 cell HyperCLDB: cl1090 DPS84 DPS84 cell HyperCLDB: cl1091 DPSO 114/74 DPSO 114/74 cell ATCC: CCL-194 DPW 5 DPW 5 cell HyperCLDB: cl1093 DR 9 DR 9 cell HyperCLDB: cl1094 DR4 MEF disease: feeder layer DR4 MEF cell ATCC: SCRC-1045 D-R86 D-R86 cell HyperCLDB: cl965 DR89P DR89P cell HyperCLDB: cl1095 DREG200 disease: hybridoma DREG200 cell ATCC: HB-302 DREG56 disease: hybridoma DREG56 cell ATCC: HB-300 DRS DRS cell ATCC: CRL-6497 DS 92 DS 92 cell HyperCLDB: cl1097 DS-1 disease: hybridoma disease: lymphangiectasia (B lymphocyte primary); IL-6 dependent DS-1 cell ATCC: CRL-11102 DS-1 DS-1 cell ATCC: HB-8906 DS19 DS19 cell HyperCLDB: cl1100 DS22-4 DS22-4 cell HyperCLDB: cl1101 DS-3 disease: hybridoma DS-3 cell ATCC: HB-8651 DS-5 disease: hybridoma DS-5 cell ATCC: HB-8653 DS-6 disease: hybridoma DS-6 cell ATCC: HB-8652 DSDh disease: retroviral packaging line DSDh cell ATCC: CRL-2131 DS-G23 disease: erythroleukemia DS-G23 cell HyperCLDB: cl1098 DSH1PV DSH1PV cell HyperCLDB: cl1102 DSH2PV DSH2PV cell HyperCLDB: cl1103 DSH3PV DSH3PV cell HyperCLDB: cl1104 DSH4PV DSH4PV cell HyperCLDB: cl1105 DSL-6A/C1 DSL-6A/C1 cell ATCC: CRL-2132 HyperCLDB: cl5060 DSL-6B/C2 DSL-6B/C2 cell ATCC: CRL-2133 DSN disease: produces SNV helper virus DSN cell ATCC: CRL-9939 DT40 DT40 cell ATCC: CRL-2111 D-T93 D-T93 cell HyperCLDB: cl966 DT95 DT95 cell ATCC: CRL-2112 LCL-1146 DU 145 disease: carcinoma (prostate primary) DU 145 cell ATCC: HTB-81 DU1-29 disease: hybridoma DU1-29 cell ATCC: HB-263 LCL-1323 DU4475 disease: ductal carcinoma DU4475 cell ATCC: HTB-123 HyperCLDB: cl5264 Dubca Dubca cell ATCC: CRL-2276 Duck embryo Duck embryo cell ATCC: CCL-141 HyperCLDB: cl1112 DUKX B1 disease: production of mouse c-myc protein DUKX B1 cell ATCC: CRL-9010 DV68F DV68F cell ATCC: CRL-6345 LCL-1636 DV-90 DV90 DV-90 cell CHEMBL: CHEMBL3308729 CVCL: CVCL_1184 DSMZ: ACC 307 HyperCLDB: cl5265 DVA96 DVA96 cell HyperCLDB: cl1113 DXB-11 DXB-11 cell HyperCLDB: cl1114 E 20 disease: hybridoma E 20 cell ATCC: HB-8443 E 21 E 21 cell HyperCLDB: cl1115 E. Derm (NBL-6) E. Derm (NBL-6) cell ATCC: CCL-57 E.Derm E.Derm cell HyperCLDB: cl1117 E.G7-OVA E.G7-OVA cell ATCC: CRL-2113 E.H. IV disease: infectious mononucleosis E.H. IV cell ATCC: CCL-104 E.H.IV (Elaine IV) E.H.IV (Elaine IV) cell HyperCLDB: cl1120 E1 E1 cell HyperCLDB: cl1121 E13 161-7 disease: hybridoma E13 161-7 cell ATCC: HB-215 E1a E1a cell HyperCLDB: cl1122 E2 E2 cell HyperCLDB: cl1123 E3 E3 cell HyperCLDB: cl1124 E5ab2 E5ab2 cell HyperCLDB: cl1125 E5BB3IIA2 disease: hybridoma E5BB3IIA2 cell ATCC: HB-121 E6(2)2 disease: hybridoma E6(2)2 cell ATCC: HB-8172 E-8 disease: hybridoma E-8 cell ATCC: HB-10179 Ea.4 Possible typographic error in 'Organism' field (value 'insect - Estigmene agrea (saltmarsh catepillar)') to be considered as 'Estigmene agreai' (NCBI_Taxon: 56594) [SS] Ea.4 cell HyperCLDB: cl5114 EB disease: Ehlers-Danlos syndrome, variant type EB cell ATCC: CRL-1365 EB (JC) EB (JC) cell HyperCLDB: cl1126 EB-1 EB-1 cell HyperCLDB: cl1127 LCL-2030 EB1 disease: Burkitts lymphoma EB1 cell ATCC: HTB-60 EB176 (JC) EB176 (JC) cell HyperCLDB: cl1129 EB185 (JC) Possible mapping of 'Organism' field (value 'orangutang') via synonym of 'Pongo pygmaeus' (NCBI_Taxon: 9600) [SS] EB185 (JC) cell HyperCLDB: cl1130 LCL-2031 EB2 disease: Burkitts lymphoma (B lymphocyte primary) EB2 cell ATCC: HTB-61 CHEMBL: CHEMBL3308867 CVCL: CVCL_1186 EFO: EFO_0002173 LCL-2032 EB-3 disease: Burkitts lymphoma EB-3 cell ATCC: CCL-85 CHEMBL: CHEMBL3308824 CVCL: CVCL_1185 EBL EBL cell HyperCLDB: cl1131 EBTr EBTr cell HyperCLDB: cl1132 EBTr (NBL-4) EBTr (NBL-4) cell ATCC: CCL-44 EC EC cell HyperCLDB: cl1134 Ect1/E6E7 disease: HPV-16 E6/E7 transformed Ect1/E6E7 cell ATCC: CRL-2614 ECTC ECTC cell HyperCLDB: cl1135 ECV304 ECV304 cell HyperCLDB: cl5185 ECV-304 disease: carcinoma, urinary ECV-304 cell HyperCLDB: cl5266 ED1-19-1-6-5 disease: hybridoma ED1-19-1-6-5 cell ATCC: HB-90 EDS 100 EDS 100 cell HyperCLDB: cl1137 EDS 101 EDS 101 cell HyperCLDB: cl1138 EDS 105 EDS 105 cell HyperCLDB: cl1139 LCL-1494 EFE-184 EFE-184 cell CHEMBL: CHEMBL3308103 CVCL: CVCL_1191 DSMZ: ACC 230 HyperCLDB: cl1140 LCL-1311 EFM-19 EFM-19 cell CHEMBL: CHEMBL3308502 CVCL: CVCL_0253 DSMZ: ACC 231 EFO: EFO_0002175 HyperCLDB: cl1141 LCL-1478 ZN EFM-192A EFM-192A cell DSMZ: ACC 258 HyperCLDB: cl5267 LCL-1312 EFM-192B EFM-192B cell DSMZ: ACC 308 HyperCLDB: cl5268 LCL-1479 ZN EFM-192C EFM-192C cell DSMZ: ACC 311 HyperCLDB: cl5269 LCL-1515 EFO-21 EFO-21 cell CHEMBL: CHEMBL3308730 CVCL: CVCL_0029 DSMZ: ACC 235 HyperCLDB: cl1142 LCL-1521 EFO-27 EFO27 EFO-27 cell CHEMBL: CHEMBL3308134 CVCL: CVCL_1192 DSMZ: ACC 191 HyperCLDB: cl1143 EGC/PK060399egfr disease: enteroglial EGC/PK060399egfr cell ATCC: CRL-2690 LCL-1787 EGI-1 EGI-1 cell CHEMBL: CHEMBL3308731 CVCL: CVCL_1193 DSMZ: ACC 385 HyperCLDB: cl5270 EH/A44 EH/A44 cell HyperCLDB: cl1145 EH17a disease: hybridoma EH17a cell ATCC: CRL-2209 EH7a disease: hybridoma EH7a cell ATCC: CRL-2194 LCL-1085 EHEB EHEB cell ACC 67 CHEMBL: CHEMBL3308163 CVCL: CVCL_1194 HyperCLDB: cl1146 Ehrlich-Lettre ascites, strain E Ehrlich-Lettre ascites, strain E cell ATCC: CCL-77 HyperCLDB: cl1148 EHS EHS cell ATCC: CRL-2108 EHT EHT cell HyperCLDB: cl1150 EIAV 12E8.1 disease: hybridoma EIAV 12E8.1 cell ATCC: HB-8917 EIII EIII cell HyperCLDB: cl1151 EJ (MGH-U1) EJ (MGH-U1) cell HyperCLDB: cl1152 LCL-1704 EJ138 EJ138 cell ECACC: 85061108 HyperCLDB: cl1154 EJ-6-2-Bam-6a EJ-6-2-Bam-6a cell ATCC: CRL-1888 EJG disease: capillary endothelium EJG cell ATCC: CRL-8659 EKL EKL cell HyperCLDB: cl1156 EL 1 disease: macrophage; monocyte EL 1 cell ATCC: CRL-9854 EL 2 EL 2 cell HyperCLDB: cl1157 El Don disease: Ehlers-Danlos syndrome, type VII (arthrochalasia type) El Don cell ATCC: CRL-1149 immortal T cell line cell that is derived from blood T cells from mouse C57BL/6 inbred strain that has disease mouse lymphoma. EL4 WEB: http://web.expasy.org/cellosaurus/CVCL_0255 EL4 cell ATCC: TIB-39 RRID:CVCL_0255 EL4.BU disease: hybridoma fusion partner,T cell EL4.BU cell ATCC: TIB-40 EL4.BU.1.OUAr.1.1 EL4.BU.1.OUAr.1.1 cell ATCC: TIB-41 EL4.BU.OU6 disease: lymphoma, lymphoblastic EL4.BU.OU6 cell HyperCLDB: cl1161 EL4.IL-2 EL4.IL-2 cell ATCC: TIB-181 EL4.NOB-1 disease: lymphoma, lymphoblastic EL4.NOB-1 cell HyperCLDB: cl1162 ELM-I-1 ELM-I-1 cell HyperCLDB: cl1163 EL-NC-1S disease: hybridoma EL-NC-1S cell ATCC: HB-9647 Em Ar disease: Ehlers-Danlos syndrome, possible heterozygote Em Ar cell ATCC: CRL-1168 LCL-1112 EM-2 EM-2 cell CHEMBL: CHEMBL3308889 CVCL: CVCL_1196 EFO: EFO_0002176 HyperCLDB: cl1164 Sanger: COSMIC ID:906855 EM-3 disease: leukemia, chronic myeloid EM-3 cell HyperCLDB: cl1165 EM9 disease: defective in single strand break repair EM9 cell ATCC: CRL-1861 EML Cell Line, Clone 1 disease: lymphohematopoietic progenitor cell line\ EML Cell Line, Clone 1 cell ATCC: CRL-11691 EMT6 disease: mammary carcinoma EMT6 cell ATCC: CRL-2755 EN9F10 disease: hybridoma EN9F10 cell ATCC: CRL-2403 End1/E6E7 disease: HPV-16 E6/E7 transformed End1/E6E7 cell ATCC: CRL-2615 EOC 13.31 EOC 13.31 cell ATCC: CRL-2468 EOC 2 EOC 2 cell ATCC: CRL-2467 EOC 20 EOC 20 cell ATCC: CRL-2469 EOL-1 disease: leukemia, acute myeloid EOL-1 cell HyperCLDB: cl5271 EoL-1 cell disease: leukemia, eosinophilic EoL-1 cell cell HyperCLDB: cl1166 EOMA disease: microvascular endothelial cell model EOMA cell ATCC: CRL-2586 EOMA-GFP disease: microvascular endothelial cell model; expresses GFP EOMA-GFP cell ATCC: CRL-2587 LCL-2055 Eos-HL-60 Eos-HL-60 cell 96100920 HyperCLDB: cl5062 Ep 16 disease: hybridoma Ep 16 cell HyperCLDB: cl5187 Ep-16 disease: hybridoma Ep-16 cell ATCC: HB-155 E-P95 E-P95 cell HyperCLDB: cl1116 EPC disease: epithelioma EPC cell HyperCLDB: cl1167 EPI EPI cell HyperCLDB: cl1169 LCL-1581 EPLC-272H disease: carcinoma, epidermoid EPLC-272H cell CHEMBL: CHEMBL3308104 CVCL: CVCL_1197 DSMZ: ACC 383 HyperCLDB: cl5272 EPNT-5 EPNT-5 cell HyperCLDB: cl1170 ER4.7G.11 disease: hybridoma ER4.7G.11 cell ATCC: HB-11642 EREp EREp cell HyperCLDB: cl1172 ES-095 ES-095 cell HyperCLDB: cl1173 LCL-1806 ES-2 disease: clear cell carcinoma ES-2 cell ATCC: CRL-1978 ES-C57BL/6 ES-C57BL/6 cell ATCC: SCRC-1002 ES-D3 disease: pluripotent ES-D3 cell ATCC: CRL-11632 ES-D3 ES-D3 cell ATCC: CRL-1934 ES-D3 GL disease: germline competent ES-D3 GL cell ATCC: SCRC-1003 ES-E14TG2a disease: pluripotent; HGRPT deficient ES-E14TG2a cell ATCC: CRL-1821 ESK-4 ESK-4 cell ATCC: CL-184 LCL-1507 ESS-1 ESS-1 cell CHEMBL: CHEMBL3308384 CVCL: CVCL_1205 DSMZ: ACC 461 HyperCLDB: cl7098 LCL-1313 EVSA-T EVSA-T cell CHEMBL: CHEMBL3307361 CVCL: CVCL_1207 DSMZ: ACC 433 HyperCLDB: cl5273 EZZ (TOU II-4) EZZ (TOU II-4) cell HyperCLDB: cl1177 F.thy 62891 disease: immortalized with SV40 large T antigen F.thy 62891 cell ATCC: CRL-10936 F0091 F0091 cell HyperCLDB: cl1185 F0894 F0894 cell HyperCLDB: cl1186 F1 F1 cell HyperCLDB: cl1187 F1.652 disease: hybridoma F1.652 cell ATCC: CRL-2039 F11 F11 cell HyperCLDB: cl1188 F1187 F1187 cell HyperCLDB: cl1189 F11B F11B cell ATCC: CRL-6168 F1293 F1293 cell HyperCLDB: cl1190 F1-3G8-1 disease: hybridoma F1-3G8-1 cell ATCC: HB-192 F1-652 F1-652 cell HyperCLDB: cl5274 F1792 F1792 cell HyperCLDB: cl1191 F18 AF1 disease: hybridoma F18 AF1 cell ATCC: HB-8208 F19 disease: hybridoma F19 cell ATCC: CRL-2733 F1A3-23 disease: hybridoma F1A3-23 cell ATCC: HB-8207 F2 F2 cell HyperCLDB: cl1192 F21-1D3G7C8 disease: hybridoma F21-1D3G7C8 cell ATCC: HB-9463 F24 disease: hybridoma F24 cell ATCC: HB-9257 F25 disease: erythroleukemia F25 cell ATCC: CRL-6566 F2586 F2586 cell HyperCLDB: cl1193 F32 VIII C4 disease: hybridoma F32 VIII C4 cell ATCC: CRL-1653 F3B6 disease: hybridoma fusion partner F3B6 cell ATCC: HB-8785 F4/4.K6 F4/4.K6 cell HyperCLDB: cl1194 F4/80 disease: hybridoma F4/80 cell ATCC: HB-198 F45J disease: hybridoma F45J cell ATCC: HB-9740 F4N (MEL) F4N (MEL) cell HyperCLDB: cl5063 F5 F5 cell HyperCLDB: cl1195 F5-A-1/22.8.13 disease: hybridoma F5-A-1/22.8.13 cell ATCC: HB-8051 F7000 F7000 cell HyperCLDB: cl1196 F8 F8 cell ATCC: CRL-6074 F89 F89 cell HyperCLDB: cl1197 F9 disease: embryonic carcinoma; testicular teratoma F9 cell ATCC: CRL-1720 F94 F94 cell HyperCLDB: cl1203 F95 F95 cell HyperCLDB: cl1204 F96 F96 cell HyperCLDB: cl1205 F98 disease: undifferentiated malignant glioma F98 cell ATCC: CRL-2397 LCL-1201 FaDu disease: squamous cell carcinoma FaDu cell ATCC: HTB-43 CHEMBL: CHEMBL3307943 CVCL: CVCL_1218 EFO: EFO_0002178 FAK–/– FAK–/– cell ATCC: CRL-2644 FAK+/+ disease: positive for FAK but null for p53, integrin signalling pathway FAK+/+ cell ATCC: CRL-2645 Fao disease: hepatoma Fao cell HyperCLDB: cl1206 HyperCLDB: cl4908 LCL-1131 Farage disease: non-Hodgkins lymphoma Farage cell ATCC: CRL-2630 FAT 7 disease: squamous cell carcinoma FAT 7 cell ATCC: CRL-2109 FB2 disease: hybridoma FB2 cell ATCC: CRL-1891 FB2.K FB2.K cell ATCC: CRL-6033 FB2.Ln FB2.Ln cell ATCC: CRL-6034 FB2.Sp FB2.Sp cell HyperCLDB: cl1207 FB2.Thy FB2.Thy cell ATCC: CRL-6036 FB3.Ln FB3.Ln cell ATCC: CRL-6038 FB3.Thy FB3.Thy cell ATCC: CRL-6039 FB4.Ln FB4.Ln cell ATCC: CRL-6041 FB4.Sp/Thy FB4.Sp/Thy cell ATCC: CRL-6042 FB5.Bm FB5.Bm cell ATCC: CRL-6043 FB5.Ln FB5.Ln cell ATCC: CRL-6044 FB8H3 [Mab8H3] disease: hybridoma FB8H3 [Mab8H3] cell ATCC: CRL-2402 FBHE FBHE cell ATCC: CRL-1395 FBL-J5 FBL-J5 cell HyperCLDB: cl1210 FBT FBT cell HyperCLDB: cl1211 Fc 2 Lu Fc 2 Lu cell HyperCLDB: cl1213 Fc 3 Tg Fc 3 Tg cell HyperCLDB: cl1215 FC100.Ln FC100.Ln cell ATCC: CRL-6117 FC100.Sp FC100.Sp cell ATCC: CRL-6116 FC100.T FC100.T cell ATCC: CRL-6115 FC101 FC101 cell ATCC: CRL-6118 FC102 FC102 cell ATCC: CRL-6119 FC104.We FC104.We cell ATCC: CRL-6152 FC106.We FC106.We cell ATCC: CRL-6154 FC107.We FC107.We cell ATCC: CRL-6155 FC108.We FC108.We cell ATCC: CRL-6156 FC109.We FC109.We cell ATCC: CRL-6157 FC11.BM disease: reticulum cell sarcoma FC11.BM cell ATCC: CRL-6088 FC110.We FC110.We cell ATCC: CRL-6158 FC112 FC112 cell ATCC: CRL-6120 FC113 FC113 cell ATCC: CRL-6121 FC114E.Tr FC114E.Tr cell ATCC: CRL-6167 FC115.K FC115.K cell ATCC: CRL-6122 FC118 FC118 cell ATCC: CRL-6124 FC119 FC119 cell ATCC: CRL-6125 FC16.Sp FC16.Sp cell ATCC: CRL-6174 FC2.K FC2.K cell ATCC: CRL-6126 FC2.Lu FC2.Lu cell ATCC: CRL-6569 FC28.Lu FC28.Lu cell ATCC: CRL-6130 Fc2Lu Fc2Lu cell ATCC: CCL-217 Fc3Tg Fc3Tg cell ATCC: CCL-176 FC47 FC47 cell ATCC: CRL-6094 FC5.K FC5.K cell ATCC: CRL-6078 FC56.Thy FC56.Thy cell ATCC: CRL-6134 FC57.Thy FC57.Thy cell ATCC: CRL-6136 FC58.Thy FC58.Thy cell ATCC: CRL-6137 FC59.Thy FC59.Thy cell ATCC: CRL-6139 FC6.Bm FC6.Bm cell ATCC: CRL-6081 FC6.K FC6.K cell ATCC: CRL-6082 FC60(A).We FC60(A).We cell ATCC: CRL-6571 FC60(B).We FC60(B).We cell ATCC: CRL-6098 FC60A.We FC60A.We cell ATCC: CRL-6140 FC60B.We FC60B.We cell ATCC: CRL-6141 FC61 FC61 cell ATCC: CRL-6099 FC63.Res FC63.Res cell ATCC: CRL-6143 FC70.We FC70.We cell ATCC: CRL-6102 FC71A.We FC71A.We cell ATCC: CRL-6145 FC77.T disease: fibrosarcoma FC77.T cell ATCC: CRL-6105 FC79.We FC79.We cell ATCC: CRL-6106 FC81.Sp disease: fibrosarcoma FC81.Sp cell ATCC: CRL-6107 FC81.T disease: fibrosarcoma FC81.T cell ATCC: CRL-6108 FC81.Thy disease: fibrosarcoma FC81.Thy cell ATCC: CRL-6109 FC83.Res FC83.Res cell ATCC: CRL-6567 FC83.Sp disease: fibrosarcoma FC83.Sp cell ATCC: CRL-6110 F-C87 F-C87 cell HyperCLDB: cl1178 FC87.Sk FC87.Sk cell ATCC: CRL-6150 FC94.T disease: fibrosarcoma FC94.T cell ATCC: CRL-6113 FC95.Thy FC95.Thy cell ATCC: CRL-6114 FC96IL2 FC96IL2 cell HyperCLDB: cl1217 FC96ls FC96ls cell HyperCLDB: cl1218 Fcwf-4 disease: macrophage Fcwf-4 cell ATCC: CRL-2787 FD441.8 disease: hybridoma FD441.8 cell ATCC: TIB-213 F-D96 F-D96 cell HyperCLDB: cl1179 FDCP-1 FDCP-1 cell HyperCLDB: cl5275 FDC-P1 FDC-P1 cell ATCC: CRL-12103 FDCP-Mix cl.A4 FDCP-Mix cl.A4 cell HyperCLDB: cl5276 Fe Bos disease: Ehlers-Danlos syndrome, type II (hemorrhagic type) Fe Bos cell ATCC: CRL-1177 FE92 FE92 cell HyperCLDB: cl1219 FEA4 + PFSC/C1 FEA4 + PFSC/C1 cell HyperCLDB: cl1220 FEL FEL cell HyperCLDB: cl1221 FeLV 3281 FeLV 3281 cell HyperCLDB: cl1222 FeLV-3281 FeLV-3281 cell ATCC: CRL-9116 FER FER cell HyperCLDB: cl1223 Fer Ray Fer Ray cell HyperCLDB: cl1224