openapi: 3.1.0 info: title: EvolutionaryScale Forge ESM3 Embeddings API description: 'Hosted inference API for the ESM3 multimodal protein language model from EvolutionaryScale. ESM3 reasons jointly across sequence, structure, and function tracks. The Forge API exposes generate, batch_generate, encode, decode, forward_and_sample, and logits operations across small (1.4B), medium (7B), and large (98B) parameter checkpoints. All requests authenticate with a Forge API token obtained from forge.evolutionaryscale.ai. This OpenAPI is reconstructed from the open-source `esm` Python SDK (Biohub/esm) which is the canonical client for the Forge service. ' version: 2024-08-01 contact: name: EvolutionaryScale Forge url: https://forge.evolutionaryscale.ai license: name: Cambrian Inference Clickthrough License Agreement url: https://www.evolutionaryscale.ai/policies/cambrian-inference-clickthrough-license-agreement servers: - url: https://forge.evolutionaryscale.ai description: EvolutionaryScale Forge Production security: - BearerAuth: [] tags: - name: Embeddings description: Sequence-only tokenization and representation extraction. paths: /api/v1/esmc/encode: post: summary: Encode Protein Sequence With ESM C description: 'Tokenize an `ESMProtein` (sequence track only) into an `ESMProteinTensor` ready for logits / embedding retrieval. ESM C operates over the sequence track exclusively. ' operationId: esmcEncode tags: - Embeddings requestBody: required: true content: application/json: schema: $ref: '#/components/schemas/ESMCEncodeRequest' examples: SimpleEncode: $ref: '#/components/examples/SimpleEncodeExample' responses: '200': description: Sequence tensor for the supplied protein. content: application/json: schema: $ref: '#/components/schemas/ESMProteinTensor' 4XX: $ref: '#/components/responses/ErrorResponse' components: schemas: ESMCEncodeRequest: type: object required: - model - protein properties: model: type: string example: esmc-300m-2024-12 enum: - esmc-300m-2024-12 - esmc-600m-2024-12 - esmc-6b-2024-12 protein: $ref: '#/components/schemas/ESMProtein' Error: type: object properties: error: type: object properties: type: type: string message: type: string code: type: string ESMProtein: type: object properties: sequence: type: string description: Amino acid sequence using one-letter codes. example: MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ ESMProteinTensor: type: object properties: sequence: type: array items: type: integer examples: SimpleEncodeExample: summary: Encode a short protein sequence value: model: esmc-300m-2024-12 protein: sequence: AAAAA responses: ErrorResponse: description: Error returned by the Forge API. content: application/json: schema: $ref: '#/components/schemas/Error' securitySchemes: BearerAuth: type: http scheme: bearer description: Forge API token issued via forge.evolutionaryscale.ai.