--- name: "biopython-molecular-biology" description: "Molecular biology toolkit: sequence manipulation, FASTA/GenBank/PDB I/O, NCBI Entrez, BLAST automation, pairwise/MSA alignment, Bio.PDB, phylogenetic trees. Use for batch processing, custom pipelines, format conversion, PubMed/GenBank queries. For quick gene lookups use gget; for multi-service REST APIs use bioservices." license: "Biopython License (BSD-like)" --- # Biopython: Computational Molecular Biology Toolkit ## Overview Biopython is the standard open-source Python library for computational molecular biology, providing modular APIs for sequence handling, biological file parsing, NCBI database access, BLAST searches, protein structure analysis, and phylogenetics. It supports Python 3 and requires NumPy. ## When to Use - Parse and convert biological file formats (FASTA, GenBank, FASTQ, PDB, mmCIF, PHYLIP) - Fetch sequences or publications from NCBI databases (GenBank, PubMed, Protein) programmatically - Run and parse BLAST searches (remote NCBI or local BLAST+) - Perform pairwise or multiple sequence alignments with custom scoring - Analyze 3D protein structures — distances, angles, DSSP, superimposition - Build and visualize phylogenetic trees from sequence alignments - Calculate sequence statistics (GC content, molecular weight, melting temperature) - Batch-process thousands of sequences with custom filtering logic - Use `pysam` instead for reading SAM/BAM/CRAM alignment files and working with mapped reads; use `scikit-bio` instead for advanced ecological diversity metrics ## Prerequisites - **Python packages**: `biopython`, `numpy`, `matplotlib` (for tree visualization) - **Data requirements**: Sequence files (FASTA, GenBank, FASTQ) or accession IDs for NCBI access - **Environment**: Python 3.8+; NCBI Entrez requires email registration ```bash pip install biopython numpy matplotlib ``` ## Quick Start ```python from Bio import SeqIO from Bio.Seq import Seq from Bio.SeqUtils import gc_fraction # Parse a FASTA file and compute basic statistics records = list(SeqIO.parse("sequences.fasta", "fasta")) print(f"Sequences loaded: {len(records)}") seq = records[0].seq print(f"ID: {records[0].id}") print(f"Length: {len(seq)} bp") print(f"GC content: {gc_fraction(seq)*100:.1f}%") print(f"Reverse complement: {seq.reverse_complement()[:30]}...") print(f"Protein translation: {seq.translate()[:10]}...") ``` ## Core API ### Module 1: Sequence Objects (Bio.Seq) Create and manipulate DNA, RNA, and protein sequences. ```python from Bio.Seq import Seq # Create sequence and perform standard operations dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG") print(f"Length: {len(dna)} bp") print(f"Complement: {dna.complement()}") print(f"Reverse complement: {dna.reverse_complement()}") print(f"Transcription: {dna.transcribe()}") print(f"Translation: {dna.translate()}") print(f"Translation (to stop): {dna.translate(to_stop=True)}") # Length: 39 bp # Translation: MAIVMGR*KGAR* # Translation (to stop): MAIVMGR ``` ```python from Bio.Seq import Seq # Alternative genetic codes (e.g., mitochondrial) mito_dna = Seq("ATGGCCATTGTAATGGGCCGCTGA") std_protein = mito_dna.translate(table=1) # Standard mito_protein = mito_dna.translate(table=2) # Vertebrate mitochondrial print(f"Standard: {std_protein}") print(f"Mitochondrial: {mito_protein}") # Find all start codons coding_dna = Seq("ATGAAACCCATGGGGTTTAAATAG") positions = [i for i in range(len(coding_dna) - 2) if coding_dna[i:i+3] == "ATG"] print(f"ATG positions: {positions}") # ATG positions: [0, 9] ``` ### Module 2: Sequence I/O (Bio.SeqIO) Read, write, and convert biological file formats. ```python from Bio import SeqIO # Parse FASTA file — returns SeqRecord iterator records = list(SeqIO.parse("sequences.fasta", "fasta")) print(f"Loaded {len(records)} sequences") for rec in records[:3]: print(f" {rec.id}: {len(rec.seq)} bp — {rec.description}") # Parse GenBank — rich annotation access for rec in SeqIO.parse("genome.gb", "genbank"): print(f"{rec.id}: {len(rec.features)} features, {len(rec.seq)} bp") for feat in rec.features[:5]: print(f" {feat.type}: {feat.location}") # Convert between formats count = SeqIO.convert("input.gb", "genbank", "output.fasta", "fasta") print(f"Converted {count} records: GenBank → FASTA") ``` ```python from Bio import SeqIO from Bio.SeqRecord import SeqRecord from Bio.Seq import Seq # Write sequences to file records = [ SeqRecord(Seq("ATCGATCG"), id="seq1", description="test sequence 1"), SeqRecord(Seq("GCTAGCTA"), id="seq2", description="test sequence 2"), ] count = SeqIO.write(records, "output.fasta", "fasta") print(f"Wrote {count} records to output.fasta") # Filter sequences by length (streaming — memory efficient) long_seqs = (rec for rec in SeqIO.parse("large_file.fasta", "fasta") if len(rec.seq) >= 200) count = SeqIO.write(long_seqs, "filtered.fasta", "fasta") print(f"Kept {count} sequences >= 200 bp") # Index large FASTA for random access idx = SeqIO.index("large_file.fasta", "fasta") print(f"Indexed {len(idx)} sequences") rec = idx["target_sequence_id"] print(f"Retrieved: {rec.id}, {len(rec.seq)} bp") ``` ### Module 3: NCBI Database Access (Bio.Entrez) Programmatic search and download from NCBI databases. ```python from Bio import Entrez, SeqIO Entrez.email = "your.email@example.com" # Entrez.api_key = "your_key" # Optional: 10 req/s instead of 3 req/s # Search PubMed handle = Entrez.esearch(db="pubmed", term="CRISPR Cas9 2024", retmax=5) results = Entrez.read(handle) handle.close() print(f"Found {results['Count']} articles, retrieved {len(results['IdList'])} IDs") print(f"IDs: {results['IdList']}") # Fetch GenBank record by accession handle = Entrez.efetch(db="nucleotide", id="EU490707", rettype="gb", retmode="text") record = SeqIO.read(handle, "genbank") handle.close() print(f"{record.id}: {record.description}") print(f"Length: {len(record.seq)} bp, Features: {len(record.features)}") ``` ```python from Bio import Entrez import time Entrez.email = "your.email@example.com" # Batch download with rate limiting handle = Entrez.esearch(db="protein", term="insulin[Protein Name] AND human[Organism]", retmax=20) results = Entrez.read(handle) handle.close() # Fetch summaries in batch ids = results["IdList"][:10] handle = Entrez.esummary(db="protein", id=",".join(ids)) summaries = Entrez.read(handle) handle.close() for doc in summaries: print(f" {doc['AccessionVersion']}: {doc['Title'][:60]}...") print(f"\nFetched {len(summaries)} protein summaries") ``` ### Module 4: BLAST Operations (Bio.Blast) Run and parse BLAST searches against NCBI or local databases. ```python from Bio.Blast import NCBIWWW, NCBIXML # Remote BLAST search (nucleotide) query_seq = "ATCGATCGATCGATCGATCGATCGATCGATCG" result_handle = NCBIWWW.qblast("blastn", "nt", query_seq, hitlist_size=5) blast_record = NCBIXML.read(result_handle) result_handle.close() print(f"Query: {blast_record.query[:50]}") print(f"Database: {blast_record.database}") print(f"Hits: {len(blast_record.alignments)}") for aln in blast_record.alignments[:3]: hsp = aln.hsps[0] print(f"\n {aln.title[:60]}...") print(f" E-value: {hsp.expect:.2e}, Identity: {hsp.identities}/{hsp.align_length}") print(f" Score: {hsp.score}, Bits: {hsp.bits:.1f}") ``` ```python from Bio.Blast.Applications import NcbiblastpCommandline from Bio.Blast import NCBIXML # Local BLAST (requires BLAST+ installed) blastp_cline = NcbiblastpCommandline( query="query.fasta", db="swissprot", evalue=1e-5, outfmt=5, # XML output out="blast_results.xml", num_threads=4, ) print(f"Command: {blastp_cline}") # stdout, stderr = blastp_cline() # Execute # Parse local BLAST XML results with open("blast_results.xml") as f: for record in NCBIXML.parse(f): print(f"Query: {record.query}") for aln in record.alignments[:3]: print(f" Hit: {aln.hit_def[:50]}, E={aln.hsps[0].expect:.2e}") ``` ### Module 5: Pairwise Alignment (Bio.Align) Global and local pairwise sequence alignment with customizable scoring. ```python from Bio import Align # Global alignment aligner = Align.PairwiseAligner() aligner.mode = "global" aligner.match_score = 2 aligner.mismatch_score = -1 aligner.open_gap_score = -5 aligner.extend_gap_score = -0.5 alignments = aligner.align("ACCGGTAACG", "ACGGTAAC") print(f"Score: {alignments.score}") print(f"Number of alignments: {len(alignments)}") print(f"Best alignment:\n{alignments[0]}") ``` ```python from Bio import Align from Bio.Align import substitution_matrices # Protein alignment with BLOSUM62 aligner = Align.PairwiseAligner() aligner.mode = "local" aligner.substitution_matrix = substitution_matrices.load("BLOSUM62") aligner.open_gap_score = -10 aligner.extend_gap_score = -0.5 seq1 = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" seq2 = "MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST" alignments = aligner.align(seq1, seq2) print(f"Score: {alignments.score}") print(f"Best alignment:\n{alignments[0]}") ``` ### Module 6: Protein Structure Analysis (Bio.PDB) Parse PDB/mmCIF files and analyze 3D protein structures. ```python from Bio.PDB import PDBParser, PPBuilder # Parse PDB structure parser = PDBParser(QUIET=True) structure = parser.get_structure("1CRN", "1crn.pdb") # Navigate SMCRA hierarchy: Structure > Model > Chain > Residue > Atom model = structure[0] for chain in model: residues = list(chain.get_residues()) print(f"Chain {chain.id}: {len(residues)} residues") # Extract sequence from structure ppb = PPBuilder() for pp in ppb.build_peptides(structure): print(f"Peptide: {pp.get_sequence()[:50]}... ({len(pp.get_sequence())} aa)") # Calculate CA-CA distance chain_a = model["A"] ca1 = chain_a[10]["CA"] ca2 = chain_a[20]["CA"] distance = ca1 - ca2 print(f"CA distance (res 10-20): {distance:.2f} Angstrom") ``` ```python from Bio.PDB import PDBParser, Superimposer import numpy as np # Structure superimposition (RMSD calculation) parser = PDBParser(QUIET=True) struct1 = parser.get_structure("s1", "structure1.pdb") struct2 = parser.get_structure("s2", "structure2.pdb") # Get CA atoms for alignment atoms1 = [res["CA"] for res in struct1[0]["A"].get_residues() if "CA" in res] atoms2 = [res["CA"] for res in struct2[0]["A"].get_residues() if "CA" in res] # Superimpose (requires same number of atoms) n = min(len(atoms1), len(atoms2)) sup = Superimposer() sup.set_atoms(atoms1[:n], atoms2[:n]) sup.apply(struct2.get_atoms()) print(f"RMSD: {sup.rms:.3f} Angstrom over {n} CA atoms") ``` ### Module 7: Phylogenetics (Bio.Phylo) Build, manipulate, and visualize phylogenetic trees. ```python from Bio import Phylo, AlignIO from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor import io # Build tree from multiple sequence alignment alignment = AlignIO.read("aligned_sequences.fasta", "fasta") print(f"Alignment: {len(alignment)} sequences, {alignment.get_alignment_length()} positions") # Calculate distance matrix and build NJ tree calculator = DistanceCalculator("identity") dm = calculator.get_distance(alignment) print(f"Distance matrix:\n{dm}") constructor = DistanceTreeConstructor() nj_tree = constructor.nj(dm) upgma_tree = constructor.upgma(dm) # Visualize Phylo.draw_ascii(nj_tree) # Save tree Phylo.write(nj_tree, "tree.nwk", "newick") print("Saved tree.nwk") ``` ### Module 8: Sequence Utilities (Bio.SeqUtils) Compute sequence statistics and physicochemical properties. ```python from Bio.Seq import Seq from Bio.SeqUtils import gc_fraction, molecular_weight, MeltingTemp dna = Seq("ATCGATCGATCGATCGATCG") print(f"GC content: {gc_fraction(dna):.2%}") print(f"Molecular weight: {molecular_weight(dna, seq_type='DNA'):.2f} Da") print(f"Melting temp (basic): {MeltingTemp.Tm_Wallace(dna):.1f} C") print(f"Melting temp (NN): {MeltingTemp.Tm_NN(dna):.1f} C") # Protein analysis from Bio.SeqUtils.ProtParam import ProteinAnalysis protein = ProteinAnalysis("MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK") print(f"\nProtein MW: {protein.molecular_weight():.2f} Da") print(f"Isoelectric point: {protein.isoelectric_point():.2f}") print(f"Aromaticity: {protein.aromaticity():.4f}") print(f"Instability index: {protein.instability_index():.2f}") print(f"GRAVY: {protein.gravy():.4f}") aa_pct = protein.get_amino_acids_percent() print(f"Top 3 amino acids: {sorted(aa_pct.items(), key=lambda x: -x[1])[:3]}") ``` ## Common Workflows ### Workflow 1: Gene Sequence Retrieval and Analysis Pipeline **Goal**: Fetch a gene from NCBI, analyze its properties, translate to protein, and compute statistics. ```python from Bio import Entrez, SeqIO from Bio.Seq import Seq from Bio.SeqUtils import gc_fraction from Bio.SeqUtils.ProtParam import ProteinAnalysis Entrez.email = "your.email@example.com" # Step 1: Fetch gene from GenBank handle = Entrez.efetch(db="nucleotide", id="NM_007294.4", rettype="gb", retmode="text") record = SeqIO.read(handle, "genbank") handle.close() print(f"Gene: {record.description}") print(f"Length: {len(record.seq)} bp") # Step 2: Extract CDS cds_features = [f for f in record.features if f.type == "CDS"] if cds_features: cds = cds_features[0] cds_seq = cds.location.extract(record).seq print(f"CDS: {len(cds_seq)} bp, GC: {gc_fraction(cds_seq):.2%}") # Step 3: Translate protein_seq = cds_seq.translate(to_stop=True) print(f"Protein: {len(protein_seq)} aa") print(f"First 30 aa: {protein_seq[:30]}...") # Step 4: Protein properties analysis = ProteinAnalysis(str(protein_seq)) print(f"MW: {analysis.molecular_weight():.0f} Da") print(f"pI: {analysis.isoelectric_point():.2f}") print(f"Instability: {analysis.instability_index():.1f}") print(f"GRAVY: {analysis.gravy():.3f}") ``` ### Workflow 2: Comparative Sequence Analysis with BLAST and Phylogeny **Goal**: BLAST a protein sequence, fetch homologs, align, and build a phylogenetic tree. ```python from Bio.Blast import NCBIWWW, NCBIXML from Bio import Entrez, SeqIO, AlignIO, Phylo from Bio.Phylo.TreeConstruction import DistanceCalculator, DistanceTreeConstructor from Bio.Align.Applications import MuscleCommandline import time Entrez.email = "your.email@example.com" # Step 1: BLAST search query = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" result_handle = NCBIWWW.qblast("blastp", "swissprot", query, hitlist_size=10) blast_record = NCBIXML.read(result_handle) print(f"BLAST hits: {len(blast_record.alignments)}") # Step 2: Collect homolog accessions accessions = [] for aln in blast_record.alignments[:8]: acc = aln.accession accessions.append(acc) print(f" {acc}: E={aln.hsps[0].expect:.2e}, {aln.hit_def[:50]}...") # Step 3: Fetch sequences and save for alignment handle = Entrez.efetch(db="protein", id=",".join(accessions), rettype="fasta", retmode="text") records = list(SeqIO.parse(handle, "fasta")) handle.close() SeqIO.write(records, "homologs.fasta", "fasta") print(f"Saved {len(records)} homolog sequences") # Step 4: Align (requires MUSCLE installed) # muscle_cline = MuscleCommandline(input="homologs.fasta", out="aligned.fasta") # muscle_cline() # Step 5: Build phylogenetic tree from alignment alignment = AlignIO.read("aligned.fasta", "fasta") calculator = DistanceCalculator("blosum62") dm = calculator.get_distance(alignment) tree = DistanceTreeConstructor().nj(dm) Phylo.draw_ascii(tree) Phylo.write(tree, "homologs.nwk", "newick") print("Saved phylogenetic tree to homologs.nwk") ``` ### Workflow 3: Batch Sequence Processing and Quality Filtering **Goal**: Process a large FASTQ/FASTA dataset — filter by quality/length, compute statistics, and export. ```python from Bio import SeqIO from Bio.SeqUtils import gc_fraction import pandas as pd # Step 1: Stream through large file and collect stats stats = [] passed = [] for rec in SeqIO.parse("reads.fastq", "fastq"): seq_len = len(rec.seq) gc = gc_fraction(rec.seq) avg_qual = sum(rec.letter_annotations["phred_quality"]) / seq_len stats.append({"id": rec.id, "length": seq_len, "gc": gc, "avg_qual": avg_qual}) # Filter: length >= 100 and avg quality >= 20 if seq_len >= 100 and avg_qual >= 20: passed.append(rec) # Step 2: Summary statistics df = pd.DataFrame(stats) print(f"Total reads: {len(df)}") print(f"Passed QC: {len(passed)} ({len(passed)/len(df)*100:.1f}%)") print(f"\nLength: mean={df['length'].mean():.0f}, median={df['length'].median():.0f}") print(f"GC: mean={df['gc'].mean():.2%}, std={df['gc'].std():.2%}") print(f"Quality: mean={df['avg_qual'].mean():.1f}, min={df['avg_qual'].min():.1f}") # Step 3: Export filtered reads count = SeqIO.write(passed, "filtered_reads.fastq", "fastq") print(f"\nExported {count} filtered reads to filtered_reads.fastq") # Step 4: Save statistics df.to_csv("read_statistics.csv", index=False) print(f"Saved statistics to read_statistics.csv") ``` ## Key Parameters | Parameter | Module | Default | Range / Options | Effect | |-----------|--------|---------|-----------------|--------| | `Seq.translate(table=)` | Bio.Seq | `1` (Standard) | `1`-`33` | NCBI genetic code table for translation | | `Seq.translate(to_stop=)` | Bio.Seq | `False` | `True`, `False` | Stop at first stop codon vs translate entire sequence | | `SeqIO.parse(format=)` | Bio.SeqIO | — | `"fasta"`, `"genbank"`, `"fastq"`, `"phylip"` | File format for parsing | | `Entrez.email` | Bio.Entrez | (required) | Valid email | NCBI requires email for tracking; set before any Entrez call | | `Entrez.api_key` | Bio.Entrez | `None` | NCBI API key string | Increases rate limit from 3 to 10 requests/second | | `PairwiseAligner.mode` | Bio.Align | `"global"` | `"global"`, `"local"` | Needleman-Wunsch vs Smith-Waterman algorithm | | `PairwiseAligner.open_gap_score` | Bio.Align | `-1` | `-20` to `0` | Penalty for opening a gap; more negative = fewer gaps | | `PairwiseAligner.substitution_matrix` | Bio.Align | None | `"BLOSUM62"`, `"BLOSUM45"`, `"PAM250"` | Scoring matrix for protein alignment | | `PDBParser(QUIET=)` | Bio.PDB | `False` | `True`, `False` | Suppress parser warnings for non-standard PDB files | | `DistanceCalculator(model=)` | Bio.Phylo | `"identity"` | `"identity"`, `"blosum62"` | Distance model for tree construction | ## Common Recipes ### Recipe: Restriction Enzyme Analysis When to use: Find restriction sites in a DNA sequence for cloning design. ```python from Bio.Seq import Seq from Bio.Restriction import EcoRI, BamHI, HindIII, RestrictionBatch, Analysis seq = Seq("GAATTCAAAGGATCCTTTTAAGCTTGGGAATTC") # Single enzyme print(f"EcoRI cuts at: {EcoRI.search(seq)}") print(f"BamHI cuts at: {BamHI.search(seq)}") # Batch analysis batch = RestrictionBatch([EcoRI, BamHI, HindIII]) analysis = Analysis(batch, seq) result = analysis.full() for enzyme, sites in result.items(): if sites: print(f"{enzyme}: cuts at positions {sites}") ``` ### Recipe: Motif Discovery and Position Weight Matrix When to use: Analyze transcription factor binding sites or consensus patterns. ```python from Bio import motifs from Bio.Seq import Seq # Create motif from observed binding sites instances = [ Seq("TACGAT"), Seq("TAGCAT"), Seq("TACGGT"), Seq("TAGCAT"), Seq("TACGAT"), ] m = motifs.create(instances) print(f"Consensus: {m.consensus}") print(f"Degenerate: {m.degenerate_consensus}") print(f"\nPosition Weight Matrix:") print(m.counts) # Score a new sequence against the motif pwm = m.counts.normalize(pseudocounts=0.5) pssm = pwm.log_odds() test_seq = Seq("AATACGATCCC") for pos, score in pssm.search(test_seq, threshold=0.0): print(f" Position {pos}: score={score:.2f}") ``` ### Recipe: GenomeDiagram — Visualize Genomic Features When to use: Create a circular or linear genome map from a GenBank file. ```python from Bio import SeqIO from Bio.Graphics import GenomeDiagram from reportlab.lib import colors from reportlab.lib.units import cm # Load annotated genome record = SeqIO.read("plasmid.gb", "genbank") # Create diagram diagram = GenomeDiagram.Diagram(record.name) track = diagram.new_track(1, name="Annotated Features", greytrack=True) feature_set = track.new_set() # Color features by type color_map = {"CDS": colors.blue, "gene": colors.green, "promoter": colors.red} for feature in record.features: if feature.type in color_map: feature_set.add_feature(feature, color=color_map[feature.type], label=True, label_size=8) # Draw circular map diagram.draw(format="circular", circular=True, pagesize=(20*cm, 20*cm), start=0, end=len(record)) diagram.write("genome_map.pdf", "PDF") print(f"Saved genome_map.pdf ({len(record.features)} features)") ``` ### Recipe: Batch PubMed Literature Search When to use: Programmatically search and download publication metadata. ```python from Bio import Entrez import time Entrez.email = "your.email@example.com" # Search PubMed with complex query query = "(CRISPR[Title]) AND (2024[Date - Publication]) AND (review[Publication Type])" handle = Entrez.esearch(db="pubmed", term=query, retmax=100) results = Entrez.read(handle) handle.close() print(f"Found {results['Count']} articles") # Fetch abstracts in batches ids = results["IdList"] batch_size = 20 articles = [] for i in range(0, len(ids), batch_size): batch = ids[i:i+batch_size] handle = Entrez.efetch(db="pubmed", id=",".join(batch), rettype="xml") records = Entrez.read(handle) handle.close() for article in records["PubmedArticle"]: info = article["MedlineCitation"]["Article"] title = info.get("ArticleTitle", "N/A") abstract = info.get("Abstract", {}).get("AbstractText", ["N/A"])[0] articles.append({"title": title, "abstract": str(abstract)[:200]}) time.sleep(0.4) # Rate limiting for a in articles[:5]: print(f" {a['title'][:70]}...") print(f"\nRetrieved {len(articles)} articles") ``` ## Troubleshooting | Problem | Cause | Solution | |---------|-------|----------| | `HTTPError 400` from Entrez | Invalid accession/ID or malformed query | Validate accessions; check query syntax with NCBI web interface first | | `HTTPError 429` (Too Many Requests) | Exceeding NCBI rate limit (3 req/s) | Set `Entrez.api_key` for 10 req/s; add `time.sleep(0.4)` between calls | | `ValueError: No records found` in `SeqIO.read()` | Empty file or wrong format string | Use `SeqIO.parse()` to check if file has records; verify format matches actual content | | `Bio.PDB.PDBExceptions.PDBConstructionWarning` | Non-standard atoms or occupancy issues | Use `PDBParser(QUIET=True)` or fix PDB with `pdb-tools`; check for alternate conformations | | BLAST search times out | Large query or busy NCBI servers | Use local BLAST+ for large-scale searches; set `NCBIWWW.qblast(hitlist_size=N)` to limit results | | `Alignment has sequences of different lengths` | Unaligned sequences passed to AlignIO | Align sequences first with MUSCLE/Clustal before loading as alignment | | `SeqIO.index()` raises `ValueError` | Duplicate IDs in FASTA file | Deduplicate IDs with `SeqIO.to_dict()` or pre-process with `awk` | | `ImportError: No module named Bio` | Biopython not installed in active environment | `pip install biopython`; verify with `python -c "import Bio; print(Bio.__version__)"` | | `translate()` gives unexpected `*` | Stop codons in middle of sequence | Check reading frame; use `Seq.translate(table=N)` with correct genetic code | | GenomeDiagram blank output | No features matched filter criteria | Check `feature.type` values in your GenBank file; print types to debug | ## References - [Biopython Tutorial and Cookbook](https://biopython.org/docs/latest/Tutorial/) — Official comprehensive tutorial - [Biopython API Documentation](https://biopython.org/docs/latest/api/) — Complete API reference - [Cock, P.J.A. et al. (2009) Bioinformatics 25:1422-1423](https://doi.org/10.1093/bioinformatics/btp163) — Original Biopython paper - [NCBI Entrez Programming Utilities](https://www.ncbi.nlm.nih.gov/books/NBK25497/) — E-utilities documentation for programmatic NCBI access - [Biopython GitHub Repository](https://github.com/biopython/biopython) — Source code, issues, and release notes