openapi: 3.1.0 info: title: EvolutionaryScale Forge ESM3 Embeddings MSA API description: 'Hosted inference API for the ESM3 multimodal protein language model from EvolutionaryScale. ESM3 reasons jointly across sequence, structure, and function tracks. The Forge API exposes generate, batch_generate, encode, decode, forward_and_sample, and logits operations across small (1.4B), medium (7B), and large (98B) parameter checkpoints. All requests authenticate with a Forge API token obtained from forge.evolutionaryscale.ai. This OpenAPI is reconstructed from the open-source `esm` Python SDK (Biohub/esm) which is the canonical client for the Forge service. ' version: 2024-08-01 contact: name: EvolutionaryScale Forge url: https://forge.evolutionaryscale.ai license: name: Cambrian Inference Clickthrough License Agreement url: https://www.evolutionaryscale.ai/policies/cambrian-inference-clickthrough-license-agreement servers: - url: https://forge.evolutionaryscale.ai description: EvolutionaryScale Forge Production security: - BearerAuth: [] tags: - name: MSA description: Fetch multiple sequence alignments used by structure predictors. paths: /api/v1/msa: post: summary: Fetch Multiple Sequence Alignment description: 'Fetch a multiple sequence alignment (MSA) for the input sequence. The MSA can be passed into subsequent fold calls to improve accuracy. ' operationId: msa tags: - MSA requestBody: required: true content: application/json: schema: $ref: '#/components/schemas/MSARequest' responses: '200': description: MSA returned in A3M format and as a parsed list. content: application/json: schema: $ref: '#/components/schemas/MSAResponse' 4XX: $ref: '#/components/responses/ErrorResponse' components: schemas: MSARequest: type: object required: - sequence properties: sequence: type: string example: MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ max_depth: type: integer default: 256 MSAResponse: type: object properties: a3m: type: string description: MSA in A3M format. sequences: type: array items: type: string Error: type: object properties: error: type: object properties: type: type: string message: type: string code: type: string responses: ErrorResponse: description: Error returned by the Forge API. content: application/json: schema: $ref: '#/components/schemas/Error' securitySchemes: BearerAuth: type: http scheme: bearer description: Forge API token issued via forge.evolutionaryscale.ai.