format-version: 1.2
data-version: releases/2022-02-16
subsetdef: 1_STAR ""
subsetdef: 2_STAR ""
subsetdef: 3_STAR ""
subsetdef: abnormal_slim ""
subsetdef: added_for_HCA ""
subsetdef: attribute_slim ""
subsetdef: BDS_subset ""
subsetdef: cell_quality ""
subsetdef: cumbo ""
subsetdef: cyclostome_subset ""
subsetdef: developmental_classification ""
subsetdef: disposition_slim ""
subsetdef: dubious_grouping ""
subsetdef: early_development ""
subsetdef: efo_slim ""
subsetdef: emapa_ehdaa2 ""
subsetdef: functional_classification ""
subsetdef: gocheck_do_not_annotate ""
subsetdef: gocheck_do_not_manually_annotate ""
subsetdef: goslim_agr ""
subsetdef: goslim_aspergillus ""
subsetdef: goslim_candida ""
subsetdef: goslim_chembl ""
subsetdef: goslim_drosophila ""
subsetdef: goslim_flybase_ribbon ""
subsetdef: goslim_generic ""
subsetdef: goslim_metagenomics ""
subsetdef: goslim_mouse ""
subsetdef: goslim_pir ""
subsetdef: goslim_plant ""
subsetdef: goslim_pombe ""
subsetdef: goslim_synapse ""
subsetdef: goslim_yeast ""
subsetdef: grouping_class ""
subsetdef: homology_grouping ""
subsetdef: http://purl.obolibrary.org/obo/valid_for_go_annotation_extension ""
subsetdef: http://purl.obolibrary.org/obo/valid_for_go_gp2term ""
subsetdef: http://purl.obolibrary.org/obo/valid_for_go_ontology ""
subsetdef: http://purl.obolibrary.org/obo/valid_for_gocam ""
subsetdef: inconsistent_with_fma ""
subsetdef: location_grouping ""
subsetdef: major_organ ""
subsetdef: mpath_slim ""
subsetdef: non_informative ""
subsetdef: organ_slim ""
subsetdef: pheno_slim ""
subsetdef: phenotype_rcn ""
subsetdef: ro-eco ""
subsetdef: RO:0002259 ""
subsetdef: scalar_slim ""
subsetdef: uberon_slim ""
subsetdef: ubprop:upper_level "abstract upper-level terms not directly useful for analysis"
subsetdef: unverified_taxonomic_grouping ""
subsetdef: upper_level ""
subsetdef: value_slim ""
subsetdef: vertebrate_core ""
synonymtypedef: HUMAN_PREFERRED "preferred term when talking about an instance of this class in Homo sapiens"
synonymtypedef: LATIN "latin term"
synonymtypedef: PLURAL "plural term"
remark: See PMID:15693950, PMID:12799354, PMID:20123131, PMID:21208450; Contact Alexander Diehl, addiehl@buffalo.edu, University at Buffalo.
ontology: cl
property_value: dc-contributor "Alexander Diehl" xsd:string
property_value: dc-contributor "Ceri van Slyke" xsd:string
property_value: dc-contributor "Chris Mungall" xsd:string
property_value: dc-contributor "David Osumi-Sutherland" xsd:string
property_value: dc-contributor "Jim Balhoff" xsd:string
property_value: dc-contributor "Melissa Haendel" xsd:string
property_value: dc-contributor "Nicole Vasilevsky" xsd:string
property_value: dc-contributor "Terry Meehan" xsd:string
property_value: dc-contributor "Yvonne Bradford" xsd:string
property_value: dc-description "An ontology of cell types." xsd:string
property_value: dc-title "Cell Ontology" xsd:string
property_value: dcterms-license http://creativecommons.org/licenses/by/4.0/
property_value: IAO:0000700 CL:0000000
property_value: owl:versionInfo "2022-02-16" xsd:string

[Term]
id: BFO:0000002
name: continuant
def: "An entity that exists in full at any time in which it exists at all, persists through time while maintaining its identity and has no temporal parts." []
disjoint_from: BFO:0000003 ! occurrent
relationship: part_of BFO:0000002 ! continuant

[Term]
id: BFO:0000003
name: occurrent
def: "An entity that has temporal parts and that happens, unfolds or develops through time." []
relationship: part_of BFO:0000003 ! occurrent

[Term]
id: BFO:0000004
name: independent continuant
def: "A continuant that is a bearer of quality and realizable entity entities, in which other entities inhere and which itself cannot inhere in anything." []
is_a: BFO:0000002 ! continuant
disjoint_from: BFO:0000020 ! specifically dependent continuant
disjoint_from: BFO:0000031 ! generically dependent continuant
relationship: part_of BFO:0000004 ! independent continuant

[Term]
id: BFO:0000006
name: spatial region
is_a: BFO:0000141 ! immaterial entity

[Term]
id: BFO:0000015
name: process
def: "An occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t." []
is_a: BFO:0000003 ! occurrent

[Term]
id: BFO:0000016
name: disposition
is_a: BFO:0000017 ! realizable entity
disjoint_from: BFO:0000023 ! role

[Term]
id: BFO:0000017
name: realizable entity
def: "A specifically dependent continuant  that inheres in continuant  entities and are not exhibited in full at every time in which it inheres in an entity or group of entities. The exhibition or actualization of a realizable entity is a particular manifestation, functioning or process that occurs under certain circumstances." []
is_a: BFO:0000020 ! specifically dependent continuant
disjoint_from: BFO:0000019 ! quality
relationship: part_of BFO:0000017 ! realizable entity

[Term]
id: BFO:0000019
name: quality
is_a: BFO:0000020 ! specifically dependent continuant
relationship: part_of BFO:0000019 ! quality

[Term]
id: BFO:0000020
name: specifically dependent continuant
def: "A continuant that inheres in or is borne by other entities. Every instance of A requires some specific instance of B which must always be the same." []
is_a: BFO:0000002 ! continuant
disjoint_from: BFO:0000031 ! generically dependent continuant
relationship: part_of BFO:0000020 ! specifically dependent continuant

[Term]
id: BFO:0000023
name: role
def: "A realizable entity  the manifestation of which brings about some result or end that is not essential to a continuant  in virtue of the kind of thing that it is but that can be served or participated in by that kind of continuant  in some kinds of natural, social or institutional contexts." []
is_a: CHEBI:50906 ! role
equivalent_to: CHEBI:50906 ! role

[Term]
id: BFO:0000031
name: generically dependent continuant
def: "A continuant that is dependent on one or other independent continuant bearers. For every instance of A requires some instance of (an independent continuant type) B but which instance of B serves can change from time to time." []
is_a: BFO:0000002 ! continuant
relationship: part_of BFO:0000031 ! generically dependent continuant

[Term]
id: BFO:0000034
name: function
is_a: BFO:0000016 ! disposition

[Term]
id: BFO:0000040
name: material entity
def: "An independent continuant that is spatially extended whose identity is independent of that of other entities and can be maintained through time." []
is_a: BFO:0000004 ! independent continuant
disjoint_from: BFO:0000141 ! immaterial entity

[Term]
id: BFO:0000141
name: immaterial entity
is_a: BFO:0000004 ! independent continuant

[Term]
id: CARO:0000006
relationship: drains CARO:0000003

[Term]
id: CHEBI:10545
name: electron
namespace: chebi_ontology
def: "Elementary particle not affected by the strong force having a spin 1/2, a negative elementary charge and a rest mass of 0.000548579903(13) u, or 0.51099906(15) MeV." []
subset: 3_STAR
synonym: "beta" RELATED [IUPAC]
synonym: "beta(-)" RELATED [ChEBI]
synonym: "beta-particle" RELATED [IUPAC]
synonym: "e" RELATED [IUPAC]
synonym: "e(-)" RELATED [UniProt]
synonym: "e-" RELATED [KEGG_COMPOUND]
synonym: "electron" EXACT [KEGG_COMPOUND]
synonym: "electron" EXACT IUPAC_NAME [IUPAC]
synonym: "electron" EXACT [ChEBI]
synonym: "Elektron" RELATED [ChEBI]
synonym: "negatron" RELATED [IUPAC]
xref: KEGG:C05359
xref: PMID:21614077 {source="Europe PMC"}
xref: Wikipedia:Electron
is_a: CHEBI:36338 ! lepton
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "0.000548579903" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "0.0" xsd:string

[Term]
id: CHEBI:131565
name: steroid aldehyde
namespace: chebi_ontology
def: "Any steroid substituted by a formyl group." []
subset: 3_STAR
synonym: "steroid aldehydes" RELATED [ChEBI]
is_a: CHEBI:17478 ! aldehyde
is_a: CHEBI:35341 ! steroid

[Term]
id: CHEBI:131604
name: Mycoplasma genitalium metabolite
namespace: chebi_ontology
def: "Any bacterial metabolite produced during a metabolic reaction in Mycoplasma genitalium." []
subset: 3_STAR
synonym: "Mycoplasma genitalium metabolites" RELATED [ChEBI]
is_a: CHEBI:76969 ! bacterial metabolite

[Term]
id: CHEBI:131621
name: C19-steroid
namespace: chebi_ontology
def: "A steroid compound with a structure based on a 19-carbon (androstane) skeleton." []
subset: 3_STAR
synonym: "C19-steroids" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid
relationship: has_parent_hydride CHEBI:35509 ! androstane

[Term]
id: CHEBI:131927
name: dicarboxylic acids and O-substituted derivatives
namespace: chebi_ontology
def: "A class of carbonyl compound encompassing dicarboxylic acids and any derivatives obtained by substitution of either one or both of the carboxy hydrogens." []
subset: 3_STAR
synonym: "dicarboxylic acids and derivatives" RELATED [ChEBI]
is_a: CHEBI:36586 ! carbonyl compound

[Term]
id: CHEBI:132153
name: hyaluronate
namespace: chebi_ontology
def: "A carbohydrate acid derivative anion obtained by deprotonation of the carboxy groups of hyaluronic acid; major species at pH 7.3." []
subset: 3_STAR
synonym: "hyaluronan" RELATED [UniProt]
synonym: "hyaluronate polyanion" RELATED [ChEBI]
is_a: CHEBI:61469 ! polyanionic polymer
is_a: CHEBI:63551 ! carbohydrate acid derivative anion
relationship: is_conjugate_base_of CHEBI:16336 ! hyaluronic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H20NO11)n.H2O" xsd:string

[Term]
id: CHEBI:136849
name: 3-oxo-Delta(4)-steroid group
namespace: chebi_ontology
def: "An organic group derived from any 3-oxo-Delta(4)-steroid." []
subset: 3_STAR
synonym: "a 3-oxo-Delta4-steroid group" RELATED [UniProt]
is_a: CHEBI:33247 ! organic group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H6O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "94.111" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "94.04186" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=C(C*)*C(CC1=O)*" xsd:string

[Term]
id: CHEBI:136889
name: 5beta steroid
namespace: chebi_ontology
def: "Any steroid that has beta-configuration at position 5." []
subset: 3_STAR
synonym: "5beta steroids" RELATED [ChEBI]
synonym: "5beta-steroid" RELATED [ChEBI]
synonym: "5beta-steroids" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid

[Term]
id: CHEBI:138103
name: inorganic acid
namespace: chebi_ontology
def: "A Bronsted acid derived from one or more inorganic compounds. Inorganic acids (also known as mineral acids) form hydrons and conjugate base ions when dissolved in water." []
subset: 3_STAR
synonym: "inorganic acids" RELATED [ChEBI]
synonym: "mineral acid" RELATED [ChEBI]
synonym: "mineral acids" RELATED [ChEBI]
xref: Wikipedia:Mineral_acid
is_a: CHEBI:39141 ! Bronsted acid

[Term]
id: CHEBI:138366
name: bile acids
namespace: chebi_ontology
def: "Any member of a group of hydroxy steroids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration, while in lower vertebrates, some bile acids, known as allo-bile acids, have 5alpha-configuration." []
subset: 3_STAR
is_a: CHEBI:25384 ! monocarboxylic acid
is_a: CHEBI:35350 ! hydroxy steroid
is_a: CHEBI:36078 ! cholanoid

[Term]
id: CHEBI:13850
name: apoprotein
namespace: chebi_ontology
def: "An apoprotein is a protein devoid of its characteristic prosthetic group or metal." []
subset: 3_STAR
synonym: "apoprotein" EXACT IUPAC_NAME [IUPAC]
synonym: "apoproteins" RELATED [ChEBI]
xref: KEGG:C16240
is_a: CHEBI:38560 ! simple protein
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite

[Term]
id: CHEBI:138675
name: gas molecular entity
namespace: chebi_ontology
def: "Any main group molecular entity that is gaseous at standard temperature and pressure (STP; 0degreeC and 100 kPa)." []
subset: 3_STAR
synonym: "gas molecular entities" RELATED [ChEBI]
synonym: "gaseous molecular entities" RELATED [ChEBI]
synonym: "gaseous molecular entity" RELATED [ChEBI]
xref: Wikipedia:https\://en.wikipedia.org/wiki/Gas
is_a: CHEBI:33579 ! main group molecular entity

[Term]
id: CHEBI:13941
name: carbamate
namespace: chebi_ontology
subset: 3_STAR
synonym: "Carbamat" RELATED [ChEBI]
synonym: "carbamate" EXACT [UniProt]
synonym: "carbamate" EXACT IUPAC_NAME [IUPAC]
synonym: "carbamate ion" RELATED [ChemIDplus]
synonym: "carbamic acid, ion(1-)" RELATED [ChemIDplus]
synonym: "Karbamat" RELATED [ChEBI]
xref: Beilstein:3903503 {source="Beilstein"}
xref: CAS:302-11-4 {source="ChemIDplus"}
xref: Gmelin:239604 {source="Gmelin"}
is_a: CHEBI:37022 ! amino-acid anion
relationship: is_conjugate_base_of CHEBI:28616 ! carbamic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KXDHJXZQYSOELW-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "60.03212" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.00910" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC([O-])=O" xsd:string

[Term]
id: CHEBI:139588
name: alpha-hydroxy ketone
namespace: chebi_ontology
def: "An alpha-oxyketone that has a hydroxy group as the alpha-oxy moiety." []
subset: 3_STAR
synonym: "alpha-hydroxy ketones" RELATED [ChEBI]
synonym: "alpha-hydroxy-ketone" RELATED [ChEBI]
synonym: "alpha-hydroxy-ketones" RELATED [ChEBI]
synonym: "alpha-hydroxyketone" RELATED [ChEBI]
synonym: "alpha-hydroxyketones" RELATED [ChEBI]
xref: PMID:15326516 {source="Europe PMC"}
xref: PMID:19908854 {source="Europe PMC"}
xref: PMID:20382022 {source="Europe PMC"}
xref: PMID:23295224 {source="Europe PMC"}
is_a: CHEBI:30879 ! alcohol
is_a: CHEBI:52396 ! alpha-oxyketone

[Term]
id: CHEBI:139590
name: primary alpha-hydroxy ketone
namespace: chebi_ontology
def: "An alpha-hydroxy ketone in which the carbonyl group and the hydroxy group are linked by a -CH2 (methylene) group." []
subset: 3_STAR
synonym: "primary alpha-hydroxy ketones" RELATED [ChEBI]
synonym: "primary alpha-hydroxy-ketone" RELATED [ChEBI]
synonym: "primary alpha-hydroxy-ketones" RELATED [ChEBI]
synonym: "primary alpha-hydroxyketone" RELATED [ChEBI]
synonym: "primary alpha-hydroxyketones" RELATED [ChEBI]
is_a: CHEBI:139588 ! alpha-hydroxy ketone
is_a: CHEBI:15734 ! primary alcohol
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "59.044" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01330" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(C(O)([H])[H])=O" xsd:string

[Term]
id: CHEBI:140601
name: fatty acid 4:0
namespace: chebi_ontology
def: "Any saturated fatty acid containing 4 carbons." []
subset: 3_STAR
is_a: CHEBI:26666 ! short-chain fatty acid
relationship: is_conjugate_acid_of CHEBI:78115 ! fatty acid anion 4:0
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.017" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(O)=O" xsd:string

[Term]
id: CHEBI:142163
name: 24G7 epitope
namespace: chebi_ontology
def: "An antigenic epitope recognized by an anti-bilirubin monoclonal antibody designated 24G7. A substructure of bilirubin IXalpha, it is the region containing the oxo group at C-1, the methyl group at C-2, C-(4, 5, 6, 9), and N-21 and -22." []
subset: 3_STAR
is_a: CHEBI:24433 ! group
relationship: RO:0000087 CHEBI:53000 ! has role epitope
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C7H6N2O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "134.136" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "134.04801" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(=CC(NC(=*)*)=*)(NC(C(C)=*)=O)*" xsd:string

[Term]
id: CHEBI:14321
name: glutamate(1-)
namespace: chebi_ontology
def: "An alpha-amino-acid anion that is the conjugate base of glutamic acid, having anionic carboxy groups and a cationic amino group" []
subset: 3_STAR
synonym: "2-ammoniopentanedioate" RELATED [IUPAC]
synonym: "glutamate" RELATED [UniProt]
synonym: "glutamate(1-)" EXACT [JCBN]
synonym: "glutamic acid monoanion" RELATED [JCBN]
synonym: "hydrogen glutamate" EXACT IUPAC_NAME [IUPAC]
xref: Gmelin:327908 {source="Gmelin"}
is_a: CHEBI:33558 ! alpha-amino-acid anion
relationship: is_conjugate_acid_of CHEBI:29987 ! glutamate(2-)
relationship: is_conjugate_base_of CHEBI:18237 ! glutamic acid
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H8NO4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "146.12136" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "146.04588" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]C(CCC([O-])=O)C([O-])=O" xsd:string

[Term]
id: CHEBI:15339
name: acceptor
namespace: chebi_ontology
alt_id: CHEBI:13699
alt_id: CHEBI:2377
def: "A molecular entity that can accept an electron, a pair of electrons, an atom or a group from another molecular entity." []
subset: 3_STAR
synonym: "A" RELATED [KEGG_COMPOUND]
synonym: "accepteur" RELATED [ChEBI]
synonym: "Acceptor" EXACT [KEGG_COMPOUND]
synonym: "Akzeptor" RELATED [ChEBI]
synonym: "Hydrogen-acceptor" RELATED [KEGG_COMPOUND]
synonym: "Oxidized donor" RELATED [KEGG_COMPOUND]
xref: KEGG:C00028
xref: KEGG:C16722
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:15355
name: acetylcholine
namespace: chebi_ontology
alt_id: CHEBI:12686
alt_id: CHEBI:13715
alt_id: CHEBI:22197
alt_id: CHEBI:2416
alt_id: CHEBI:40559
def: "Actylcholine is an ester of acetic acid and choline, which acts as a neurotransmitter." []
subset: 3_STAR
synonym: "2-acetyloxy-N,N,N-trimethylethanaminium" EXACT IUPAC_NAME [IUPAC]
synonym: "ACETYLCHOLINE" EXACT [PDBeChem]
synonym: "Acetylcholine" EXACT [KEGG_COMPOUND]
synonym: "acetylcholine" EXACT [UniProt]
synonym: "ACh" RELATED [ChemIDplus]
synonym: "Azetylcholin" RELATED [ChEBI]
synonym: "choline acetate" RELATED [ChemIDplus]
synonym: "O-Acetylcholine" RELATED [KEGG_COMPOUND]
xref: Beilstein:1764436 {source="ChemIDplus"}
xref: CAS:51-84-3 {source="KEGG COMPOUND"}
xref: CAS:51-84-3 {source="ChemIDplus"}
xref: Drug_Central:65 {source="DrugCentral"}
xref: DrugBank:DB03128
xref: Gmelin:326108 {source="Gmelin"}
xref: KEGG:C01996
xref: LINCS:LSM-5888
xref: PDBeChem:ACH
xref: PMID:14764638 {source="Europe PMC"}
xref: PMID:15014918 {source="Europe PMC"}
xref: PMID:15231705 {source="Europe PMC"}
xref: PMID:15361288 {source="Europe PMC"}
xref: PMID:18050502 {source="Europe PMC"}
xref: PMID:18407448 {source="Europe PMC"}
xref: PMID:19255787 {source="Europe PMC"}
xref: PMID:20963497 {source="Europe PMC"}
xref: PMID:21130809 {source="Europe PMC"}
xref: PMID:21246223 {source="Europe PMC"}
xref: PMID:21545631 {source="Europe PMC"}
xref: PMID:21601579 {source="Europe PMC"}
xref: Wikipedia:Acetylcholine
is_a: CHEBI:35287 ! acylcholine
is_a: CHEBI:47622 ! acetate ester
relationship: RO:0000087 CHEBI:24621 ! has role hormone
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent
relationship: RO:0000087 CHEBI:38325 ! has role muscarinic agonist
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C7H16NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C7H16NO2/c1-7(9)10-6-5-8(2,3)4/h5-6H2,1-4H3/q+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OIPILFWXSMYKGL-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "146.20748" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "146.11756" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(=O)OCC[N+](C)(C)C" xsd:string

[Term]
id: CHEBI:15366
name: acetic acid
namespace: chebi_ontology
alt_id: CHEBI:22169
alt_id: CHEBI:2387
alt_id: CHEBI:40486
def: "A simple monocarboxylic acid containing two carbons." []
subset: 3_STAR
synonym: "ACETIC ACID" EXACT [PDBeChem]
synonym: "Acetic acid" EXACT [KEGG_COMPOUND]
synonym: "acetic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "acide acetique" RELATED [ChemIDplus]
synonym: "AcOH" RELATED [ChEBI]
synonym: "CH3-COOH" RELATED [IUPAC]
synonym: "CH3CO2H" RELATED [ChEBI]
synonym: "E 260" RELATED [ChEBI]
synonym: "E-260" RELATED [ChEBI]
synonym: "E260" RELATED [ChEBI]
synonym: "Essigsaeure" RELATED [ChEBI]
synonym: "Ethanoic acid" RELATED [KEGG_COMPOUND]
synonym: "ethoic acid" RELATED [ChEBI]
synonym: "Ethylic acid" RELATED [ChemIDplus]
synonym: "HOAc" RELATED [ChEBI]
synonym: "INS No. 260" RELATED [ChEBI]
synonym: "MeCO2H" RELATED [ChEBI]
synonym: "MeCOOH" RELATED [ChEBI]
synonym: "Methanecarboxylic acid" RELATED [ChemIDplus]
xref: Beilstein:506007 {source="Beilstein"}
xref: CAS:64-19-7 {source="ChemIDplus"}
xref: CAS:64-19-7 {source="NIST Chemistry WebBook"}
xref: CAS:64-19-7 {source="KEGG COMPOUND"}
xref: Drug_Central:4211 {source="DrugCentral"}
xref: Gmelin:1380 {source="Gmelin"}
xref: HMDB:HMDB0000042
xref: KEGG:C00033
xref: KEGG:D00010
xref: KNApSAcK:C00001176
xref: LIPID_MAPS_instance:LMFA01010002 {source="LIPID MAPS"}
xref: MetaCyc:ACET
xref: PDBeChem:ACT
xref: PDBeChem:ACY
xref: PMID:12005138 {source="Europe PMC"}
xref: PMID:15107950 {source="Europe PMC"}
xref: PMID:16630552 {source="Europe PMC"}
xref: PMID:16774200 {source="Europe PMC"}
xref: PMID:17190852 {source="Europe PMC"}
xref: PMID:19416101 {source="Europe PMC"}
xref: PMID:19469536 {source="Europe PMC"}
xref: PMID:22153255 {source="Europe PMC"}
xref: PMID:22173419 {source="Europe PMC"}
xref: PPDB:1333
xref: Reaxys:506007 {source="Reaxys"}
xref: Wikipedia:Acetic_acid
is_a: CHEBI:25384 ! monocarboxylic acid
relationship: is_conjugate_acid_of CHEBI:30089 ! acetate
relationship: RO:0000087 CHEBI:48356 ! has role protic solvent
relationship: RO:0000087 CHEBI:64049 ! has role food acidity regulator
relationship: RO:0000087 CHEBI:65256 ! has role antimicrobial food preservative
relationship: RO:0000087 CHEBI:83056 ! has role Daphnia magna metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H4O2/c1-2(3)4/h1H3,(H,3,4)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QTBSBXVTEAMEQO-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "60.05200" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.02113" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(O)=O" xsd:string

[Term]
id: CHEBI:15377
name: water
namespace: chebi_ontology
alt_id: CHEBI:10743
alt_id: CHEBI:13352
alt_id: CHEBI:27313
alt_id: CHEBI:42043
alt_id: CHEBI:42857
alt_id: CHEBI:43228
alt_id: CHEBI:44292
alt_id: CHEBI:44701
alt_id: CHEBI:44819
alt_id: CHEBI:5585
def: "An oxygen hydride consisting of an oxygen atom that is covalently bonded to two hydrogen atoms." []
subset: 3_STAR
synonym: "[OH2]" RELATED [IUPAC]
synonym: "acqua" RELATED [ChEBI]
synonym: "agua" RELATED [ChEBI]
synonym: "aqua" RELATED [ChEBI]
synonym: "BOUND WATER" RELATED [PDBeChem]
synonym: "dihydridooxygen" RELATED [IUPAC]
synonym: "dihydrogen oxide" RELATED [IUPAC]
synonym: "eau" RELATED [ChEBI]
synonym: "H2O" RELATED [KEGG_COMPOUND]
synonym: "H2O" RELATED [UniProt]
synonym: "HOH" RELATED [ChEBI]
synonym: "hydrogen hydroxide" RELATED [ChEBI]
synonym: "oxidane" EXACT IUPAC_NAME [IUPAC]
synonym: "Wasser" RELATED [ChEBI]
synonym: "WATER" EXACT [PDBeChem]
synonym: "Water" EXACT [KEGG_COMPOUND]
synonym: "water" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:3587155 {source="Beilstein"}
xref: CAS:7732-18-5 {source="NIST Chemistry WebBook"}
xref: CAS:7732-18-5 {source="ChemIDplus"}
xref: CAS:7732-18-5 {source="KEGG COMPOUND"}
xref: Gmelin:117 {source="Gmelin"}
xref: HMDB:HMDB0002111
xref: KEGG:C00001
xref: KEGG:D00001
xref: MetaCyc:WATER
xref: MolBase:1
xref: PDBeChem:HOH
xref: Reaxys:3587155 {source="Reaxys"}
xref: Wikipedia:Water
is_a: CHEBI:33693 ! oxygen hydride
is_a: CHEBI:37176 ! mononuclear parent hydride
is_a: CHEBI:52625 ! inorganic hydroxy compound
relationship: is_conjugate_acid_of CHEBI:16234 ! hydroxide
relationship: is_conjugate_base_of CHEBI:29412 ! oxonium
relationship: RO:0000087 CHEBI:48360 ! has role amphiprotic solvent
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:76413 ! has role greenhouse gas
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "18.01530" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "18.01056" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]O[H]" xsd:string

[Term]
id: CHEBI:15379
name: dioxygen
namespace: chebi_ontology
alt_id: CHEBI:10745
alt_id: CHEBI:13416
alt_id: CHEBI:23833
alt_id: CHEBI:25366
alt_id: CHEBI:30491
alt_id: CHEBI:44742
alt_id: CHEBI:7860
subset: 3_STAR
synonym: "[OO]" RELATED [MolBase]
synonym: "dioxygen" EXACT IUPAC_NAME [IUPAC]
synonym: "dioxygene" RELATED [ChEBI]
synonym: "Disauerstoff" RELATED [ChEBI]
synonym: "E 948" RELATED [ChEBI]
synonym: "E-948" RELATED [ChEBI]
synonym: "E948" RELATED [ChEBI]
synonym: "molecular oxygen" RELATED [ChEBI]
synonym: "O2" RELATED [UniProt]
synonym: "O2" RELATED [IUPAC]
synonym: "O2" RELATED [KEGG_COMPOUND]
synonym: "Oxygen" RELATED [KEGG_COMPOUND]
synonym: "OXYGEN MOLECULE" RELATED [PDBeChem]
xref: CAS:7782-44-7 {source="NIST Chemistry WebBook"}
xref: CAS:7782-44-7 {source="ChemIDplus"}
xref: CAS:7782-44-7 {source="KEGG COMPOUND"}
xref: Gmelin:485 {source="Gmelin"}
xref: HMDB:HMDB0001377
xref: KEGG:C00007
xref: KEGG:D00003
xref: MetaCyc:OXYGEN-MOLECULE
xref: MolBase:750
xref: PDBeChem:OXY
xref: PMID:10906528 {source="Europe PMC"}
xref: PMID:16977326 {source="Europe PMC"}
xref: PMID:18210929 {source="Europe PMC"}
xref: PMID:18638417 {source="Europe PMC"}
xref: PMID:19840863 {source="Europe PMC"}
xref: PMID:7710549 {source="Europe PMC"}
xref: PMID:9463773 {source="Europe PMC"}
xref: Wikipedia:Oxygen
is_a: CHEBI:138675 ! gas molecular entity
is_a: CHEBI:25362 ! elemental molecule
is_a: CHEBI:33263 ! diatomic oxygen
relationship: is_conjugate_base_of CHEBI:29793 ! hydridodioxygen(1+)
relationship: RO:0000087 CHEBI:27027 ! has role micronutrient
relationship: RO:0000087 CHEBI:33893 ! has role reagent
relationship: RO:0000087 CHEBI:35472 ! has role anti-inflammatory drug
relationship: RO:0000087 CHEBI:63248 ! has role oxidising agent
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
relationship: RO:0000087 CHEBI:77974 ! has role food packaging gas
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O2/c1-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MYMOFIZGZYHOMD-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "31.99880" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=O" xsd:string

[Term]
id: CHEBI:15428
name: glycine
namespace: chebi_ontology
alt_id: CHEBI:10792
alt_id: CHEBI:14344
alt_id: CHEBI:24368
alt_id: CHEBI:42964
alt_id: CHEBI:5460
def: "The simplest (and the only achiral) proteinogenic amino acid, with a hydrogen atom as its side chain." []
subset: 3_STAR
synonym: "Aminoacetic acid" RELATED [KEGG_COMPOUND]
synonym: "aminoacetic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "Aminoessigsaeure" RELATED [ChEBI]
synonym: "aminoethanoic acid" RELATED [ChEBI]
synonym: "aminoethanoic acid" RELATED [JCBN]
synonym: "G" RELATED [ChEBI]
synonym: "Gly" RELATED [KEGG_COMPOUND]
synonym: "Glycin" RELATED [ChemIDplus]
synonym: "GLYCINE" EXACT [PDBeChem]
synonym: "Glycine" EXACT [KEGG_COMPOUND]
synonym: "glycine" EXACT IUPAC_NAME [IUPAC]
synonym: "Glycocoll" RELATED [ChemIDplus]
synonym: "Glykokoll" RELATED [ChEBI]
synonym: "Glyzin" RELATED [ChEBI]
synonym: "H2N-CH2-COOH" RELATED [IUPAC]
synonym: "Hgly" RELATED [IUPAC]
synonym: "Leimzucker" RELATED [ChemIDplus]
xref: Beilstein:635782 {source="Beilstein"}
xref: CAS:56-40-6 {source="NIST Chemistry WebBook"}
xref: CAS:56-40-6 {source="ChemIDplus"}
xref: CAS:56-40-6 {source="KEGG COMPOUND"}
xref: Drug_Central:1319 {source="DrugCentral"}
xref: DrugBank:DB00145
xref: ECMDB:ECMDB00123
xref: Gmelin:1808 {source="Gmelin"}
xref: HMDB:HMDB0000123
xref: KEGG:C00037
xref: KEGG:D00011
xref: KNApSAcK:C00001361
xref: MetaCyc:GLY
xref: PDBeChem:GLY
xref: PMID:10930630 {source="Europe PMC"}
xref: PMID:11019925 {source="Europe PMC"}
xref: PMID:11174716 {source="Europe PMC"}
xref: PMID:11542461 {source="Europe PMC"}
xref: PMID:11806864 {source="Europe PMC"}
xref: PMID:12631515 {source="Europe PMC"}
xref: PMID:12754315 {source="Europe PMC"}
xref: PMID:12770151 {source="Europe PMC"}
xref: PMID:12921899 {source="Europe PMC"}
xref: PMID:15331688 {source="Europe PMC"}
xref: PMID:15388434 {source="Europe PMC"}
xref: PMID:15710237 {source="Europe PMC"}
xref: PMID:16105183 {source="Europe PMC"}
xref: PMID:16151895 {source="Europe PMC"}
xref: PMID:16214212 {source="Europe PMC"}
xref: PMID:16417482 {source="Europe PMC"}
xref: PMID:16444815 {source="Europe PMC"}
xref: PMID:16664855 {source="Europe PMC"}
xref: PMID:16901953 {source="Europe PMC"}
xref: PMID:16918424 {source="Europe PMC"}
xref: PMID:16986325 {source="Europe PMC"}
xref: PMID:16998855 {source="Europe PMC"}
xref: PMID:17154252 {source="Europe PMC"}
xref: PMID:17383967 {source="Europe PMC"}
xref: PMID:17582620 {source="Europe PMC"}
xref: PMID:17970719 {source="Europe PMC"}
xref: PMID:18079355 {source="Europe PMC"}
xref: PMID:18396796 {source="Europe PMC"}
xref: PMID:18440992 {source="Europe PMC"}
xref: PMID:18593588 {source="Europe PMC"}
xref: PMID:18816054 {source="Europe PMC"}
xref: PMID:18840508 {source="Europe PMC"}
xref: PMID:19028609 {source="Europe PMC"}
xref: PMID:19120667 {source="Europe PMC"}
xref: PMID:19449910 {source="Europe PMC"}
xref: PMID:19526731 {source="Europe PMC"}
xref: PMID:19544666 {source="Europe PMC"}
xref: PMID:19738917 {source="Europe PMC"}
xref: PMID:19916621 {source="Europe PMC"}
xref: PMID:19924257 {source="Europe PMC"}
xref: PMID:21751272 {source="Europe PMC"}
xref: PMID:22044190 {source="Europe PMC"}
xref: PMID:22079563 {source="Europe PMC"}
xref: PMID:22234938 {source="Europe PMC"}
xref: PMID:22264337 {source="Europe PMC"}
xref: PMID:22293292 {source="Europe PMC"}
xref: PMID:22401276 {source="Europe PMC"}
xref: PMID:22434786 {source="Europe PMC"}
xref: Reaxys:635782 {source="Reaxys"}
xref: Wikipedia:Glycine
xref: YMDB:YMDB00016
is_a: CHEBI:26650 ! serine family amino acid
relationship: is_conjugate_acid_of CHEBI:32508 ! glycinate
relationship: is_conjugate_base_of CHEBI:32507 ! glycinium
relationship: is_tautomer_of CHEBI:57305 ! glycine zwitterion
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:27027 ! has role micronutrient
relationship: RO:0000087 CHEBI:50733 ! has role nutraceutical
relationship: RO:0000087 CHEBI:62868 ! has role hepatoprotective agent
relationship: RO:0000087 CHEBI:64570 ! has role EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitor
relationship: RO:0000087 CHEBI:64571 ! has role NMDA receptor agonist
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H5NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "75.06664" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "75.03203" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC(O)=O" xsd:string

[Term]
id: CHEBI:15440
name: squalene
namespace: chebi_ontology
alt_id: CHEBI:10795
alt_id: CHEBI:10843
alt_id: CHEBI:15104
alt_id: CHEBI:26746
alt_id: CHEBI:9245
def: "A triterpene consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration." []
subset: 3_STAR
synonym: "(6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene" EXACT IUPAC_NAME [IUPAC]
synonym: "(all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene" RELATED [NIST_Chemistry_WebBook]
synonym: "Spinacene" RELATED [KEGG_COMPOUND]
synonym: "Squalene" EXACT [KEGG_COMPOUND]
synonym: "squalene" EXACT [UniProt]
synonym: "Supraene" RELATED [KEGG_COMPOUND]
xref: Beilstein:1728920 {source="Beilstein"}
xref: CAS:111-02-4 {source="KEGG COMPOUND"}
xref: CAS:111-02-4 {source="ChemIDplus"}
xref: CAS:111-02-4 {source="NIST Chemistry WebBook"}
xref: HMDB:HMDB0000256
xref: KEGG:C00751
xref: KNApSAcK:C00003755
xref: LIPID_MAPS_instance:LMPR0106010002 {source="LIPID MAPS"}
xref: MetaCyc:SQUALENE
xref: PDBeChem:SQL
xref: PMID:16341241 {source="Europe PMC"}
xref: PMID:23625688 {source="Europe PMC"}
xref: PMID:24362891 {source="Europe PMC"}
xref: PMID:25286851 {source="Europe PMC"}
xref: PMID:25286853 {source="Europe PMC"}
xref: PMID:25987292 {source="Europe PMC"}
xref: Wikipedia:Squalene
is_a: CHEBI:35191 ! triterpene
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C30H50" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C30H50/c1-25(2)15-11-19-29(7)23-13-21-27(5)17-9-10-18-28(6)22-14-24-30(8)20-12-16-26(3)4/h15-18,23-24H,9-14,19-22H2,1-8H3/b27-17+,28-18+,29-23+,30-24+" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YYGNTYWPHWGJRM-AAJYLUCBSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "410.730" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "410.39125" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(C)=CCC\\C(C)=C\\CC\\C(C)=C\\CC\\C=C(/C)CC\\C=C(/C)CCC=C(C)C" xsd:string

[Term]
id: CHEBI:15693
name: aldose
namespace: chebi_ontology
alt_id: CHEBI:13755
alt_id: CHEBI:22305
alt_id: CHEBI:2561
def: "Aldehydic parent sugars (polyhydroxy aldehydes H[CH(OH)]nC(=O)H, n >= 2) and their intramolecular hemiacetals." []
subset: 3_STAR
synonym: "Aldose" EXACT [KEGG_COMPOUND]
synonym: "aldoses" RELATED [ChEBI]
synonym: "an aldose" RELATED [UniProt]
xref: KEGG:C01370
xref: Wikipedia:Aldose
is_a: CHEBI:35381 ! monosaccharide
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4O2(CH2O)n" xsd:string

[Term]
id: CHEBI:15705
name: L-alpha-amino acid
namespace: chebi_ontology
alt_id: CHEBI:13072
alt_id: CHEBI:13243
alt_id: CHEBI:13797
alt_id: CHEBI:21224
alt_id: CHEBI:6175
def: "Any alpha-amino acid having L-configuration at the alpha-carbon." []
subset: 3_STAR
synonym: "L-2-Amino acid" RELATED [KEGG_COMPOUND]
synonym: "L-alpha-amino acid" EXACT [IUPAC]
synonym: "L-alpha-amino acids" EXACT IUPAC_NAME [IUPAC]
synonym: "L-alpha-amino acids" RELATED [ChEBI]
synonym: "L-Amino acid" RELATED [KEGG_COMPOUND]
xref: KEGG:C00151
is_a: CHEBI:33704 ! alpha-amino acid
relationship: is_conjugate_acid_of CHEBI:59814 ! L-alpha-amino acid anion
relationship: is_tautomer_of CHEBI:59869 ! L-alpha-amino acid zwitterion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "N[C@@H]([*])C(O)=O" xsd:string

[Term]
id: CHEBI:15734
name: primary alcohol
namespace: chebi_ontology
alt_id: CHEBI:13676
alt_id: CHEBI:14887
alt_id: CHEBI:26262
alt_id: CHEBI:57489
alt_id: CHEBI:8406
def: "A primary alcohol is a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it." []
subset: 3_STAR
synonym: "1-Alcohol" RELATED [KEGG_COMPOUND]
synonym: "a primary alcohol" RELATED [UniProt]
synonym: "Primary alcohol" EXACT [KEGG_COMPOUND]
synonym: "primary alcohols" RELATED [ChEBI]
xref: KEGG:C00226
is_a: CHEBI:30879 ! alcohol
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "31.034" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.01839" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(O)([H])[H]" xsd:string

[Term]
id: CHEBI:15740
name: formate
namespace: chebi_ontology
alt_id: CHEBI:14276
alt_id: CHEBI:24081
def: "A monocarboxylic acid anion that is the conjugate base of formic acid. Induces severe metabolic acidosis and ocular injury in human subjects." []
subset: 3_STAR
synonym: "aminate" RELATED [ChEBI]
synonym: "formate" EXACT IUPAC_NAME [IUPAC]
synonym: "formate" EXACT [UniProt]
synonym: "formiate" RELATED [ChEBI]
synonym: "formic acid, ion(1-)" RELATED [ChemIDplus]
synonym: "formylate" RELATED [ChEBI]
synonym: "HCO2 anion" RELATED [NIST_Chemistry_WebBook]
synonym: "hydrogen carboxylate" RELATED [ChEBI]
synonym: "methanoate" RELATED [ChEBI]
xref: Beilstein:1901205 {source="Beilstein"}
xref: CAS:71-47-6 {source="ChemIDplus"}
xref: CAS:71-47-6 {source="NIST Chemistry WebBook"}
xref: Gmelin:1006 {source="Gmelin"}
xref: HMDB:HMDB0000142
xref: KEGG:C00058
xref: MetaCyc:FORMATE
xref: PMID:17190852 {source="Europe PMC"}
xref: PMID:3946945 {source="Europe PMC"}
xref: Reaxys:1901205 {source="Reaxys"}
xref: UM-BBD_compID:c0106 {source="UM-BBD"}
xref: Wikipedia:Formate
is_a: CHEBI:35757 ! monocarboxylic acid anion
relationship: is_conjugate_base_of CHEBI:30751 ! formic acid
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O2/c2-1-3/h1H,(H,2,3)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BDAGIHXWWSANSR-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01744" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99820" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C([O-])=O" xsd:string

[Term]
id: CHEBI:15841
name: polypeptide
namespace: chebi_ontology
alt_id: CHEBI:14860
alt_id: CHEBI:8314
def: "A peptide containing ten or more amino acid residues." []
subset: 3_STAR
synonym: "polipeptido" RELATED [ChEBI]
synonym: "Polypeptid" RELATED [ChEBI]
synonym: "Polypeptide" EXACT [KEGG_COMPOUND]
synonym: "polypeptides" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00403
is_a: CHEBI:16670 ! peptide
is_a: CHEBI:33839 ! macromolecule
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H6N2O3R2(C2H2NOR)n" xsd:string

[Term]
id: CHEBI:15986
name: polynucleotide
namespace: chebi_ontology
alt_id: CHEBI:13672
alt_id: CHEBI:14859
alt_id: CHEBI:8312
def: "A nucleobase-containing molecular entity with a polymeric structure comprised of a linear sequence of 13 or more nucleotide residues." []
subset: 3_STAR
synonym: "Polynucleotide" EXACT [KEGG_COMPOUND]
synonym: "polynucleotides" RELATED [ChEBI]
xref: KEGG:C00419
is_a: CHEBI:33695 ! information biomacromolecule
is_a: CHEBI:61120 ! nucleobase-containing molecular entity
relationship: has_part CHEBI:50319 ! nucleotide residue
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "(C5H8O6PR)n.C10H17O10PR2" xsd:string

[Term]
id: CHEBI:16134
name: ammonia
namespace: chebi_ontology
alt_id: CHEBI:13405
alt_id: CHEBI:13406
alt_id: CHEBI:13407
alt_id: CHEBI:13771
alt_id: CHEBI:22533
alt_id: CHEBI:44269
alt_id: CHEBI:44284
alt_id: CHEBI:44404
alt_id: CHEBI:7434
def: "An azane that consists of a single nitrogen atom covelently bonded to three hydrogen atoms." []
subset: 3_STAR
synonym: "[NH3]" RELATED [MolBase]
synonym: "AMMONIA" EXACT [PDBeChem]
synonym: "Ammonia" EXACT [KEGG_COMPOUND]
synonym: "ammonia" EXACT IUPAC_NAME [IUPAC]
synonym: "ammoniac" RELATED [ChEBI]
synonym: "Ammoniak" RELATED [ChemIDplus]
synonym: "amoniaco" RELATED [ChEBI]
synonym: "azane" EXACT IUPAC_NAME [IUPAC]
synonym: "NH3" RELATED [KEGG_COMPOUND]
synonym: "NH3" RELATED [UniProt]
synonym: "NH3" RELATED [IUPAC]
synonym: "R-717" RELATED [ChEBI]
synonym: "spirit of hartshorn" RELATED [ChemIDplus]
xref: Beilstein:3587154 {source="Beilstein"}
xref: CAS:7664-41-7 {source="ChemIDplus"}
xref: CAS:7664-41-7 {source="NIST Chemistry WebBook"}
xref: CAS:7664-41-7 {source="KEGG COMPOUND"}
xref: Drug_Central:4625 {source="DrugCentral"}
xref: Gmelin:79 {source="Gmelin"}
xref: HMDB:HMDB0000051
xref: KEGG:C00014
xref: KEGG:D02916
xref: KNApSAcK:C00007267
xref: MetaCyc:AMMONIA
xref: MolBase:930
xref: PDBeChem:NH3
xref: PMID:110589 {source="Europe PMC"}
xref: PMID:11139349 {source="Europe PMC"}
xref: PMID:11540049 {source="Europe PMC"}
xref: PMID:11746427 {source="Europe PMC"}
xref: PMID:11783653 {source="Europe PMC"}
xref: PMID:13753780 {source="Europe PMC"}
xref: PMID:14663195 {source="Europe PMC"}
xref: PMID:15092448 {source="Europe PMC"}
xref: PMID:15094021 {source="Europe PMC"}
xref: PMID:15554424 {source="Europe PMC"}
xref: PMID:15969015 {source="Europe PMC"}
xref: PMID:16008360 {source="Europe PMC"}
xref: PMID:16050680 {source="Europe PMC"}
xref: PMID:16348008 {source="Europe PMC"}
xref: PMID:16349403 {source="Europe PMC"}
xref: PMID:16614889 {source="Europe PMC"}
xref: PMID:16664306 {source="Europe PMC"}
xref: PMID:16842901 {source="Europe PMC"}
xref: PMID:17025297 {source="Europe PMC"}
xref: PMID:17439666 {source="Europe PMC"}
xref: PMID:17569513 {source="Europe PMC"}
xref: PMID:17737668 {source="Europe PMC"}
xref: PMID:18670398 {source="Europe PMC"}
xref: PMID:22002069 {source="Europe PMC"}
xref: PMID:22081570 {source="Europe PMC"}
xref: PMID:22088435 {source="Europe PMC"}
xref: PMID:22100291 {source="Europe PMC"}
xref: PMID:22130175 {source="Europe PMC"}
xref: PMID:22150211 {source="Europe PMC"}
xref: PMID:22240068 {source="Europe PMC"}
xref: PMID:22290316 {source="Europe PMC"}
xref: PMID:22342082 {source="Europe PMC"}
xref: PMID:22385337 {source="Europe PMC"}
xref: PMID:22443779 {source="Europe PMC"}
xref: PMID:22560242 {source="Europe PMC"}
xref: Reaxys:3587154 {source="Reaxys"}
xref: Wikipedia:Ammonia
is_a: CHEBI:138675 ! gas molecular entity
is_a: CHEBI:35107 ! azane
is_a: CHEBI:37176 ! mononuclear parent hydride
relationship: is_conjugate_acid_of CHEBI:29337 ! azanide
relationship: is_conjugate_base_of CHEBI:28938 ! ammonium
relationship: RO:0000087 CHEBI:50910 ! has role neurotoxin
relationship: RO:0000087 CHEBI:59740 ! has role nucleophilic reagent
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77941 ! has role EC 3.5.1.4 (amidase) inhibitor
relationship: RO:0000087 CHEBI:78433 ! has role refrigerant
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H3N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3N/h1H3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QGZKDVFQNNGYKY-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "17.03056" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.02655" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]N([H])[H]" xsd:string

[Term]
id: CHEBI:16137
name: chondroitin D-glucuronate
namespace: chebi_ontology
alt_id: CHEBI:13989
alt_id: CHEBI:13992
alt_id: CHEBI:23221
alt_id: CHEBI:3673
def: "A mucopolysaccharide composed of repeating beta-D-glucopyranuronosyl-(1->3)-beta-D-N-acetylgalactosaminyl units." []
subset: 3_STAR
synonym: "Chondroitin" RELATED [KEGG_COMPOUND]
synonym: "Chondroitin-D-glucuronate" RELATED [KEGG_COMPOUND]
xref: KEGG:C00401
xref: KEGG:G11334
is_a: CHEBI:37395 ! mucopolysaccharide
relationship: is_conjugate_acid_of CHEBI:57652 ! chondroitin D-glucuronate anion
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H21NO11)nH2O" xsd:string

[Term]
id: CHEBI:16189
name: sulfate
namespace: chebi_ontology
alt_id: CHEBI:15135
alt_id: CHEBI:45687
alt_id: CHEBI:9335
def: "A sulfur oxoanion obtained by deprotonation of both OH groups of sulfuric acid." []
subset: 3_STAR
synonym: "[SO4](2-)" RELATED [IUPAC]
synonym: "SO4(2-)" RELATED [IUPAC]
synonym: "Sulfate" EXACT [KEGG_COMPOUND]
synonym: "sulfate" EXACT [UniProt]
synonym: "sulfate" EXACT IUPAC_NAME [IUPAC]
synonym: "Sulfate anion(2-)" RELATED [HMDB]
synonym: "Sulfate dianion" RELATED [HMDB]
synonym: "SULFATE ION" RELATED [PDBeChem]
synonym: "Sulfate(2-)" RELATED [HMDB]
synonym: "Sulfuric acid ion(2-)" RELATED [HMDB]
synonym: "sulphate" RELATED [ChEBI]
synonym: "sulphate ion" RELATED [ChEBI]
synonym: "tetraoxidosulfate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "tetraoxosulfate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "tetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:3648446 {source="Beilstein"}
xref: CAS:14808-79-8 {source="ChemIDplus"}
xref: CAS:14808-79-8 {source="NIST Chemistry WebBook"}
xref: Gmelin:2120 {source="Gmelin"}
xref: HMDB:HMDB0001448
xref: KEGG:C00059
xref: KEGG:D05963
xref: MetaCyc:SULFATE
xref: PDBeChem:SO4
xref: PMID:11200094 {source="Europe PMC"}
xref: PMID:11452993 {source="Europe PMC"}
xref: PMID:11581495 {source="Europe PMC"}
xref: PMID:11798107 {source="Europe PMC"}
xref: PMID:12166931 {source="Europe PMC"}
xref: PMID:12668033 {source="Europe PMC"}
xref: PMID:14597181 {source="Europe PMC"}
xref: PMID:15093386 {source="Europe PMC"}
xref: PMID:15984785 {source="Europe PMC"}
xref: PMID:16186560 {source="Europe PMC"}
xref: PMID:16345535 {source="Europe PMC"}
xref: PMID:16347366 {source="Europe PMC"}
xref: PMID:16348007 {source="Europe PMC"}
xref: PMID:16483812 {source="Europe PMC"}
xref: PMID:16534979 {source="Europe PMC"}
xref: PMID:16656509 {source="Europe PMC"}
xref: PMID:16742508 {source="Europe PMC"}
xref: PMID:16742518 {source="Europe PMC"}
xref: PMID:17120760 {source="Europe PMC"}
xref: PMID:17420092 {source="Europe PMC"}
xref: PMID:17439666 {source="Europe PMC"}
xref: PMID:17709180 {source="Europe PMC"}
xref: PMID:18398178 {source="Europe PMC"}
xref: PMID:18815700 {source="Europe PMC"}
xref: PMID:18846414 {source="Europe PMC"}
xref: PMID:19047345 {source="Europe PMC"}
xref: PMID:19244483 {source="Europe PMC"}
xref: PMID:19544990 {source="Europe PMC"}
xref: PMID:19628332 {source="Europe PMC"}
xref: PMID:19812358 {source="Europe PMC"}
xref: PMID:30398859 {source="Europe PMC"}
xref: Reaxys:3648446 {source="Reaxys"}
xref: Wikipedia:Sulfate
is_a: CHEBI:33482 ! sulfur oxoanion
is_a: CHEBI:48154 ! sulfur oxide
is_a: CHEBI:79388 ! divalent inorganic anion
relationship: is_conjugate_base_of CHEBI:45696 ! hydrogensulfate
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O4S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-L" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06360" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95283" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]S([O-])(=O)=O" xsd:string

[Term]
id: CHEBI:16234
name: hydroxide
namespace: chebi_ontology
alt_id: CHEBI:13365
alt_id: CHEBI:13419
alt_id: CHEBI:44641
alt_id: CHEBI:5594
subset: 3_STAR
synonym: "HO-" RELATED [KEGG_COMPOUND]
synonym: "hydridooxygenate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydroxide" EXACT IUPAC_NAME [IUPAC]
synonym: "HYDROXIDE ION" RELATED [PDBeChem]
synonym: "Hydroxide ion" RELATED [KEGG_COMPOUND]
synonym: "OH(-)" RELATED [IUPAC]
synonym: "OH-" RELATED [KEGG_COMPOUND]
synonym: "oxidanide" EXACT IUPAC_NAME [IUPAC]
xref: CAS:14280-30-9 {source="ChemIDplus"}
xref: CAS:14280-30-9 {source="NIST Chemistry WebBook"}
xref: Gmelin:24714 {source="Gmelin"}
xref: KEGG:C01328
xref: PDBeChem:OH
is_a: CHEBI:33693 ! oxygen hydride
relationship: is_conjugate_base_of CHEBI:15377 ! water
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "17.00734" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00329" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-][H]" xsd:string

[Term]
id: CHEBI:16336
name: hyaluronic acid
namespace: chebi_ontology
alt_id: CHEBI:14412
alt_id: CHEBI:24622
alt_id: CHEBI:24623
alt_id: CHEBI:5772
def: "A mucopolysaccharide composed of N-acetylglucosamine and glucuronic acid subunits. It is found in the connective tissues of vertebrates. A principal constituent of the extracellular matrix (ECM), it mediates the growth and metastasis of tumour cells." []
subset: 3_STAR
synonym: "[beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n" RELATED [ChEBI]
synonym: "[beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n" RELATED [KEGG_COMPOUND]
synonym: "acide hyaluronique" RELATED [ChEBI]
synonym: "acido hialuronico" RELATED [ChEBI]
synonym: "hyaluronan" RELATED [ChEBI]
synonym: "Hyaluronic acid" EXACT [KEGG_COMPOUND]
synonym: "Hyaluronsaeure" RELATED [ChEBI]
xref: Beilstein:8538277 {source="Beilstein"}
xref: CAS:9004-61-9 {source="KEGG COMPOUND"}
xref: CAS:9004-61-9 {source="ChemIDplus"}
xref: HMDB:HMDB0010366
xref: KEGG:C00518
xref: KEGG:D08043
xref: KEGG:G10505
xref: PMID:11122186 {source="Europe PMC"}
xref: PMID:18056362 {source="Europe PMC"}
xref: PMID:18290544 {source="Europe PMC"}
xref: Reaxys:8187837 {source="Reaxys"}
xref: Wikipedia:Hyaluronan
is_a: CHEBI:37395 ! mucopolysaccharide
is_a: CHEBI:72813 ! exopolysaccharide
relationship: is_conjugate_acid_of CHEBI:132153 ! hyaluronate
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H21NO12)n" xsd:string

[Term]
id: CHEBI:16480
name: nitric oxide
namespace: chebi_ontology
alt_id: CHEBI:14657
alt_id: CHEBI:25546
alt_id: CHEBI:44452
alt_id: CHEBI:7583
def: "A nitrogen oxide which is a free radical, each molecule of which consists of one nitrogen and one oxygen atom." []
subset: 3_STAR
synonym: "(.)NO" RELATED [ChEBI]
synonym: "(NO)(.)" RELATED [IUPAC]
synonym: "[NO]" RELATED [MolBase]
synonym: "EDRF" RELATED [ChEBI]
synonym: "endothelium-derived relaxing factor" RELATED [ChEBI]
synonym: "mononitrogen monoxide" RELATED [ChemIDplus]
synonym: "monoxido de nitrogeno" RELATED [ChEBI]
synonym: "monoxyde d'azote" RELATED [ChEBI]
synonym: "Nitric oxide" EXACT [KEGG_COMPOUND]
synonym: "nitric oxide" EXACT [UniProt]
synonym: "nitrogen monooxide" RELATED [IUPAC]
synonym: "Nitrogen monoxide" RELATED [KEGG_COMPOUND]
synonym: "nitrogen monoxide" RELATED [IUPAC]
synonym: "nitrosyl" RELATED [IUPAC]
synonym: "NO" RELATED [KEGG_COMPOUND]
synonym: "NO(.)" RELATED [IUPAC]
synonym: "oxido de nitrogeno(II)" RELATED [ChEBI]
synonym: "oxido nitrico" RELATED [ChEBI]
synonym: "oxidonitrogen(.)" EXACT IUPAC_NAME [IUPAC]
synonym: "oxoazanyl" EXACT IUPAC_NAME [IUPAC]
synonym: "oxyde azotique" RELATED [ChEBI]
synonym: "oxyde nitrique" RELATED [ChEBI]
synonym: "Stickstoff(II)-oxid" RELATED [ChEBI]
synonym: "Stickstoffmonoxid" RELATED [ChEBI]
xref: CAS:10102-43-9 {source="KEGG COMPOUND"}
xref: CAS:10102-43-9 {source="NIST Chemistry WebBook"}
xref: CAS:10102-43-9 {source="ChemIDplus"}
xref: DrugBank:DB00435
xref: Gmelin:451 {source="Gmelin"}
xref: KEGG:C00533
xref: KEGG:D00074
xref: MolBase:943
xref: PDBeChem:NO
xref: Reaxys:3587257 {source="Reaxys"}
xref: Wikipedia:Nitric_oxide
is_a: CHEBI:35196 ! nitrogen oxide
is_a: CHEBI:36871 ! inorganic radical
is_a: CHEBI:62764 ! reactive nitrogen species
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:35523 ! has role bronchodilator agent
relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent
relationship: RO:0000087 CHEBI:48578 ! has role radical scavenger
relationship: RO:0000087 CHEBI:62488 ! has role signalling molecule
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "NO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/NO/c1-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MWUXSHHQAYIFBG-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "30.00614" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.99799" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[N]=O" xsd:string

[Term]
id: CHEBI:16541
name: protein polypeptide chain
namespace: chebi_ontology
alt_id: CHEBI:8526
def: "A naturally occurring polypeptide synthesized at the ribosome." []
subset: 3_STAR
synonym: "polypeptide chain" RELATED [ChEBI]
synonym: "Protein" RELATED [KEGG_COMPOUND]
synonym: "protein polypeptide chains" RELATED [ChEBI]
xref: KEGG:C00017
is_a: CHEBI:15841 ! polypeptide
relationship: has_part CHEBI:33700 ! proteinogenic amino-acid residue

[Term]
id: CHEBI:16646
name: carbohydrate
namespace: chebi_ontology
alt_id: CHEBI:15131
alt_id: CHEBI:23008
alt_id: CHEBI:9318
def: "Any member of the class of organooxygen compounds that is a polyhydroxy-aldehyde or -ketone or a lactol resulting from their intramolecular condensation (monosaccharides); substances derived from these by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom; and polymeric products arising by intermolecular acetal formation between two or more such molecules (disaccharides, polysaccharides and oligosaccharides). Carbohydrates contain only carbon, hydrogen and oxygen atoms; prior to any oxidation or reduction, most have the empirical formula Cm(H2O)n. Compounds obtained from carbohydrates by substitution, etc., are known as carbohydrate derivatives and may contain other elements. Cyclitols are generally not regarded as carbohydrates." []
subset: 3_STAR
synonym: "carbohidrato" RELATED [IUPAC]
synonym: "carbohidratos" RELATED [IUPAC]
synonym: "carbohydrate" EXACT IUPAC_NAME [IUPAC]
synonym: "carbohydrates" EXACT IUPAC_NAME [IUPAC]
synonym: "glucide" RELATED [ChEBI]
synonym: "glucides" RELATED [ChEBI]
synonym: "glucido" RELATED [ChEBI]
synonym: "glucidos" RELATED [ChEBI]
synonym: "hydrates de carbone" RELATED [ChEBI]
synonym: "Kohlenhydrat" RELATED [ChEBI]
synonym: "Kohlenhydrate" RELATED [ChEBI]
synonym: "saccharide" RELATED [IUPAC]
synonym: "saccharides" RELATED [IUPAC]
synonym: "saccharidum" RELATED [ChEBI]
xref: Wikipedia:Carbohydrate
is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives

[Term]
id: CHEBI:16670
name: peptide
namespace: chebi_ontology
alt_id: CHEBI:14753
alt_id: CHEBI:25906
alt_id: CHEBI:7990
def: "Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from alpha-amino acids, but it includes those derived from any amino carboxylic acid. X = OH, OR, NH2, NHR, etc." []
subset: 3_STAR
synonym: "Peptid" RELATED [ChEBI]
synonym: "Peptide" EXACT [KEGG_COMPOUND]
synonym: "peptides" EXACT IUPAC_NAME [IUPAC]
synonym: "peptido" RELATED [ChEBI]
synonym: "peptidos" RELATED [ChEBI]
xref: KEGG:C00012
is_a: CHEBI:37622 ! carboxamide
is_a: CHEBI:50047 ! organic amino compound
relationship: has_part CHEBI:33708 ! amino-acid residue
relationship: is_tautomer_of CHEBI:60466 ! peptide zwitterion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "(C2H2NOR)nC2H3NOR" xsd:string

[Term]
id: CHEBI:166902
name: noradrenaline(1+)
namespace: chebi_ontology
subset: 2_STAR
synonym: "noradrenaline" RELATED [UniProt]
is_a: CHEBI:25697 ! organic cation
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:33569 ! noradrenaline
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H12NO3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "170.187" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "170.08117" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=CC(=CC(=C1O)O)C(C[NH3+])O" xsd:string

[Term]
id: CHEBI:167559
name: glycan
namespace: chebi_ontology
def: "Any oligosaccharide, polysaccharide or their derivatives consisting of monosaccharides or monosaccharide derivatives linked by glycosidic bonds. See also http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001." []
subset: 3_STAR
synonym: "glycans" RELATED [ChEBI]
is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives

[Term]
id: CHEBI:16765
name: tryptamine
namespace: chebi_ontology
alt_id: CHEBI:15274
alt_id: CHEBI:27161
alt_id: CHEBI:46157
alt_id: CHEBI:9767
def: "An aminoalkylindole consisting of indole having a 2-aminoethyl group at the 3-position." []
subset: 3_STAR
synonym: "1H-indole-3-ethanamine" RELATED [NIST_Chemistry_WebBook]
synonym: "2-(1H-INDOL-3-YL)ETHANAMINE" RELATED [PDBeChem]
synonym: "2-(1H-indol-3-yl)ethanamine" EXACT IUPAC_NAME [IUPAC]
synonym: "2-(3-indolyl)ethylamine" RELATED [ChemIDplus]
synonym: "3-(2-Aminoethyl)indole" RELATED [KEGG_COMPOUND]
synonym: "Tryptamine" EXACT [KEGG_COMPOUND]
xref: Beilstein:125513 {source="Beilstein"}
xref: CAS:61-54-1 {source="ChemIDplus"}
xref: CAS:61-54-1 {source="NIST Chemistry WebBook"}
xref: CAS:61-54-1 {source="KEGG COMPOUND"}
xref: DrugBank:DB08653
xref: Gmelin:603448 {source="Gmelin"}
xref: HMDB:HMDB0000303
xref: KEGG:C00398
xref: KNApSAcK:C00001434
xref: MetaCyc:TRYPTAMINE
xref: PDBeChem:TSS
xref: PMID:16126914 {source="Europe PMC"}
xref: PMID:22770225 {source="Europe PMC"}
xref: PMID:24345948 {source="Europe PMC"}
xref: PMID:24558969 {source="Europe PMC"}
xref: Reaxys:125513 {source="Reaxys"}
xref: Wikipedia:Tryptamine
is_a: CHEBI:27162 ! tryptamines
is_a: CHEBI:38631 ! aminoalkylindole
is_a: CHEBI:38958 ! indole alkaloid
is_a: CHEBI:64365 ! aralkylamino compound
relationship: is_conjugate_base_of CHEBI:57887 ! tryptaminium
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H12N2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "APJYDQYYACXCRM-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "160.21570" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "160.10005" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1c[nH]c2ccccc12" xsd:string

[Term]
id: CHEBI:16796
name: melatonin
namespace: chebi_ontology
alt_id: CHEBI:14577
alt_id: CHEBI:25180
alt_id: CHEBI:6730
def: "A member of the class of  acetamides that is acetamide in which one of the hydrogens attached to the nitrogen atom is replaced by a 2-(5-methoxy-1H-indol-3-yl)ethyl group. It is a hormone secreted by the pineal gland in humans." []
subset: 3_STAR
synonym: "5-methoxy-N-acetyltryptamine" RELATED [ChemIDplus]
synonym: "Melatonin" EXACT [KEGG_COMPOUND]
synonym: "melatonin" EXACT [UniProt]
synonym: "melatonine" RELATED [ChEBI]
synonym: "N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide" EXACT IUPAC_NAME [IUPAC]
synonym: "N-[2-(5-methoxyindol-3-yl)ethyl]acetamide" RELATED [NIST_Chemistry_WebBook]
synonym: "N-Acetyl-5-methoxytryptamine" RELATED [KEGG_COMPOUND]
xref: Beilstein:205542 {source="Beilstein"}
xref: CAS:73-31-4 {source="ChemIDplus"}
xref: CAS:73-31-4 {source="NIST Chemistry WebBook"}
xref: CAS:73-31-4 {source="KEGG COMPOUND"}
xref: Drug_Central:1672 {source="DrugCentral"}
xref: DrugBank:DB01065
xref: HMDB:HMDB0001389
xref: KEGG:C01598
xref: KEGG:D08170
xref: LINCS:LSM-4779
xref: MetaCyc:N-ACETYL-5-METHOXY-TRYPTAMINE
xref: PDBeChem:ML1
xref: PMID:16678784 {source="Europe PMC"}
xref: PMID:18212404 {source="Europe PMC"}
xref: PMID:18485664 {source="Europe PMC"}
xref: PMID:8290600 {source="Europe PMC"}
xref: Reaxys:205542 {source="Reaxys"}
xref: Wikipedia:Melatonin
is_a: CHEBI:22160 ! acetamides
is_a: CHEBI:27162 ! tryptamines
relationship: has_functional_parent CHEBI:16765 ! tryptamine
relationship: RO:0000087 CHEBI:176497 ! has role geroprotector
relationship: RO:0000087 CHEBI:24621 ! has role hormone
relationship: RO:0000087 CHEBI:35623 ! has role anticonvulsant
relationship: RO:0000087 CHEBI:48578 ! has role radical scavenger
relationship: RO:0000087 CHEBI:50847 ! has role immunological adjuvant
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C13H16N2O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C13H16N2O2/c1-9(16)14-6-5-10-8-15-13-4-3-11(17-2)7-12(10)13/h3-4,7-8,15H,5-6H2,1-2H3,(H,14,16)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DRLFMBDRBRZALE-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "232.283" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "232.12118" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C=1C=C(C=C2C(=CNC12)CCNC(=O)C)OC" xsd:string

[Term]
id: CHEBI:16865
name: gamma-aminobutyric acid
namespace: chebi_ontology
alt_id: CHEBI:1786
alt_id: CHEBI:193777
alt_id: CHEBI:20318
alt_id: CHEBI:40483
def: "A gamma-amino acid that is butanoic acid with the amino substituent located at C-4." []
subset: 3_STAR
synonym: "4-Aminobutanoic acid" RELATED [KEGG_COMPOUND]
synonym: "4-aminobutanoic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "4-aminobutanoic acid" RELATED [ChEBI]
synonym: "4-Aminobutyric acid" RELATED [KEGG_COMPOUND]
synonym: "4-aminobutyric acid" RELATED [ChEBI]
synonym: "4Abu" RELATED [ChEBI]
synonym: "GABA" RELATED [KEGG_COMPOUND]
synonym: "GABA" RELATED [IUPHAR]
synonym: "GAMMA-AMINO-BUTANOIC ACID" RELATED [PDBeChem]
synonym: "gamma-amino-n-butyric acid" RELATED [NIST_Chemistry_WebBook]
synonym: "gamma-aminobutanoic acid" RELATED [NIST_Chemistry_WebBook]
synonym: "gamma-Aminobuttersaeure" RELATED [NIST_Chemistry_WebBook]
synonym: "gamma-Aminobutyric acid" EXACT [KEGG_COMPOUND]
synonym: "gamma-aminobutyric acid" EXACT [NIST_Chemistry_WebBook]
synonym: "omega-aminobutyric acid" RELATED [NIST_Chemistry_WebBook]
synonym: "piperidic acid" RELATED [ChemIDplus]
synonym: "piperidinic acid" RELATED [ChemIDplus]
xref: Beilstein:906818 {source="Beilstein"}
xref: BPDB:2298
xref: CAS:56-12-2 {source="ChemIDplus"}
xref: CAS:56-12-2 {source="NIST Chemistry WebBook"}
xref: CAS:56-12-2 {source="KEGG COMPOUND"}
xref: Drug_Central:1262 {source="DrugCentral"}
xref: DrugBank:DB02530
xref: Gmelin:49775 {source="Gmelin"}
xref: HMDB:HMDB0000112
xref: KEGG:C00334
xref: KEGG:D00058
xref: KNApSAcK:C00001337
xref: LIPID_MAPS_instance:LMFA01100039 {source="LIPID MAPS"}
xref: MetaCyc:4-AMINO-BUTYRATE
xref: PDBeChem:ABU
xref: PMID:10630630 {source="Europe PMC"}
xref: PMID:10930630 {source="Europe PMC"}
xref: PMID:16276116 {source="Europe PMC"}
xref: PMID:21614609 {source="Europe PMC"}
xref: PMID:22770225 {source="Europe PMC"}
xref: Reaxys:906818 {source="Reaxys"}
xref: Wikipedia:Gamma-Aminobutyric_acid
is_a: CHEBI:25384 ! monocarboxylic acid
is_a: CHEBI:33707 ! gamma-amino acid
relationship: has_functional_parent CHEBI:30772 ! butyric acid
relationship: is_conjugate_acid_of CHEBI:30566 ! gamma-aminobutyrate
relationship: is_tautomer_of CHEBI:59888 ! gamma-aminobutyric acid zwitterion
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:62488 ! has role signalling molecule
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H9NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "103.11980" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "103.06333" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCCC(O)=O" xsd:string

[Term]
id: CHEBI:16990
name: bilirubin IXalpha
namespace: chebi_ontology
alt_id: CHEBI:13898
alt_id: CHEBI:22870
alt_id: CHEBI:3099
def: "A member of the class of  biladienes that is a linear tetrapyrrole with the dipyrrole units being of both exovinyl and endovinyl type. A product of heme degradation, it is produced in the reticuloendothelial system by the reduction of biliverdin and transported to the liver as a complex with serum albumin." []
subset: 3_STAR
synonym: "1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid" RELATED [ChemIDplus]
synonym: "2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid" RELATED [ChemIDplus]
synonym: "2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid" RELATED [IUPAC]
synonym: "3,18-diethenyl-2,7,13,17-tetramethyl-1,19-dioxo-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione" RELATED [JCBN]
synonym: "Bilirubin" RELATED [KEGG_COMPOUND]
synonym: "bilirubin" EXACT IUPAC_NAME [IUPAC]
synonym: "bilirubin(Z,Z)" RELATED [ChEBI]
synonym: "bilirubin-IXalpha" RELATED [ChEBI]
xref: Beilstein:74376 {source="Beilstein"}
xref: CAS:635-65-4 {source="KEGG COMPOUND"}
xref: CAS:635-65-4 {source="ChemIDplus"}
xref: Gmelin:411033 {source="Gmelin"}
xref: HMDB:HMDB0000054
xref: KEGG:C00486
xref: KNApSAcK:C00029828
xref: MetaCyc:BILIRUBIN
xref: PMID:12799017 {source="Europe PMC"}
xref: PMID:18442622 {source="Europe PMC"}
xref: PMID:23763371 {source="Europe PMC"}
xref: PMID:8605219 {source="Europe PMC"}
xref: PMID:9587403 {source="Europe PMC"}
xref: Reaxys:74376 {source="Reaxys"}
xref: Wikipedia:Bilirubin
is_a: CHEBI:35692 ! dicarboxylic acid
is_a: CHEBI:36735 ! biladienes
relationship: has_part CHEBI:142163 ! 24G7 epitope
relationship: is_conjugate_acid_of CHEBI:57977 ! bilirubin(2-)
relationship: RO:0000087 CHEBI:22586 ! has role antioxidant
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C33H36N4O6" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/b26-13-,27-14-" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BPYKTIZUTYGOLE-IFADSCNNSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "584.66230" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "584.26348" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC1=C(C=C)\\C(NC1=O)=C\\c1[nH]c(Cc2[nH]c(\\C=C3NC(=O)C(C=C)=C/3C)c(C)c2CCC(O)=O)c(CCC(O)=O)c1C" xsd:string

[Term]
id: CHEBI:16991
name: deoxyribonucleic acid
namespace: chebi_ontology
alt_id: CHEBI:13302
alt_id: CHEBI:21123
alt_id: CHEBI:33698
alt_id: CHEBI:4291
def: "High molecular weight, linear polymers, composed of nucleotides containing deoxyribose and linked by phosphodiester bonds; DNA contain the genetic information of organisms." []
subset: 3_STAR
synonym: "(Deoxyribonucleotide)m" RELATED [KEGG_COMPOUND]
synonym: "(Deoxyribonucleotide)n" RELATED [KEGG_COMPOUND]
synonym: "(Deoxyribonucleotide)n+m" RELATED [KEGG_COMPOUND]
synonym: "Deoxyribonucleic acid" EXACT [KEGG_COMPOUND]
synonym: "deoxyribonucleic acids" EXACT IUPAC_NAME [IUPAC]
synonym: "deoxyribonucleic acids" RELATED [ChEBI]
synonym: "Desoxyribonukleinsaeure" RELATED [ChEBI]
synonym: "desoxyribose nucleic acid" RELATED [ChemIDplus]
synonym: "DNA" RELATED [KEGG_COMPOUND]
synonym: "DNA" RELATED [IUPAC]
synonym: "DNAn" RELATED [KEGG_COMPOUND]
synonym: "DNAn+1" RELATED [KEGG_COMPOUND]
synonym: "DNS" RELATED [ChEBI]
synonym: "thymus nucleic acid" RELATED [ChEBI]
xref: CAS:9007-49-2 {source="ChemIDplus"}
xref: CAS:9007-49-2 {source="KEGG COMPOUND"}
xref: KEGG:C00039
is_a: CHEBI:33696 ! nucleic acid
relationship: has_part CHEBI:33793 ! canonical deoxyribonucleoside residue
relationship: has_part CHEBI:50298 ! canonical deoxyribonucleotide residue
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite

[Term]
id: CHEBI:17026
name: progesterone
namespace: chebi_ontology
alt_id: CHEBI:14896
alt_id: CHEBI:18798
alt_id: CHEBI:26269
alt_id: CHEBI:439
alt_id: CHEBI:45786
alt_id: CHEBI:8453
def: "A C21-steroid hormone in which a pregnane skeleton carries oxo substituents at positions 3 and 20 and is unsaturated at C(4)-C(5). As a hormone, it is involved in the female menstrual cycle, pregnancy and embryogenesis of humans and other species." []
subset: 3_STAR
synonym: "(S)-4-Pregnene-3,20-dione" RELATED [KEGG_COMPOUND]
synonym: "(S)-Pregn-4-en-3,20-dione" RELATED [KEGG_COMPOUND]
synonym: "(S)-Progesterone" RELATED [KEGG_COMPOUND]
synonym: "17alpha-progesterone" RELATED [NIST_Chemistry_WebBook]
synonym: "4-Pregnene-3,20-dione" RELATED [KEGG_COMPOUND]
synonym: "Agolutin" RELATED [NIST_Chemistry_WebBook]
synonym: "Akrolutin" RELATED [ChEBI]
synonym: "corpus luteum hormone" RELATED [ChemIDplus]
synonym: "Crinone" RELATED [ChemIDplus]
synonym: "Delta(4)-pregnene-3,20-dione" RELATED [ChEBI]
synonym: "Gelbkoerperhormon" RELATED [ChEBI]
synonym: "luteohormone" RELATED [ChemIDplus]
synonym: "pregn-4-ene-3,20-dione" EXACT IUPAC_NAME [IUPAC]
synonym: "Progesteron" RELATED [ChEBI]
synonym: "PROGESTERONE" EXACT [PDBeChem]
synonym: "Progesterone" EXACT [KEGG_COMPOUND]
synonym: "progesterone" EXACT [UniProt]
xref: Beilstein:1915950 {source="Beilstein"}
xref: CAS:57-83-0 {source="KEGG COMPOUND"}
xref: CAS:57-83-0 {source="ChemIDplus"}
xref: CAS:57-83-0 {source="NIST Chemistry WebBook"}
xref: Drug_Central:2279 {source="DrugCentral"}
xref: DrugBank:DB00396
xref: Gmelin:708590 {source="Gmelin"}
xref: HMDB:HMDB0001830
xref: KEGG:C00410
xref: KEGG:D00066
xref: MetaCyc:PROGESTERONE
xref: PDBeChem:STR
xref: PMID:10438974 {source="Europe PMC"}
xref: PMID:9506942 {source="Europe PMC"}
xref: Reaxys:1915950 {source="Reaxys"}
xref: Wikipedia:Progesterone
is_a: CHEBI:36885 ! 20-oxo steroid
is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid
is_a: CHEBI:64600 ! C21-steroid hormone
relationship: has_parent_hydride CHEBI:8386 ! pregnane
relationship: RO:0000087 CHEBI:49323 ! has role contraceptive drug
relationship: RO:0000087 CHEBI:59826 ! has role progestin
relationship: RO:0000087 CHEBI:70709 ! has role progesterone receptor agonist
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H30O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H30O2/c1-13(22)17-6-7-18-16-5-4-14-12-15(23)8-10-20(14,2)19(16)9-11-21(17,18)3/h12,16-19H,4-11H2,1-3H3/t16-,17+,18-,19-,20-,21+/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RJKFOVLPORLFTN-LEKSSAKUSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "314.46170" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "314.22458" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3=CC(=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@H](CC[C@@]21[H])C(C)=O" xsd:string

[Term]
id: CHEBI:17087
name: ketone
namespace: chebi_ontology
alt_id: CHEBI:13427
alt_id: CHEBI:13646
alt_id: CHEBI:24974
alt_id: CHEBI:6127
alt_id: CHEBI:8742
def: "A compound in which a carbonyl group is bonded to two carbon atoms: R2C=O (neither R may be H)." []
subset: 3_STAR
synonym: "a ketone" RELATED [UniProt]
synonym: "cetone" RELATED [ChEBI]
synonym: "Keton" RELATED [ChEBI]
synonym: "Ketone" EXACT [KEGG_COMPOUND]
synonym: "ketones" EXACT IUPAC_NAME [IUPAC]
synonym: "ketones" RELATED [ChEBI]
synonym: "R-CO-R'" RELATED [KEGG_COMPOUND]
xref: KEGG:C01450
xref: Wikipedia:Ketone
is_a: CHEBI:36586 ! carbonyl compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "COR2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "28.010" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "27.99491" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C([*])=O" xsd:string

[Term]
id: CHEBI:17089
name: glycoprotein
namespace: chebi_ontology
alt_id: CHEBI:14349
alt_id: CHEBI:5481
alt_id: CHEBI:5493
def: "A compound in which a carbohydrate component is covalently bound to a protein component." []
subset: 3_STAR
synonym: "glicoproteina" RELATED [ChEBI]
synonym: "glicoproteinas" RELATED [ChEBI]
synonym: "Glycoprotein" EXACT [KEGG_COMPOUND]
synonym: "glycoproteine" RELATED [ChEBI]
synonym: "glycoproteines" RELATED [ChEBI]
synonym: "glycoproteins" EXACT IUPAC_NAME [IUPAC]
synonym: "Glykoprotein" RELATED [ChEBI]
synonym: "Glykoproteine" RELATED [ChEBI]
xref: KEGG:C00326
is_a: CHEBI:33837 ! conjugated protein
is_a: CHEBI:63299 ! carbohydrate derivative

[Term]
id: CHEBI:17234
name: glucose
namespace: chebi_ontology
alt_id: CHEBI:14313
alt_id: CHEBI:24277
alt_id: CHEBI:33929
alt_id: CHEBI:5418
def: "An aldohexose used as a source of energy and metabolic intermediate." []
subset: 3_STAR
synonym: "DL-glucose" RELATED [ChEBI]
synonym: "Glc" RELATED [JCBN]
synonym: "gluco-hexose" EXACT IUPAC_NAME [IUPAC]
synonym: "Glucose" EXACT [KEGG_COMPOUND]
synonym: "glucose" EXACT IUPAC_NAME [IUPAC]
synonym: "Glukose" RELATED [ChEBI]
xref: CAS:50-99-7 {source="KEGG COMPOUND"}
xref: KEGG:C00293
xref: Wikipedia:Glucose
is_a: CHEBI:33917 ! aldohexose
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H12O6" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "180.15588" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "180.06339" xsd:string

[Term]
id: CHEBI:17347
name: testosterone
namespace: chebi_ontology
alt_id: CHEBI:15214
alt_id: CHEBI:26883
alt_id: CHEBI:45798
alt_id: CHEBI:9461
def: "An androstanoid having 17beta-hydroxy and 3-oxo groups, together with unsaturation at C-4-C-5.." []
subset: 3_STAR
synonym: "17beta-Hydroxy-4-androsten-3-one" RELATED [KEGG_COMPOUND]
synonym: "17beta-hydroxy-4-androsten-3-one" RELATED [ChEBI]
synonym: "17beta-hydroxyandrost-4-en-3-one" EXACT IUPAC_NAME [IUPAC]
synonym: "4-androsten-17beta-ol-3-one" RELATED [NIST_Chemistry_WebBook]
synonym: "Androderm" RELATED [ChemIDplus]
synonym: "Testosteron" RELATED [ChemIDplus]
synonym: "testosterona" RELATED INN [ChemIDplus]
synonym: "TESTOSTERONE" EXACT [PDBeChem]
synonym: "Testosterone" EXACT [KEGG_COMPOUND]
synonym: "testosterone" EXACT [UniProt]
synonym: "testosterone" RELATED INN [ChemIDplus]
synonym: "testosteronum" RELATED INN [ChemIDplus]
xref: Beilstein:1915399 {source="Beilstein"}
xref: Beilstein:3653705 {source="Beilstein"}
xref: CAS:58-22-0 {source="NIST Chemistry WebBook"}
xref: CAS:58-22-0 {source="ChemIDplus"}
xref: CAS:58-22-0 {source="KEGG COMPOUND"}
xref: Drug_Central:2607 {source="DrugCentral"}
xref: DrugBank:DB00624
xref: Gmelin:538843 {source="Gmelin"}
xref: HMDB:HMDB0000234
xref: KEGG:C00535
xref: KEGG:D00075
xref: KNApSAcK:C00003675
xref: LIPID_MAPS_instance:LMST02020002 {source="LIPID MAPS"}
xref: PDBeChem:TES
xref: PMID:10438974 {source="Europe PMC"}
xref: PMID:11786693 {source="Europe PMC"}
xref: PMID:18900503 {source="Europe PMC"}
xref: PMID:24498482 {source="Europe PMC"}
xref: Reaxys:1915399 {source="Reaxys"}
xref: Wikipedia:Testosterone
is_a: CHEBI:131621 ! C19-steroid
is_a: CHEBI:35343 ! 17beta-hydroxy steroid
is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid
is_a: CHEBI:50402 ! androstanoid
relationship: RO:0000087 CHEBI:50113 ! has role androgen
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
relationship: RO:0000087 CHEBI:83056 ! has role Daphnia magna metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H28O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C19H28O2/c1-18-9-7-13(20)11-12(18)3-4-14-15-5-6-17(21)19(15,2)10-8-16(14)18/h11,14-17,21H,3-10H2,1-2H3/t14-,15-,16-,17-,18-,19-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MUMGGOZAMZWBJJ-DYKIIFRCSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "288.42440" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.20893" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3=CC(=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H](O)CC[C@@]21[H]" xsd:string

[Term]
id: CHEBI:17478
name: aldehyde
namespace: chebi_ontology
alt_id: CHEBI:13432
alt_id: CHEBI:13753
alt_id: CHEBI:13805
alt_id: CHEBI:13806
alt_id: CHEBI:22291
alt_id: CHEBI:2554
alt_id: CHEBI:8750
def: "A compound RC(=O)H, in which a carbonyl group is bonded to one hydrogen atom and to one R group." []
subset: 3_STAR
synonym: "aldehido" RELATED [ChEBI]
synonym: "aldehidos" RELATED [ChEBI]
synonym: "Aldehyd" RELATED [ChEBI]
synonym: "Aldehyde" EXACT [KEGG_COMPOUND]
synonym: "aldehyde" EXACT [ChEBI]
synonym: "aldehyde" EXACT IUPAC_NAME [IUPAC]
synonym: "aldehydes" EXACT IUPAC_NAME [IUPAC]
synonym: "aldehydes" RELATED [ChEBI]
synonym: "aldehydum" RELATED [ChEBI]
synonym: "an aldehyde" RELATED [UniProt]
synonym: "RC(=O)H" RELATED [IUPAC]
synonym: "RCHO" RELATED [KEGG_COMPOUND]
xref: KEGG:C00071
is_a: CHEBI:36586 ! carbonyl compound
relationship: has_part CHEBI:42485 ! formyl group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHOR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "29.01800" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.00274" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C([*])=O" xsd:string

[Term]
id: CHEBI:17544
name: hydrogencarbonate
namespace: chebi_ontology
alt_id: CHEBI:13363
alt_id: CHEBI:22863
alt_id: CHEBI:40961
alt_id: CHEBI:5589
def: "The carbon oxoanion resulting from the removal of a proton from carbonic acid." []
subset: 3_STAR
synonym: "[CO2(OH)](-)" RELATED [IUPAC]
synonym: "Acid carbonate" RELATED [KEGG_COMPOUND]
synonym: "Bicarbonate" RELATED [KEGG_COMPOUND]
synonym: "BICARBONATE ION" RELATED [PDBeChem]
synonym: "HCO3(-)" RELATED [IUPAC]
synonym: "HCO3-" RELATED [KEGG_COMPOUND]
synonym: "hydrogen carbonate" RELATED [PDBeChem]
synonym: "hydrogen(trioxidocarbonate)(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "Hydrogencarbonate" EXACT [KEGG_COMPOUND]
synonym: "hydrogencarbonate" EXACT [UniProt]
synonym: "hydrogencarbonate" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogencarbonate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogentrioxocarbonate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogentrioxocarbonate(IV)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydroxidodioxidocarbonate(1-)" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:3903504 {source="Beilstein"}
xref: CAS:71-52-3 {source="ChemIDplus"}
xref: Gmelin:49249 {source="Gmelin"}
xref: HMDB:HMDB0000595
xref: KEGG:C00288
xref: MetaCyc:HCO3
xref: PDBeChem:BCT
xref: PMID:17215880 {source="Europe PMC"}
xref: PMID:17505962 {source="Europe PMC"}
xref: PMID:18439416 {source="Europe PMC"}
xref: PMID:28732801 {source="Europe PMC"}
xref: PMID:29150416 {source="Europe PMC"}
xref: PMID:29460248 {source="Europe PMC"}
xref: PMID:29466234 {source="Europe PMC"}
xref: PMID:4208463 {source="Europe PMC"}
xref: Wikipedia:Bicarbonate
is_a: CHEBI:35604 ! carbon oxoanion
relationship: is_conjugate_acid_of CHEBI:41609 ! carbonate
relationship: is_conjugate_base_of CHEBI:28976 ! carbonic acid
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "61.01684" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.99312" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([O-])=O" xsd:string

[Term]
id: CHEBI:176497
name: geroprotector
namespace: chebi_ontology
def: "Any compound that supports healthy aging, slows the biological aging process, or extends lifespan." []
subset: 3_STAR
synonym: "anti-aging agent" RELATED [ChEBI]
synonym: "anti-aging agents" RELATED [ChEBI]
synonym: "anti-aging drug" RELATED [ChEBI]
synonym: "anti-aging drugs" RELATED [ChEBI]
synonym: "geroprotective agent" RELATED [ChEBI]
synonym: "geroprotective agents" RELATED [ChEBI]
synonym: "geroprotectors" RELATED [ChEBI]
xref: PMID:23372317 {source="Europe PMC"}
xref: PMID:28580190 {source="Europe PMC"}
xref: PMID:30885572 {source="Europe PMC"}
xref: PMID:33144142 {source="Europe PMC"}
xref: PMID:33973253 {source="Europe PMC"}
xref: PMID:34606237 {source="Europe PMC"}
xref: Wikipedia:Geroprotector
is_a: CHEBI:50267 ! protective agent

[Term]
id: CHEBI:177917
name: phenolic steroid
namespace: chebi_ontology
subset: 2_STAR
synonym: "a phenolic steroid" RELATED [UniProt]
xref: KEGG:C02453 {source="SUBMITTER"}
xref: MetaCyc:PHENOLIC-STEROID {source="SUBMITTER"}
is_a: CHEBI:33853 ! phenols
is_a: CHEBI:36834 ! 3-hydroxy steroid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H24O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H24O/c1-18-9-2-3-17(18)16-6-4-12-11-13(19)5-7-14(12)15(16)8-10-18/h5,7,11,15-17,19H,2-4,6,8-10H2,1H3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "HJKVPZJVBHWFCQ-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "256.389" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "256.18272" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=C2C(CCC3C4CCCC4(CCC32)C)=CC(=C1)O" xsd:string

[Term]
id: CHEBI:17891
name: donor
namespace: chebi_ontology
alt_id: CHEBI:14202
alt_id: CHEBI:4697
def: "A molecular entity that can transfer (\"donate\") an electron, a pair of electrons, an atom or a group to another molecular entity." []
subset: 3_STAR
synonym: "Donator" RELATED [ChEBI]
synonym: "donneur" RELATED [ChEBI]
synonym: "Donor" EXACT [KEGG_COMPOUND]
xref: KEGG:C01351
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:17968
name: butyrate
namespace: chebi_ontology
alt_id: CHEBI:13924
alt_id: CHEBI:22946
def: "A short-chain fatty acid anion that is the conjugate base of butyric acid, obtained by deprotonation of the carboxy group." []
subset: 3_STAR
synonym: "1-butanoate" RELATED [ChEBI]
synonym: "1-butyrate" RELATED [ChEBI]
synonym: "1-propanecarboxylate" RELATED [ChEBI]
synonym: "butanate" RELATED [ChEBI]
synonym: "butanoate" EXACT IUPAC_NAME [IUPAC]
synonym: "butanoate" RELATED [ChEBI]
synonym: "butanoate" RELATED [UniProt]
synonym: "butanoic acid, ion(1-)" RELATED [ChemIDplus]
synonym: "butyrate" EXACT [IUPAC]
synonym: "CH3-[CH2]2-COO(-)" RELATED [IUPAC]
synonym: "n-butanoate" RELATED [ChEBI]
synonym: "n-butyrate" RELATED [ChemIDplus]
synonym: "propanecarboxylate" RELATED [ChEBI]
synonym: "propylformate" RELATED [ChEBI]
xref: Beilstein:3601060 {source="Beilstein"}
xref: CAS:461-55-2 {source="ChemIDplus"}
xref: Gmelin:324289 {source="Gmelin"}
xref: KEGG:C00246
xref: MetaCyc:BUTYRIC_ACID
xref: PMID:17190852 {source="Europe PMC"}
xref: PMID:7496326 {source="Europe PMC"}
xref: Reaxys:3601060 {source="Reaxys"}
xref: UM-BBD_compID:c0035 {source="UM-BBD"}
is_a: CHEBI:78115 ! fatty acid anion 4:0
relationship: is_conjugate_base_of CHEBI:30772 ! butyric acid
relationship: RO:0000087 CHEBI:61115 ! has role EC 3.5.1.98 (histone deacetylase) inhibitor
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H7O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H8O2/c1-2-3-4(5)6/h2-3H2,1H3,(H,5,6)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FERIUCNNQQJTOY-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "87.09718" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.04515" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCCC([O-])=O" xsd:string

[Term]
id: CHEBI:18059
name: lipid
namespace: chebi_ontology
alt_id: CHEBI:14517
alt_id: CHEBI:25054
alt_id: CHEBI:6486
def: "'Lipids' is a loosely defined term for substances of biological origin that are soluble in nonpolar solvents. They consist of saponifiable lipids, such as glycerides (fats and oils) and phospholipids, as well as nonsaponifiable lipids, principally steroids." []
subset: 3_STAR
synonym: "Lipid" EXACT [KEGG_COMPOUND]
synonym: "lipids" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C01356
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:18085
name: glycosaminoglycan
namespace: chebi_ontology
alt_id: CHEBI:14361
alt_id: CHEBI:24398
alt_id: CHEBI:5495
def: "Any polysaccharide containing a substantial proportion of aminomonosaccharide residues." []
subset: 3_STAR
synonym: "glicosaminoglicano" RELATED [IUPAC]
synonym: "Glycosaminoglycan" EXACT [KEGG_COMPOUND]
synonym: "glycosaminoglycan" EXACT IUPAC_NAME [IUPAC]
synonym: "glycosaminoglycane" RELATED [IUPAC]
synonym: "glycosaminoglycans" RELATED [ChEBI]
synonym: "Glykosaminoglykan" RELATED [ChEBI]
xref: KEGG:C02545
xref: Wikipedia:Glycosaminoglycan
is_a: CHEBI:22506 ! aminoglycan

[Term]
id: CHEBI:18133
name: hexose
namespace: chebi_ontology
alt_id: CHEBI:14399
alt_id: CHEBI:24590
alt_id: CHEBI:5709
def: "Any six-carbon monosaccharide which in its linear form contains either an aldehyde group at position 1 (aldohexose) or a ketone group at position 2 (ketohexose)." []
subset: 3_STAR
synonym: "Hexose" EXACT [KEGG_COMPOUND]
synonym: "hexoses" RELATED [ChEBI]
synonym: "WURCS=2.0/1,1,0/[axxxxh-1x_1-5_2*NCC/3=O]/1/" RELATED [GlyTouCan]
xref: GlyGen:G70994MS
xref: GlyTouCan:G70994MS
xref: KEGG:C00738
is_a: CHEBI:35381 ! monosaccharide

[Term]
id: CHEBI:18154
name: polysaccharide
namespace: chebi_ontology
alt_id: CHEBI:14864
alt_id: CHEBI:26205
alt_id: CHEBI:8322
def: "A biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically. This term is commonly used only for those containing more than ten monosaccharide residues." []
subset: 3_STAR
synonym: "Glycan" RELATED [KEGG_COMPOUND]
synonym: "Glycane" RELATED [ChEBI]
synonym: "glycans" RELATED [IUPAC]
synonym: "Glykan" RELATED [ChEBI]
synonym: "Glykane" RELATED [ChEBI]
synonym: "polisacarido" RELATED [ChEBI]
synonym: "polisacaridos" RELATED [IUPAC]
synonym: "Polysaccharide" EXACT [KEGG_COMPOUND]
synonym: "polysaccharides" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00420
is_a: CHEBI:16646 ! carbohydrate
is_a: CHEBI:167559 ! glycan
is_a: CHEBI:33694 ! biomacromolecule

[Term]
id: CHEBI:18237
name: glutamic acid
namespace: chebi_ontology
alt_id: CHEBI:24314
alt_id: CHEBI:5431
def: "An alpha-amino acid that is glutaric acid bearing a single amino substituent at position 2." []
subset: 3_STAR
synonym: "2-Aminoglutaric acid" RELATED [KEGG_COMPOUND]
synonym: "2-aminopentanedioic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "DL-Glutamic acid" RELATED [KEGG_DRUG]
synonym: "DL-Glutaminic acid" RELATED [KEGG_COMPOUND]
synonym: "E" RELATED [ChEBI]
synonym: "Glu" RELATED [ChEBI]
synonym: "Glutamate" RELATED [KEGG_COMPOUND]
synonym: "Glutamic acid" EXACT [KEGG_COMPOUND]
synonym: "glutamic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "Glutaminic acid" RELATED [KEGG_COMPOUND]
synonym: "Glutaminsaeure" RELATED [ChEBI]
xref: Beilstein:1723799 {source="Beilstein"}
xref: CAS:617-65-2 {source="ChemIDplus"}
xref: CAS:617-65-2 {source="NIST Chemistry WebBook"}
xref: CAS:617-65-2 {source="KEGG COMPOUND"}
xref: Gmelin:101971 {source="Gmelin"}
xref: KEGG:C00302
xref: KEGG:D04341
xref: KNApSAcK:C00001358
xref: KNApSAcK:C00019577
xref: PMID:15739367 {source="Europe PMC"}
xref: PMID:17190852 {source="Europe PMC"}
xref: PMID:24616376 {source="Europe PMC"}
xref: PMID:24984001 {source="Europe PMC"}
xref: Reaxys:1723799 {source="Reaxys"}
xref: Wikipedia:Glutamic_acid
is_a: CHEBI:26167 ! polar amino acid
is_a: CHEBI:33704 ! alpha-amino acid
relationship: has_part CHEBI:50329 ! 2-carboxyethyl group
relationship: is_conjugate_acid_of CHEBI:14321 ! glutamate(1-)
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H9NO4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "147.12930" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "147.05316" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(CCC(O)=O)C(O)=O" xsd:string

[Term]
id: CHEBI:18243
name: dopamine
namespace: chebi_ontology
alt_id: CHEBI:11695
alt_id: CHEBI:11930
alt_id: CHEBI:14203
alt_id: CHEBI:1764
alt_id: CHEBI:23886
alt_id: CHEBI:43686
def: "Catechol in which the hydrogen at position 4 is substituted by a 2-aminoethyl group." []
subset: 3_STAR
synonym: "2-(3,4-Dihydroxyphenyl)ethylamine" RELATED [KEGG_COMPOUND]
synonym: "2-(3,4-dihydroxyphenyl)ethylamine" RELATED [ChEBI]
synonym: "3,4-Dihydroxyphenethylamine" RELATED [KEGG_COMPOUND]
synonym: "3-Hydroxytyramine" RELATED [ChemIDplus]
synonym: "4-(2-Aminoethyl)-1,2-benzenediol" RELATED [KEGG_COMPOUND]
synonym: "4-(2-aminoethyl)-1,2-benzenediol" RELATED [ChEBI]
synonym: "4-(2-Aminoethyl)benzene-1,2-diol" RELATED [KEGG_COMPOUND]
synonym: "4-(2-aminoethyl)benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC]
synonym: "4-(2-aminoethyl)catechol" RELATED [ChemIDplus]
synonym: "4-(2-aminoethyl)pyrocatechol" RELATED [ChemIDplus]
synonym: "Deoxyepinephrine" RELATED [DrugBank]
synonym: "dopamina" RELATED INN [ChemIDplus]
synonym: "Dopamine" EXACT [KEGG_COMPOUND]
synonym: "dopamine" RELATED INN [ChEBI]
synonym: "dopaminum" RELATED INN [ChemIDplus]
synonym: "Hydroxytyramin" RELATED [DrugBank]
xref: CAS:51-61-6 {source="ChemIDplus"}
xref: Drug_Central:947 {source="DrugCentral"}
xref: DrugBank:DB00988
xref: HMDB:HMDB0000073
xref: KEGG:C03758
xref: KEGG:D07870
xref: KNApSAcK:C00001408
xref: LINCS:LSM-4630
xref: MetaCyc:DOPAMINE
xref: PMID:10629745 {source="Europe PMC"}
xref: PMID:11149432 {source="Europe PMC"}
xref: PMID:9422813 {source="Europe PMC"}
xref: Reaxys:1072822 {source="Reaxys"}
xref: Wikipedia:Dopamine
is_a: CHEBI:33567 ! catecholamine
relationship: is_conjugate_base_of CHEBI:59905 ! dopaminium(1+)
relationship: RO:0000087 CHEBI:35522 ! has role beta-adrenergic agonist
relationship: RO:0000087 CHEBI:35524 ! has role sympathomimetic agent
relationship: RO:0000087 CHEBI:38147 ! has role cardiotonic drug
relationship: RO:0000087 CHEBI:48560 ! has role dopaminergic agent
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VYFYYTLLBUKUHU-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "153.17840" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "153.07898" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1ccc(O)c(O)c1" xsd:string

[Term]
id: CHEBI:18248
name: iron atom
namespace: chebi_ontology
alt_id: CHEBI:13322
alt_id: CHEBI:24872
alt_id: CHEBI:5974
def: "An iron group element atom that has atomic number 26." []
subset: 3_STAR
synonym: "26Fe" RELATED [IUPAC]
synonym: "Eisen" RELATED [ChEBI]
synonym: "Fe" RELATED [IUPAC]
synonym: "fer" RELATED [ChEBI]
synonym: "ferrum" RELATED [IUPAC]
synonym: "hierro" RELATED [ChEBI]
synonym: "Iron" RELATED [KEGG_COMPOUND]
synonym: "iron" EXACT IUPAC_NAME [IUPAC]
synonym: "iron" RELATED [ChEBI]
xref: CAS:7439-89-6 {source="ChemIDplus"}
xref: CAS:7439-89-6 {source="NIST Chemistry WebBook"}
xref: CAS:7439-89-6 {source="KEGG COMPOUND"}
xref: DrugBank:DB01592
xref: HMDB:HMDB0015531
xref: KEGG:C00023
xref: Reaxys:4122945 {source="Reaxys"}
xref: WebElements:Fe
is_a: CHEBI:33356 ! iron group element atom
relationship: RO:0000087 CHEBI:27027 ! has role micronutrient
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Fe" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Fe" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XEEYBQQBJWHFJM-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "55.84500" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "55.93494" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Fe]" xsd:string

[Term]
id: CHEBI:18282
name: nucleobase
namespace: chebi_ontology
alt_id: CHEBI:13873
alt_id: CHEBI:25598
alt_id: CHEBI:2995
def: "That part of DNA or RNA that may be involved in pairing." []
subset: 3_STAR
synonym: "Base" RELATED [KEGG_COMPOUND]
synonym: "nucleobases" RELATED [ChEBI]
xref: KEGG:C00701
xref: Wikipedia:Nucleobase
is_a: CHEBI:38101 ! organonitrogen heterocyclic compound

[Term]
id: CHEBI:18295
name: histamine
namespace: chebi_ontology
alt_id: CHEBI:14401
alt_id: CHEBI:24596
alt_id: CHEBI:43187
alt_id: CHEBI:817
def: "A member of the class of imidazoles that is 1H-imidazole substituted at position C-4 by a 2-aminoethyl group." []
subset: 3_STAR
synonym: "1H-Imidazole-4-ethanamine" RELATED [KEGG_COMPOUND]
synonym: "2-(1H-imidazol-4-yl)ethanamine" EXACT IUPAC_NAME [IUPAC]
synonym: "2-(4-Imidazolyl)ethylamine" RELATED [KEGG_COMPOUND]
synonym: "HISTAMINE" EXACT [PDBeChem]
synonym: "Histamine" EXACT [KEGG_COMPOUND]
xref: Beilstein:2012 {source="Beilstein"}
xref: CAS:51-45-6 {source="NIST Chemistry WebBook"}
xref: CAS:51-45-6 {source="ChemIDplus"}
xref: CAS:51-45-6 {source="KEGG COMPOUND"}
xref: Drug_Central:1375 {source="DrugCentral"}
xref: Gmelin:2968 {source="Gmelin"}
xref: HMDB:HMDB0000870
xref: KEGG:C00388
xref: KEGG:D08040
xref: KNApSAcK:C00001414
xref: MetaCyc:HISTAMINE
xref: PDBeChem:HSM
xref: PMID:16399866 {source="Europe PMC"}
xref: PMID:19547708 {source="Europe PMC"}
xref: PMID:19843401 {source="Europe PMC"}
xref: PMID:22770225 {source="Europe PMC"}
xref: PMID:24101735 {source="Europe PMC"}
xref: Reaxys:2012 {source="Reaxys"}
xref: Wikipedia:Histamine
is_a: CHEBI:24780 ! imidazoles
is_a: CHEBI:64365 ! aralkylamino compound
relationship: is_conjugate_base_of CHEBI:58432 ! histaminium
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H9N3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NTYJJOPFIAHURM-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "111.14518" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "111.07965" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1c[nH]cn1" xsd:string

[Term]
id: CHEBI:18310
name: alkane
namespace: chebi_ontology
alt_id: CHEBI:13435
alt_id: CHEBI:22317
alt_id: CHEBI:2576
def: "An acyclic branched or unbranched hydrocarbon having the general formula CnH2n+2, and therefore consisting entirely of hydrogen atoms and saturated carbon atoms." []
subset: 3_STAR
synonym: "alcane" RELATED [IUPAC]
synonym: "alcanes" RELATED [IUPAC]
synonym: "alcano" RELATED [IUPAC]
synonym: "alcanos" RELATED [IUPAC]
synonym: "Alkan" RELATED [ChEBI]
synonym: "Alkane" EXACT [KEGG_COMPOUND]
synonym: "alkane" EXACT IUPAC_NAME [IUPAC]
synonym: "alkanes" EXACT IUPAC_NAME [IUPAC]
synonym: "an alkane" RELATED [UniProt]
synonym: "RH" RELATED [KEGG_COMPOUND]
xref: KEGG:C01371
is_a: CHEBI:24632 ! hydrocarbon
is_a: CHEBI:33653 ! aliphatic compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "15.035" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.02348" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[*]" xsd:string

[Term]
id: CHEBI:18367
name: phosphate(3-)
namespace: chebi_ontology
alt_id: CHEBI:14791
alt_id: CHEBI:45024
alt_id: CHEBI:7793
def: "A phosphate ion that is the conjugate base of hydrogenphosphate." []
subset: 3_STAR
synonym: "[PO4](3-)" RELATED [IUPAC]
synonym: "Orthophosphate" RELATED [KEGG_COMPOUND]
synonym: "Phosphate" RELATED [KEGG_COMPOUND]
synonym: "phosphate" EXACT IUPAC_NAME [IUPAC]
synonym: "PHOSPHATE ION" RELATED [PDBeChem]
synonym: "PO4(3-)" RELATED [IUPAC]
synonym: "tetraoxidophosphate(3-)" EXACT IUPAC_NAME [IUPAC]
synonym: "tetraoxophosphate(3-)" EXACT IUPAC_NAME [IUPAC]
synonym: "tetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:3903772 {source="Beilstein"}
xref: CAS:14265-44-2 {source="KEGG COMPOUND"}
xref: CAS:14265-44-2 {source="ChemIDplus"}
xref: Gmelin:1997 {source="Gmelin"}
xref: KEGG:C00009
xref: PDBeChem:PO4 {source="ChEBI"}
xref: Reaxys:3903772 {source="Reaxys"}
is_a: CHEBI:35780 ! phosphate ion
is_a: CHEBI:79387 ! trivalent inorganic anion
relationship: is_conjugate_base_of CHEBI:43474 ! hydrogenphosphate
property_value: http://purl.obolibrary.org/obo/chebi/charge "-3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O4P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-K" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "94.97136" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "94.95507" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]P([O-])([O-])=O" xsd:string

[Term]
id: CHEBI:18421
name: superoxide
namespace: chebi_ontology
alt_id: CHEBI:15143
alt_id: CHEBI:26839
alt_id: CHEBI:7710
subset: 3_STAR
synonym: "(O2)(.-)" RELATED [IUPAC]
synonym: "dioxidanidyl" EXACT IUPAC_NAME [IUPAC]
synonym: "dioxide(.1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "dioxide(1-)" RELATED [IUPAC]
synonym: "Hyperoxid" RELATED [ChEBI]
synonym: "hyperoxide" RELATED [IUPAC]
synonym: "O2(-)" RELATED [IUPAC]
synonym: "O2(.-)" RELATED [IUPAC]
synonym: "O2-" RELATED [KEGG_COMPOUND]
synonym: "O2.-" RELATED [KEGG_COMPOUND]
synonym: "superoxide" EXACT [IUPAC]
synonym: "superoxide" EXACT [UniProt]
synonym: "Superoxide anion" RELATED [KEGG_COMPOUND]
synonym: "superoxide anion radical" RELATED [ChemIDplus]
synonym: "superoxide radical" RELATED [ChEBI]
synonym: "superoxide radical anion" RELATED [ChEBI]
synonym: "superoxyde" RELATED [ChEBI]
xref: CAS:11062-77-4 {source="ChemIDplus"}
xref: CAS:11062-77-4 {source="NIST Chemistry WebBook"}
xref: Gmelin:487 {source="Gmelin"}
xref: KEGG:C00704
is_a: CHEBI:33263 ! diatomic oxygen
is_a: CHEBI:36876 ! inorganic radical anion
is_a: CHEBI:61073 ! oxygen radical
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/HO2/c1-2/h1H/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OUUQCZGPVNCOIJ-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "31.99880" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O][O-]" xsd:string

[Term]
id: CHEBI:20664
name: 5beta-cholane
namespace: chebi_ontology
subset: 3_STAR
synonym: "5beta-cholane" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:2048472 {source="Beilstein"}
is_a: CHEBI:35519 ! cholane
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H42" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18+,19+,20-,21+,22+,23+,24-/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QSHQKIURKJITMZ-OBUPQJQESA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "330.59028" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "330.32865" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC" xsd:string

[Term]
id: CHEBI:22160
name: acetamides
namespace: chebi_ontology
def: "Compounds with the general formula RNHC(=O)CH3." []
subset: 3_STAR
is_a: CHEBI:37622 ! carboxamide

[Term]
id: CHEBI:22221
name: acyl group
namespace: chebi_ontology
def: "An organic group formed by removing one or more hydroxy groups from an oxoacid that has the general structure RkE(=O)l(OH)m (l =/= 0). Although the term is almost always applied to organic compounds, with carboxylic acid as the oxoacid, acyl groups can in principle be derived from other types of acids such as sulfonic acids or phosphonic acids." []
subset: 3_STAR
synonym: "acyl group" EXACT [IUPAC]
synonym: "acyl groups" RELATED [ChEBI]
synonym: "alkanoyl" EXACT IUPAC_NAME [IUPAC]
synonym: "alkanoyl group" RELATED [ChEBI]
synonym: "groupe acyle" RELATED [IUPAC]
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:22313
name: alkaline earth metal atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "alkaline earth metal" RELATED [ChEBI]
synonym: "alkaline earth metals" EXACT IUPAC_NAME [IUPAC]
synonym: "alkaline-earth metal" RELATED [ChEBI]
synonym: "alkaline-earth metals" RELATED [ChEBI]
synonym: "Erdalkalimetall" RELATED [ChEBI]
synonym: "Erdalkalimetalle" RELATED [ChEBI]
synonym: "metal alcalino-terreux" RELATED [ChEBI]
synonym: "metal alcalinoterreo" RELATED [ChEBI]
synonym: "metales alcalinoterreos" RELATED [ChEBI]
synonym: "metaux alcalino-terreux" RELATED [ChEBI]
is_a: CHEBI:33318 ! main group element atom
is_a: CHEBI:33521 ! metal atom
is_a: CHEBI:33559 ! s-block element atom

[Term]
id: CHEBI:22314
name: alkali metal atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "alkali metal" RELATED [ChEBI]
synonym: "alkali metals" EXACT IUPAC_NAME [IUPAC]
synonym: "Alkalimetall" RELATED [ChEBI]
synonym: "Alkalimetalle" RELATED [ChEBI]
synonym: "metal alcalin" RELATED [ChEBI]
synonym: "metal alcalino" RELATED [ChEBI]
synonym: "metales alcalinos" RELATED [ChEBI]
synonym: "metaux alcalins" RELATED [ChEBI]
is_a: CHEBI:33318 ! main group element atom
is_a: CHEBI:33521 ! metal atom
is_a: CHEBI:33559 ! s-block element atom

[Term]
id: CHEBI:22315
name: alkaloid
namespace: chebi_ontology
def: "Any of the naturally occurring, basic nitrogen compounds (mostly heterocyclic) occurring mostly in the plant kingdom, but also found in bacteria, fungi, and animals. By extension, certain neutral compounds biogenetically related to basic alkaloids are also classed as alkaloids. Amino acids, peptides, proteins, nucleotides, nucleic acids, amino sugars and antibiotics are not normally regarded as alkaloids. Compounds in which the nitrogen is  exocyclic (dopamine, mescaline, serotonin, etc.) are usually classed as amines rather than alkaloids." []
subset: 3_STAR
synonym: "alcaloide" RELATED [ChEBI]
synonym: "alcaloides" RELATED [ChEBI]
synonym: "Alkaloid" EXACT [ChEBI]
synonym: "Alkaloide" RELATED [ChEBI]
synonym: "alkaloids" EXACT IUPAC_NAME [IUPAC]
xref: Wikipedia:Alkaloid
is_a: CHEBI:35352 ! organonitrogen compound
relationship: RO:0000087 CHEBI:25212 ! has role metabolite

[Term]
id: CHEBI:22506
name: aminoglycan
namespace: chebi_ontology
subset: 3_STAR
synonym: "aminoglycans" RELATED [ChEBI]
is_a: CHEBI:35352 ! organonitrogen compound
is_a: CHEBI:65212 ! polysaccharide derivative

[Term]
id: CHEBI:22563
name: anion
namespace: chebi_ontology
def: "A monoatomic or polyatomic species having one or more elementary charges of the electron." []
subset: 3_STAR
synonym: "Anion" EXACT [ChEBI]
synonym: "anion" EXACT IUPAC_NAME [IUPAC]
synonym: "anion" EXACT [ChEBI]
synonym: "Anionen" RELATED [ChEBI]
synonym: "aniones" RELATED [ChEBI]
synonym: "anions" RELATED [IUPAC]
is_a: CHEBI:24870 ! ion

[Term]
id: CHEBI:22586
name: antioxidant
namespace: chebi_ontology
def: "A substance that opposes oxidation or inhibits reactions brought about by dioxygen or peroxides." []
subset: 3_STAR
synonym: "antioxidants" RELATED [ChEBI]
synonym: "antioxydant" RELATED [ChEBI]
synonym: "antoxidant" RELATED [ChEBI]
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:22695
name: base
namespace: chebi_ontology
def: "A molecular entity having an available pair of electrons capable of forming a covalent bond with a hydron (Bronsted base) or with the vacant orbital of some other molecular entity (Lewis base)." []
subset: 3_STAR
synonym: "Base" EXACT [ChEBI]
synonym: "base" EXACT [ChEBI]
synonym: "base" EXACT IUPAC_NAME [IUPAC]
synonym: "Base1" RELATED [KEGG_COMPOUND]
synonym: "Base2" RELATED [KEGG_COMPOUND]
synonym: "Basen" RELATED [ChEBI]
synonym: "bases" RELATED [ChEBI]
synonym: "Nucleobase" RELATED [KEGG_COMPOUND]
xref: KEGG:C00701
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:22728
name: benzopyrrole
namespace: chebi_ontology
subset: 3_STAR
synonym: "benzopyrroles" RELATED [ChEBI]
is_a: CHEBI:27171 ! organic heterobicyclic compound
is_a: CHEBI:38101 ! organonitrogen heterocyclic compound
is_a: CHEBI:38180 ! polycyclic heteroarene

[Term]
id: CHEBI:22868
name: bile salt
namespace: chebi_ontology
def: "A sodium salt of the conjugate of any bile acid with either glycine or taurine." []
subset: 3_STAR
synonym: "Bile acid" RELATED [KEGG_COMPOUND]
synonym: "bile salts" RELATED [ChEBI]
xref: KEGG:C01558
is_a: CHEBI:36078 ! cholanoid
is_a: CHEBI:38700 ! organic sodium salt

[Term]
id: CHEBI:22984
name: calcium atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "20Ca" RELATED [IUPAC]
synonym: "Ca" RELATED [IUPAC]
synonym: "calcio" RELATED [ChEBI]
synonym: "Calcium" RELATED [KEGG_COMPOUND]
synonym: "calcium" EXACT IUPAC_NAME [IUPAC]
synonym: "calcium" RELATED [ChEBI]
synonym: "Kalzium" RELATED [ChEBI]
xref: CAS:7440-70-2 {source="ChemIDplus"}
xref: DrugBank:DB01373
xref: KEGG:C00076
xref: WebElements:Ca
is_a: CHEBI:22313 ! alkaline earth metal atom
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Ca" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OYPRJOBELJOOCE-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "40.07800" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Ca]" xsd:string

[Term]
id: CHEBI:22985
name: calcium molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "calcium compounds" RELATED [ChEBI]
synonym: "calcium molecular entities" RELATED [ChEBI]
synonym: "calcium molecular entity" EXACT [ChEBI]
is_a: CHEBI:33299 ! alkaline earth molecular entity
relationship: has_part CHEBI:22984 ! calcium atom

[Term]
id: CHEBI:23004
name: carbamoyl group
namespace: chebi_ontology
def: "The univalent carboacyl group formed by loss of -OH from the carboxy group of carbamic acid." []
subset: 3_STAR
synonym: "-C(O)NH2" RELATED [ChEBI]
synonym: "-CONH2" RELATED [IUPAC]
synonym: "aminocarbonyl" RELATED [IUPAC]
synonym: "carbamoyl" EXACT IUPAC_NAME [IUPAC]
synonym: "carbamyl" RELATED [ChEBI]
synonym: "carbamyl group" RELATED [ChEBI]
synonym: "carboxamide" RELATED [IUPAC]
xref: PMID:24168430 {source="Europe PMC"}
is_a: CHEBI:27207 ! univalent carboacyl group
relationship: is_substituent_group_from CHEBI:28616 ! carbamic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2NO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.03272" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.01364" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(N)=O" xsd:string

[Term]
id: CHEBI:23019
name: carbonyl group
namespace: chebi_ontology
subset: 3_STAR
synonym: ">C=O" RELATED [IUPAC]
synonym: "carbonyl" EXACT IUPAC_NAME [IUPAC]
synonym: "carbonyl group" EXACT [ChEBI]
synonym: "carbonyl group" EXACT [UniProt]
is_a: CHEBI:51422 ! organodiyl group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "28.01010" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "27.99491" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=C(*)*" xsd:string

[Term]
id: CHEBI:23357
name: cofactor
namespace: chebi_ontology
def: "An organic molecule or ion (usually a metal ion) that is required by an enzyme for its activity. It may be attached either loosely (coenzyme) or tightly (prosthetic group)." []
subset: 3_STAR
synonym: "cofactor" EXACT [IUPAC]
synonym: "cofactors" EXACT IUPAC_NAME [IUPAC]
xref: Wikipedia:Cofactor_(biochemistry)
is_a: CHEBI:52206 ! biochemical role

[Term]
id: CHEBI:23367
name: molecular entity
namespace: chebi_ontology
def: "Any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer etc., identifiable as a separately distinguishable entity." []
subset: 3_STAR
synonym: "entidad molecular" RELATED [IUPAC]
synonym: "entidades moleculares" RELATED [IUPAC]
synonym: "entite moleculaire" RELATED [IUPAC]
synonym: "molecular entities" RELATED [IUPAC]
synonym: "molecular entity" EXACT IUPAC_NAME [IUPAC]
synonym: "molekulare Entitaet" RELATED [ChEBI]
is_a: CHEBI:24431 ! chemical entity

[Term]
id: CHEBI:23449
name: cyclic peptide
namespace: chebi_ontology
subset: 3_STAR
synonym: "cyclic peptides" RELATED [ChEBI]
synonym: "Cyclopeptid" RELATED [ChEBI]
synonym: "peptide cyclique" RELATED [IUPAC]
synonym: "peptido ciclico" RELATED [IUPAC]
synonym: "Zyklopeptid" RELATED [ChEBI]
is_a: CHEBI:16670 ! peptide

[Term]
id: CHEBI:23677
name: diazole
namespace: chebi_ontology
def: "An azole that is either one of a pair of heterocyclic organic compounds comprising three carbon atoms and two nitrogen atoms arranged in a ring." []
subset: 3_STAR
synonym: "diazoles" RELATED [ChEBI]
is_a: CHEBI:68452 ! azole

[Term]
id: CHEBI:23888
name: drug
namespace: chebi_ontology
def: "Any substance which when absorbed into a living organism may modify one or more of its functions. The term is generally accepted for a substance taken for a therapeutic purpose, but is also commonly used for abused substances." []
subset: 3_STAR
synonym: "drugs" RELATED [ChEBI]
synonym: "medicine" RELATED [ChEBI]
is_a: CHEBI:52217 ! pharmaceutical

[Term]
id: CHEBI:23897
name: ecdysteroid
namespace: chebi_ontology
alt_id: CHEBI:23896
def: "A class of steroids that include insect moulting and sex hormones." []
subset: 3_STAR
synonym: "ecdysteroid hormones" RELATED [ChEBI]
synonym: "ecdysteroids" RELATED [ChEBI]
xref: Wikipedia:Ecdysteroid
is_a: CHEBI:35341 ! steroid
relationship: RO:0000087 CHEBI:24621 ! has role hormone

[Term]
id: CHEBI:23906
name: monoatomic cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "monoatomic cations" RELATED [ChEBI]
is_a: CHEBI:24867 ! monoatomic ion
is_a: CHEBI:36916 ! cation

[Term]
id: CHEBI:23924
name: enzyme inhibitor
namespace: chebi_ontology
def: "A compound or agent that combines with an enzyme in such a manner as to prevent the normal substrate-enzyme combination and the catalytic reaction." []
subset: 3_STAR
synonym: "enzyme inhibitor" EXACT IUPAC_NAME [IUPAC]
synonym: "enzyme inhibitors" RELATED [ChEBI]
synonym: "inhibidor enzimatico" RELATED [ChEBI]
synonym: "inhibidores enzimaticos" RELATED [ChEBI]
synonym: "inhibiteur enzymatique" RELATED [ChEBI]
synonym: "inhibiteurs enzymatiques" RELATED [ChEBI]
is_a: CHEBI:35222 ! inhibitor
is_a: CHEBI:52206 ! biochemical role

[Term]
id: CHEBI:23965
name: estradiol
namespace: chebi_ontology
alt_id: CHEBI:42364
def: "A 3-hydroxy steroid that is estra-1,3,5(10)-triene substituted by hydroxy groups at positions 3 and 17." []
subset: 3_STAR
synonym: "estra-1,3,5(10)-triene-3,17-diol" EXACT IUPAC_NAME [IUPAC]
synonym: "oestradiol" RELATED [ChEBI]
xref: PMID:10696569 {source="Europe PMC"}
xref: PMID:24084694 {source="Europe PMC"}
xref: Wikipedia:Estradiol
is_a: CHEBI:177917 ! phenolic steroid
is_a: CHEBI:36838 ! 17-hydroxy steroid
relationship: has_parent_hydride CHEBI:23966 ! estrane
relationship: RO:0000087 CHEBI:50114 ! has role estrogen
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H24O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H24O2/c1-18-9-8-14-13-5-3-12(19)10-11(13)2-4-15(14)16(18)6-7-17(18)20/h3,5,10,14-17,19-20H,2,4,6-9H2,1H3/t14-,15-,16+,17?,18+/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VOXZDWNPVJITMN-WKUFJEKOSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "272.38196" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "272.17763" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]12CC[C@]3(C)C(O)CC[C@@]3([H])[C@]1([H])CCc1cc(O)ccc21" xsd:string

[Term]
id: CHEBI:23966
name: estrane
namespace: chebi_ontology
subset: 3_STAR
synonym: "estrane" EXACT IUPAC_NAME [IUPAC]
synonym: "Oestran" RELATED [ChEBI]
synonym: "oestrane" RELATED [JCBN]
xref: Beilstein:3125721 {source="Beilstein"}
xref: LIPID_MAPS_instance:LMST02010000 {source="LIPID MAPS"}
is_a: CHEBI:35508 ! steroid fundamental parent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H30" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H30/c1-18-11-4-7-17(18)16-9-8-13-5-2-3-6-14(13)15(16)10-12-18/h13-17H,2-12H2,1H3/t13?,14-,15+,16+,17-,18-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "GRXPVLPQNMUNNX-MHJRRCNVSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "246.43080" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "246.23475" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]12CCCCC1CC[C@]1([H])[C@]2([H])CC[C@]2(C)CCC[C@@]12[H]" xsd:string

[Term]
id: CHEBI:24261
name: glucocorticoid
namespace: chebi_ontology
def: "Glucocorticoids are a class of steroid hormones that regulate a variety of physiological processes, in particular control of the concentration of glucose in blood." []
subset: 3_STAR
synonym: "glucocorticoids" RELATED [ChEBI]
is_a: CHEBI:36699 ! corticosteroid hormone

[Term]
id: CHEBI:24318
name: glutamine family amino acid
namespace: chebi_ontology
def: "An L-alpha-amino acid which is L-glutamic acid or any of the essential amino acids biosynthesised from it (glutamine, proline and arginine). A closed class." []
subset: 3_STAR
synonym: "glutamine family amino acids" RELATED [ChEBI]
xref: PMID:20716061 {source="Europe PMC"}
is_a: CHEBI:15705 ! L-alpha-amino acid
is_a: CHEBI:83813 ! proteinogenic amino acid

[Term]
id: CHEBI:24384
name: glycogens
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:37163 ! glucan

[Term]
id: CHEBI:24402
name: glycosphingolipid
namespace: chebi_ontology
alt_id: CHEBI:5498
def: "A glycosphingolipid is a glycolipid that is a carbohydrate-containing derivative of a sphingoid or ceramide. It is understood that the carbohydrate residue is attached by a glycosidic linkage to O-1 of the sphingoid." []
subset: 3_STAR
synonym: "glycosphingolipids" RELATED [ChEBI]
xref: PMID:18845618 {source="Europe PMC"}
xref: PMID:19303901 {source="Europe PMC"}
xref: PMID:26954668 {source="Europe PMC"}
xref: PMID:26976737 {source="Europe PMC"}
xref: PMID:27253729 {source="Europe PMC"}
xref: PMID:27325407 {source="Europe PMC"}
xref: Wikipedia:Glycosphingolipid
is_a: CHEBI:26739 ! sphingolipid
is_a: CHEBI:33563 ! glycolipid

[Term]
id: CHEBI:24431
name: chemical entity
namespace: chebi_ontology
def: "A chemical entity is a physical entity of interest in chemistry including molecular entities, parts thereof, and chemical substances." []
subset: 3_STAR
synonym: "chemical entity" EXACT [UniProt]
is_a: BFO:0000040 ! material entity

[Term]
id: CHEBI:24432
name: biological role
namespace: chebi_ontology
def: "A role played by the molecular entity or part thereof within a biological context." []
subset: 3_STAR
synonym: "biological function" RELATED [ChEBI]
is_a: BFO:0000023 ! role
is_a: CHEBI:50906 ! role

[Term]
id: CHEBI:24433
name: group
namespace: chebi_ontology
def: "A defined linked collection of atoms or a single atom within a molecular entity." []
subset: 3_STAR
synonym: "group" EXACT IUPAC_NAME [IUPAC]
synonym: "groupe" RELATED [IUPAC]
synonym: "grupo" RELATED [IUPAC]
synonym: "grupos" RELATED [IUPAC]
synonym: "Gruppe" RELATED [ChEBI]
synonym: "Rest" RELATED [ChEBI]
is_a: CHEBI:24431 ! chemical entity
relationship: has_part CHEBI:33250 ! atom

[Term]
id: CHEBI:24505
name: heparins
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:35722 ! sulfated glycosaminoglycan
is_a: CHEBI:37395 ! mucopolysaccharide

[Term]
id: CHEBI:24532
name: organic heterocyclic compound
namespace: chebi_ontology
def: "A cyclic compound having as ring members atoms of carbon and at least of one other element." []
subset: 3_STAR
synonym: "organic heterocycle" RELATED [ChEBI]
synonym: "organic heterocyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33285 ! heteroorganic entity
is_a: CHEBI:33832 ! organic cyclic compound
is_a: CHEBI:5686 ! heterocyclic compound

[Term]
id: CHEBI:24533
name: heterodetic cyclic peptide
namespace: chebi_ontology
def: "A heterodetic cyclic peptide is a peptide consisting only of amino-acid residues, but in which the linkages forming the ring are not solely peptide bonds; one or more is an isopeptide, disulfide, ester, or other bond." []
subset: 3_STAR
synonym: "heterodetic cyclic peptide" EXACT IUPAC_NAME [IUPAC]
synonym: "heterodetic cyclic peptides" RELATED [ChEBI]
synonym: "peptide cyclique heterodetique" RELATED [IUPAC]
synonym: "peptido ciclico heterodetico" RELATED [IUPAC]
is_a: CHEBI:23449 ! cyclic peptide

[Term]
id: CHEBI:24621
name: hormone
namespace: chebi_ontology
def: "Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds." []
subset: 3_STAR
synonym: "endocrine" RELATED [ChEBI]
synonym: "hormones" RELATED [ChEBI]
is_a: CHEBI:33280 ! molecular messenger
is_a: CHEBI:48705 ! agonist

[Term]
id: CHEBI:24632
name: hydrocarbon
namespace: chebi_ontology
def: "A compound consisting of carbon and hydrogen only." []
subset: 3_STAR
synonym: "hidrocarburo" RELATED [IUPAC]
synonym: "hidrocarburos" RELATED [IUPAC]
synonym: "hydrocarbon" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrocarbons" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrocarbure" RELATED [IUPAC]
synonym: "Kohlenwasserstoff" RELATED [ChEBI]
synonym: "Kohlenwasserstoffe" RELATED [ChEBI]
is_a: CHEBI:33245 ! organic fundamental parent

[Term]
id: CHEBI:24651
name: hydroxides
namespace: chebi_ontology
def: "Hydroxides are chemical compounds containing a hydroxy group or salts containing hydroxide (OH(-))." []
subset: 3_STAR
is_a: CHEBI:25806 ! oxygen molecular entity
is_a: CHEBI:33608 ! hydrogen molecular entity
is_a: CHEBI:37577 ! heteroatomic molecular entity
relationship: has_part CHEBI:43176 ! hydroxy group

[Term]
id: CHEBI:24663
name: hydroxy-5beta-cholanic acid
namespace: chebi_ontology
def: "Any member of the class of 5beta-cholanic acids carrying at least one hydroxy group at unspecified position." []
subset: 3_STAR
synonym: "hydroxy-5beta-cholanic acids" RELATED [ChEBI]
is_a: CHEBI:33822 ! organic hydroxy compound
is_a: CHEBI:36248 ! 5beta-cholanic acids
relationship: has_functional_parent CHEBI:36238 ! 5beta-cholanic acid

[Term]
id: CHEBI:24780
name: imidazoles
namespace: chebi_ontology
def: "A five-membered organic heterocycle containing two nitrogen atoms at positions 1 and 3, or any of its derivatives; compounds containing an imidazole skeleton." []
subset: 3_STAR
is_a: CHEBI:23677 ! diazole

[Term]
id: CHEBI:24828
name: indoles
namespace: chebi_ontology
def: "Any compound containing an indole skeleton." []
subset: 3_STAR
is_a: CHEBI:22728 ! benzopyrrole

[Term]
id: CHEBI:24833
name: oxoacid
namespace: chebi_ontology
def: "A compound which contains oxygen, at least one other element, and at least one hydrogen bound to oxygen, and which produces a conjugate base by loss of positive hydrogen ion(s) (hydrons)." []
subset: 3_STAR
synonym: "oxacids" RELATED [ChEBI]
synonym: "oxiacids" RELATED [ChEBI]
synonym: "oxo acid" RELATED [ChEBI]
synonym: "oxoacid" EXACT IUPAC_NAME [IUPAC]
synonym: "oxoacids" EXACT IUPAC_NAME [IUPAC]
synonym: "oxy-acids" RELATED [ChEBI]
synonym: "oxyacids" RELATED [ChEBI]
is_a: CHEBI:24651 ! hydroxides
relationship: RO:0000087 CHEBI:39141 ! has role Bronsted acid

[Term]
id: CHEBI:24834
name: inorganic anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic anions" RELATED [ChEBI]
is_a: CHEBI:22563 ! anion
is_a: CHEBI:36914 ! inorganic ion

[Term]
id: CHEBI:24835
name: inorganic molecular entity
namespace: chebi_ontology
def: "A molecular entity that contains no carbon." []
subset: 3_STAR
synonym: "anorganische Verbindungen" RELATED [ChEBI]
synonym: "inorganic compounds" RELATED [ChEBI]
synonym: "inorganic entity" RELATED [ChEBI]
synonym: "inorganic molecular entities" RELATED [ChEBI]
synonym: "inorganics" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity

[Term]
id: CHEBI:24836
name: inorganic oxide
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic oxides" RELATED [ChEBI]
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:25741 ! oxide

[Term]
id: CHEBI:24866
name: salt
namespace: chebi_ontology
def: "A salt is an assembly of cations and anions." []
subset: 3_STAR
synonym: "ionic compound" RELATED [ChEBI]
synonym: "ionic compounds" RELATED [ChEBI]
synonym: "sal" RELATED [ChEBI]
synonym: "sales" RELATED [ChEBI]
synonym: "salt" EXACT IUPAC_NAME [IUPAC]
synonym: "salts" RELATED [ChEBI]
synonym: "Salz" RELATED [ChEBI]
synonym: "Salze" RELATED [ChEBI]
synonym: "sel" RELATED [ChEBI]
synonym: "sels" RELATED [ChEBI]
is_a: CHEBI:37577 ! heteroatomic molecular entity
relationship: has_part CHEBI:22563 ! anion
relationship: has_part CHEBI:36916 ! cation

[Term]
id: CHEBI:24867
name: monoatomic ion
namespace: chebi_ontology
subset: 3_STAR
synonym: "monoatomic ions" RELATED [ChEBI]
is_a: CHEBI:24870 ! ion
is_a: CHEBI:33238 ! monoatomic entity

[Term]
id: CHEBI:24868
name: organic salt
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic salts" RELATED [ChEBI]
synonym: "organisches Salz" RELATED [ChEBI]
is_a: CHEBI:24866 ! salt

[Term]
id: CHEBI:24870
name: ion
namespace: chebi_ontology
def: "A molecular entity having a net electric charge." []
subset: 3_STAR
synonym: "Ion" EXACT [ChEBI]
synonym: "ion" EXACT IUPAC_NAME [IUPAC]
synonym: "ion" EXACT [ChEBI]
synonym: "Ionen" RELATED [ChEBI]
synonym: "iones" RELATED [ChEBI]
synonym: "ions" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity

[Term]
id: CHEBI:24873
name: iron molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "iron compounds" RELATED [ChEBI]
synonym: "iron molecular entities" RELATED [ChEBI]
synonym: "iron molecular entity" EXACT [ChEBI]
is_a: CHEBI:33744 ! iron group molecular entity
relationship: has_part CHEBI:18248 ! iron atom

[Term]
id: CHEBI:24875
name: iron cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "Fe cation" RELATED [UniProt]
synonym: "iron cation" EXACT IUPAC_NAME [IUPAC]
synonym: "iron cations" RELATED [ChEBI]
is_a: CHEBI:33515 ! transition element cation
is_a: CHEBI:82663 ! elemental iron
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
property_value: http://purl.obolibrary.org/obo/chebi/formula "Fe" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "55.845" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "55.93494" xsd:string

[Term]
id: CHEBI:24913
name: isoprenoid
namespace: chebi_ontology
def: "Any lipid formally derived from isoprene (2-methylbuta-1,3-diene), the skeleton of which can generally be discerned in repeated occurrence in the molecule. The skeleton of isoprenoids may differ from strict additivity of isoprene units by loss or shift of a fragment, commonly a methyl group. The class includes both hydrocarbons and oxygenated derivatives." []
subset: 3_STAR
synonym: "isoprenoid" EXACT [ChEBI]
synonym: "isoprenoids" EXACT IUPAC_NAME [IUPAC]
synonym: "isoprenoids" RELATED [ChEBI]
xref: LIPID_MAPS_class:LMPR01 {source="LIPID MAPS"}
xref: PMID:12769708 {source="Europe PMC"}
xref: PMID:19219049 {source="Europe PMC"}
is_a: CHEBI:18059 ! lipid

[Term]
id: CHEBI:24943
name: juvenile hormone
namespace: chebi_ontology
def: "A family of farnesane sesquiterpenoids that regulate many aspects of insect physiology." []
subset: 3_STAR
xref: Wikipedia:Juvenile_hormone
is_a: CHEBI:36757 ! farnesane sesquiterpenoid
relationship: RO:0000087 CHEBI:24621 ! has role hormone
relationship: RO:0000087 CHEBI:75767 ! has role animal metabolite

[Term]
id: CHEBI:25046
name: linear tetrapyrrole
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:26932 ! tetrapyrrole

[Term]
id: CHEBI:25179
name: melanins
namespace: chebi_ontology
alt_id: CHEBI:6727
subset: 1_STAR
is_a: CHEBI:26195 ! polyphenol
relationship: RO:0000087 CHEBI:26130 ! has role biological pigment

[Term]
id: CHEBI:25212
name: metabolite
namespace: chebi_ontology
alt_id: CHEBI:26619
alt_id: CHEBI:35220
def: "Any intermediate or product resulting from metabolism. The term 'metabolite' subsumes the classes commonly known as primary and secondary metabolites." []
subset: 3_STAR
synonym: "metabolite" EXACT IUPAC_NAME [IUPAC]
synonym: "metabolites" RELATED [ChEBI]
synonym: "primary metabolites" RELATED [ChEBI]
synonym: "secondary metabolites" RELATED [ChEBI]
is_a: CHEBI:52206 ! biochemical role

[Term]
id: CHEBI:25213
name: metal cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "a metal cation" RELATED [UniProt]
synonym: "metal cations" RELATED [ChEBI]
is_a: CHEBI:23906 ! monoatomic cation
is_a: CHEBI:36915 ! inorganic cation

[Term]
id: CHEBI:25354
name: mineralocorticoid
namespace: chebi_ontology
def: "Mineralocorticoids are a class of steroid hormones that regulate water and electrolyte metabolism." []
subset: 3_STAR
synonym: "mineralocorticoids" RELATED [ChEBI]
is_a: CHEBI:36699 ! corticosteroid hormone

[Term]
id: CHEBI:25362
name: elemental molecule
namespace: chebi_ontology
def: "A molecule all atoms of which have the same atomic number." []
subset: 3_STAR
synonym: "homoatomic molecule" RELATED [ChEBI]
synonym: "homoatomic molecules" RELATED [ChEBI]
is_a: CHEBI:25367 ! molecule
is_a: CHEBI:33259 ! elemental molecular entity

[Term]
id: CHEBI:25367
name: molecule
namespace: chebi_ontology
def: "Any polyatomic entity that is an electrically neutral entity consisting of more than one atom." []
subset: 3_STAR
synonym: "molecula" RELATED [IUPAC]
synonym: "molecule" EXACT [IUPAC]
synonym: "molecules" RELATED [IUPAC]
synonym: "Molekuel" RELATED [ChEBI]
synonym: "neutral molecular compounds" RELATED [IUPAC]
is_a: CHEBI:36357 ! polyatomic entity

[Term]
id: CHEBI:25375
name: monoamine molecular messenger
namespace: chebi_ontology
def: "A group of neurotransmitters and neuromodulators that contain one amino group that is connected to an aromatic ring by ethylene group  (-CH2-CH2-). Monoamines are derived from the aromatic amino acids phenylalanine, tyrosine, histidine and tryptophan." []
subset: 3_STAR
synonym: "monamines" RELATED [ChEBI]
synonym: "monoamines" RELATED [ChEBI]
is_a: CHEBI:63534 ! monoamine
relationship: RO:0000087 CHEBI:33280 ! has role molecular messenger

[Term]
id: CHEBI:25384
name: monocarboxylic acid
namespace: chebi_ontology
def: "An oxoacid containing a single carboxy group." []
subset: 3_STAR
synonym: "monocarboxylic acids" RELATED [ChEBI]
is_a: CHEBI:33575 ! carboxylic acid
relationship: is_conjugate_acid_of CHEBI:35757 ! monocarboxylic acid anion

[Term]
id: CHEBI:25414
name: monoatomic monocation
namespace: chebi_ontology
subset: 3_STAR
synonym: "monoatomic monocations" RELATED [ChEBI]
synonym: "monovalent inorganic cations" RELATED [ChEBI]
is_a: CHEBI:23906 ! monoatomic cation
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "0.00000" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*+]" xsd:string

[Term]
id: CHEBI:25512
name: neurotransmitter
namespace: chebi_ontology
def: "An endogenous compound that is used to transmit information across the synapse between a neuron and another cell." []
subset: 3_STAR
synonym: "neurotransmitters" RELATED [ChEBI]
xref: Wikipedia:Neurotransmitter
is_a: CHEBI:33280 ! molecular messenger

[Term]
id: CHEBI:25555
name: nitrogen atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "7N" RELATED [IUPAC]
synonym: "azote" RELATED [IUPAC]
synonym: "N" RELATED [IUPAC]
synonym: "nitrogen" EXACT IUPAC_NAME [IUPAC]
synonym: "nitrogen" RELATED [ChEBI]
synonym: "nitrogeno" RELATED [ChEBI]
synonym: "Stickstoff" RELATED [ChEBI]
xref: WebElements:N
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33300 ! pnictogen
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "14.007" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "14.00307" xsd:string

[Term]
id: CHEBI:25585
name: nonmetal atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "Nichtmetall" RELATED [ChEBI]
synonym: "Nichtmetalle" RELATED [ChEBI]
synonym: "no metal" RELATED [ChEBI]
synonym: "no metales" RELATED [ChEBI]
synonym: "non-metal" RELATED [ChEBI]
synonym: "non-metaux" RELATED [ChEBI]
synonym: "nonmetal" EXACT IUPAC_NAME [IUPAC]
synonym: "nonmetal" RELATED [ChEBI]
synonym: "nonmetals" RELATED [ChEBI]
is_a: CHEBI:33250 ! atom

[Term]
id: CHEBI:25696
name: organic anion
namespace: chebi_ontology
def: "Any organic ion with a net negative charge." []
subset: 3_STAR
synonym: "organic anions" RELATED [ChEBI]
is_a: CHEBI:22563 ! anion
is_a: CHEBI:25699 ! organic ion

[Term]
id: CHEBI:25697
name: organic cation
namespace: chebi_ontology
def: "Any organic ion with a net positive charge." []
subset: 3_STAR
synonym: "organic cations" RELATED [ChEBI]
is_a: CHEBI:25699 ! organic ion
is_a: CHEBI:36916 ! cation

[Term]
id: CHEBI:25699
name: organic ion
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic ions" RELATED [ChEBI]
is_a: CHEBI:24870 ! ion
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:25704
name: organic sulfate
namespace: chebi_ontology
def: "Compounds of the general formula SO3HOR where R is an organyl group" []
subset: 3_STAR
synonym: "organic sulfates" RELATED [ChEBI]
is_a: CHEBI:26820 ! sulfates
relationship: is_conjugate_acid_of CHEBI:58958 ! organosulfate oxoanion

[Term]
id: CHEBI:25741
name: oxide
namespace: chebi_ontology
def: "An oxide is a chemical compound of oxygen with other chemical elements." []
subset: 3_STAR
synonym: "oxide" EXACT [ChEBI]
synonym: "oxides" RELATED [ChEBI]
is_a: CHEBI:25806 ! oxygen molecular entity
is_a: CHEBI:37577 ! heteroatomic molecular entity

[Term]
id: CHEBI:25805
name: oxygen atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "8O" RELATED [IUPAC]
synonym: "O" RELATED [IUPAC]
synonym: "oxigeno" RELATED [ChEBI]
synonym: "oxygen" EXACT IUPAC_NAME [IUPAC]
synonym: "oxygen" RELATED [ChEBI]
synonym: "oxygene" RELATED [ChEBI]
synonym: "Sauerstoff" RELATED [ChEBI]
xref: KEGG:C00007
xref: WebElements:O
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33303 ! chalcogen
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QVGXLLKOCUKJST-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "15.99940" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.99491" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O]" xsd:string

[Term]
id: CHEBI:25806
name: oxygen molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxygen molecular entities" RELATED [ChEBI]
synonym: "oxygen molecular entity" EXACT [ChEBI]
is_a: CHEBI:33304 ! chalcogen molecular entity
relationship: has_part CHEBI:25805 ! oxygen atom

[Term]
id: CHEBI:25905
name: peptide hormone
namespace: chebi_ontology
def: "Any peptide with hormonal activity in animals, whether endocrine, neuroendocrine, or paracrine." []
subset: 3_STAR
synonym: "peptide hormones" RELATED [ChEBI]
synonym: "polypeptide hormone" RELATED [ChEBI]
is_a: CHEBI:16670 ! peptide
relationship: RO:0000087 CHEBI:24621 ! has role hormone

[Term]
id: CHEBI:26020
name: phosphate
namespace: chebi_ontology
def: "Salts and esters of phosphoric and oligophosphoric acids and their chalcogen analogues. In inorganic chemistry, the term is also used to describe anionic coordination entities with phosphorus as central atom." []
subset: 3_STAR
synonym: "phosphates" EXACT IUPAC_NAME [IUPAC]
synonym: "phosphates" RELATED [ChEBI]
is_a: CHEBI:26079 ! phosphoric acid derivative

[Term]
id: CHEBI:26078
name: phosphoric acid
namespace: chebi_ontology
def: "A phosphorus oxoacid that consists of one oxo and three hydroxy groups joined covalently to a central phosphorus atom." []
subset: 3_STAR
synonym: "[PO(OH)3]" RELATED [IUPAC]
synonym: "acide phosphorique" RELATED [ChEBI]
synonym: "acidum phosphoricum" RELATED [ChEBI]
synonym: "H3PO4" RELATED [IUPAC]
synonym: "Orthophosphoric acid" RELATED [KEGG_COMPOUND]
synonym: "orthophosphoric acid" RELATED [NIST_Chemistry_WebBook]
synonym: "Phosphate" RELATED [KEGG_COMPOUND]
synonym: "Phosphoric acid" EXACT [KEGG_COMPOUND]
synonym: "phosphoric acid" EXACT [IUPAC]
synonym: "Phosphorsaeure" RELATED [ChEBI]
synonym: "Phosphorsaeureloesungen" RELATED [ChEBI]
synonym: "tetraoxophosphoric acid" EXACT IUPAC_NAME [IUPAC]
synonym: "trihydrogen tetraoxophosphate(3-)" EXACT IUPAC_NAME [IUPAC]
synonym: "trihydroxidooxidophosphorus" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:1921286 {source="Beilstein"}
xref: CAS:7664-38-2 {source="NIST Chemistry WebBook"}
xref: CAS:7664-38-2 {source="KEGG COMPOUND"}
xref: CAS:7664-38-2 {source="ChemIDplus"}
xref: Drug_Central:4478 {source="DrugCentral"}
xref: Gmelin:2000 {source="Gmelin"}
xref: HMDB:HMDB0002142
xref: KEGG:C00009
xref: KEGG:D05467
xref: KNApSAcK:C00007408
xref: PMID:11455380 {source="Europe PMC"}
xref: PMID:15630224 {source="Europe PMC"}
xref: PMID:17439666 {source="Europe PMC"}
xref: PMID:17518491 {source="Europe PMC"}
xref: PMID:22282755 {source="Europe PMC"}
xref: PMID:22333268 {source="Europe PMC"}
xref: PMID:22381614 {source="Europe PMC"}
xref: PMID:22401268 {source="Europe PMC"}
xref: Reaxys:1921286 {source="Reaxys"}
xref: Wikipedia:Phosphoric_Acid
is_a: CHEBI:59698 ! phosphoric acids
relationship: is_conjugate_acid_of CHEBI:39745 ! dihydrogenphosphate
relationship: RO:0000087 CHEBI:33287 ! has role fertilizer
relationship: RO:0000087 CHEBI:46787 ! has role solvent
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
relationship: RO:0000087 CHEBI:84735 ! has role algal metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H3O4P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "97.99520" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "97.97690" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OP(=O)(O[H])O[H]" xsd:string

[Term]
id: CHEBI:26079
name: phosphoric acid derivative
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:36359 ! phosphorus oxoacid derivative
relationship: has_functional_parent CHEBI:26078 ! phosphoric acid

[Term]
id: CHEBI:26082
name: phosphorus molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "phosphorus molecular entities" RELATED [ChEBI]
is_a: CHEBI:33302 ! pnictogen molecular entity
relationship: has_part CHEBI:28659 ! phosphorus atom

[Term]
id: CHEBI:26130
name: biological pigment
namespace: chebi_ontology
def: "An endogenous molecular entity that results in a colour of an organism as the consequence of the selective absorption of light." []
subset: 3_STAR
synonym: "pigments" RELATED [ChEBI]
is_a: CHEBI:52208 ! biophysical role

[Term]
id: CHEBI:26167
name: polar amino acid
namespace: chebi_ontology
alt_id: CHEBI:8283
def: "Any amino acid whose side chain is capable of forming one or more hydrogen bonds." []
subset: 3_STAR
synonym: "polar amino acid" EXACT [ChEBI]
synonym: "polar amino acids" RELATED [ChEBI]
synonym: "polar amino-acid" RELATED [ChEBI]
synonym: "polar amino-acids" RELATED [ChEBI]
xref: MetaCyc:Polar-amino-acids
xref: PMID:12016058 {source="Europe PMC"}
is_a: CHEBI:33709 ! amino acid
relationship: is_tautomer_of CHEBI:62031 ! polar amino acid zwitterion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC(C(*)N)=O" xsd:string

[Term]
id: CHEBI:26195
name: polyphenol
namespace: chebi_ontology
def: "Members of the class of phenols that contain 2 or more benzene rings each of which is substituted by at least one hydroxy group." []
subset: 3_STAR
synonym: "polyphenols" RELATED [ChEBI]
xref: Wikipedia:Polyphenol
is_a: CHEBI:33853 ! phenols

[Term]
id: CHEBI:26519
name: radical
namespace: chebi_ontology
def: "A molecular entity possessing an unpaired electron." []
subset: 3_STAR
synonym: "free radical" RELATED [ChEBI]
synonym: "freies Radikal" RELATED [ChEBI]
synonym: "radical" EXACT IUPAC_NAME [IUPAC]
synonym: "radical libre" RELATED [ChEBI]
synonym: "radicales libres" RELATED [ChEBI]
synonym: "radicals" RELATED [IUPAC]
synonym: "Radikal" RELATED [ChEBI]
synonym: "Radikale" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity

[Term]
id: CHEBI:26523
name: reactive oxygen species
namespace: chebi_ontology
def: "Molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers." []
subset: 3_STAR
synonym: "ROS" RELATED [ChEBI]
xref: Wikipedia:Reactive_oxygen_species
is_a: CHEBI:25806 ! oxygen molecular entity

[Term]
id: CHEBI:26607
name: saturated fatty acid
namespace: chebi_ontology
def: "Any fatty acid containing no carbon to carbon multiple bonds. Known to produce adverse biological effects when ingested to excess." []
subset: 3_STAR
synonym: "saturated fatty acid" EXACT [ChEBI]
synonym: "saturated fatty acids" RELATED [ChEBI]
synonym: "SFA" RELATED [ChEBI]
synonym: "SFAs" RELATED [ChEBI]
xref: PMID:16492686 {source="Europe PMC"}
xref: PMID:19763019 {source="Europe PMC"}
xref: PMID:20237329 {source="Europe PMC"}
is_a: CHEBI:35366 ! fatty acid

[Term]
id: CHEBI:26650
name: serine family amino acid
namespace: chebi_ontology
def: "An L-alpha-amino acid which is biosynthesised from 3-phosphoglycerate (i.e. serine, glycine, cysteine and homocysteine). A closed class." []
subset: 3_STAR
synonym: "3-phosphoglycerate family amino acid" RELATED [ChEBI]
synonym: "3-phosphoglycerate family amino acids" RELATED [ChEBI]
synonym: "serine family amino acids" RELATED [ChEBI]
xref: PMID:20709681 {source="Europe PMC"}
is_a: CHEBI:15705 ! L-alpha-amino acid
is_a: CHEBI:83813 ! proteinogenic amino acid

[Term]
id: CHEBI:26658
name: sesquiterpenoid
namespace: chebi_ontology
def: "Any terpenoid derived from a sesquiterpene. The term includes compounds in which the C15 skeleton of the parent sesquiterpene has been rearranged or modified by the removal of one or more skeletal atoms (generally methyl groups)." []
subset: 3_STAR
synonym: "sesquiterpenoides" RELATED [ChEBI]
synonym: "sesquiterpenoids" RELATED [ChEBI]
xref: LIPID_MAPS_class:LMPR0103 {source="LIPID MAPS"}
is_a: CHEBI:26873 ! terpenoid
relationship: has_parent_hydride CHEBI:35189 ! sesquiterpene

[Term]
id: CHEBI:26666
name: short-chain fatty acid
namespace: chebi_ontology
def: "An aliphatic monocarboxylic acid with a chain length of less than C6. If any non-hydrocarbon substituent is present, the compound is not normally regarded as a short-chain fatty acid." []
subset: 3_STAR
synonym: "SCFA" RELATED [ChEBI]
synonym: "SCFAs" RELATED [ChEBI]
synonym: "short-chain fatty acids" RELATED [ChEBI]
xref: PMID:16633129 {source="Europe PMC"}
xref: PMID:16870803 {source="Europe PMC"}
xref: PMID:18203540 {source="Europe PMC"}
xref: PMID:20148677 {source="Europe PMC"}
is_a: CHEBI:35366 ! fatty acid
relationship: is_conjugate_acid_of CHEBI:58951 ! short-chain fatty acid anion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.017" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string

[Term]
id: CHEBI:26708
name: sodium atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "11Na" RELATED [IUPAC]
synonym: "Na" RELATED [IUPAC]
synonym: "Natrium" RELATED [ChemIDplus]
synonym: "natrium" RELATED [IUPAC]
synonym: "sodio" RELATED [ChemIDplus]
synonym: "sodium" EXACT IUPAC_NAME [IUPAC]
synonym: "sodium" RELATED [ChEBI]
xref: CAS:7440-23-5 {source="ChemIDplus"}
xref: Gmelin:16221 {source="Gmelin"}
xref: KEGG:C01330
xref: WebElements:Na
is_a: CHEBI:22314 ! alkali metal atom
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Na" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Na" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KEAYESYHFKHZAL-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "22.98977" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "22.98977" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Na]" xsd:string

[Term]
id: CHEBI:26712
name: sodium molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "sodium compounds" RELATED [ChEBI]
synonym: "sodium molecular entities" RELATED [ChEBI]
is_a: CHEBI:33296 ! alkali metal molecular entity
relationship: has_part CHEBI:26708 ! sodium atom

[Term]
id: CHEBI:26714
name: sodium salt
namespace: chebi_ontology
def: "Any alkali metal salt having sodium(1+) as the cation." []
subset: 3_STAR
synonym: "Natriumsalz" RELATED [ChEBI]
synonym: "Natriumsalze" RELATED [ChEBI]
synonym: "sodium salts" RELATED [ChEBI]
is_a: CHEBI:26712 ! sodium molecular entity
is_a: CHEBI:35479 ! alkali metal salt
relationship: has_part CHEBI:29101 ! sodium(1+)

[Term]
id: CHEBI:26739
name: sphingolipid
namespace: chebi_ontology
def: "Sphingolipids are a complex family of compounds that share a common structural feature, a sphingoid base backbone." []
subset: 3_STAR
synonym: "sphingolipids" RELATED [ChEBI]
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:35352 ! organonitrogen compound
is_a: CHEBI:36963 ! organooxygen compound

[Term]
id: CHEBI:26764
name: steroid hormone
namespace: chebi_ontology
def: "Any steroid that acts as hormone." []
subset: 3_STAR
synonym: "hormona esteroide" RELATED [ChEBI]
synonym: "hormonas esteroideas" RELATED [ChEBI]
synonym: "hormone steroide" RELATED [ChEBI]
synonym: "hormones steroides" RELATED [ChEBI]
synonym: "steroid hormones" RELATED [ChEBI]
synonym: "Steroidhormon" RELATED [ChEBI]
synonym: "Steroidhormone" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid
relationship: RO:0000087 CHEBI:24621 ! has role hormone

[Term]
id: CHEBI:26819
name: sulfuric ester
namespace: chebi_ontology
def: "An ester of an alcohol and sulfuric acid." []
subset: 3_STAR
synonym: "sulfate ester" RELATED [ChEBI]
synonym: "sulfuric acid ester" RELATED [ChEBI]
synonym: "sulfuric acid esters" RELATED [ChEBI]
is_a: CHEBI:35701 ! ester
is_a: CHEBI:37826 ! sulfuric acid derivative
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O4SR2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06300" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95173" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]OS(=O)(=O)O[*]" xsd:string

[Term]
id: CHEBI:26820
name: sulfates
namespace: chebi_ontology
def: "Salts and esters of sulfuric acid" []
subset: 3_STAR
synonym: "sulfates" EXACT [ChEBI]
synonym: "sulfuric acid derivative" RELATED [ChEBI]
synonym: "sulphates" RELATED [ChEBI]
is_a: CHEBI:37826 ! sulfuric acid derivative

[Term]
id: CHEBI:26833
name: sulfur atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "16S" RELATED [IUPAC]
synonym: "azufre" RELATED [ChEBI]
synonym: "Elemental sulfur" RELATED [KEGG_COMPOUND]
synonym: "S" RELATED [KEGG_COMPOUND]
synonym: "S" RELATED [IUPAC]
synonym: "Schwefel" RELATED [ChEBI]
synonym: "soufre" RELATED [ChEBI]
synonym: "sulfur" EXACT IUPAC_NAME [IUPAC]
synonym: "sulfur" RELATED [ChEBI]
synonym: "sulfur" RELATED [UniProt]
synonym: "sulphur" RELATED [ChEBI]
synonym: "theion" RELATED [IUPAC]
xref: CAS:7704-34-9 {source="ChemIDplus"}
xref: CAS:7704-34-9 {source="NIST Chemistry WebBook"}
xref: KEGG:C00087
xref: KEGG:D06527
xref: PPDB:605
xref: WebElements:S
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33303 ! chalcogen
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NINIDFKCEFEMDL-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "32.06600" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.97207" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[S]" xsd:string

[Term]
id: CHEBI:26835
name: sulfur molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "sulfur molecular entities" RELATED [ChEBI]
synonym: "sulfur molecular entity" EXACT [ChEBI]
is_a: CHEBI:33304 ! chalcogen molecular entity
relationship: has_part CHEBI:26833 ! sulfur atom

[Term]
id: CHEBI:26836
name: sulfuric acid
namespace: chebi_ontology
def: "A sulfur oxoacid that consists of two oxo and two hydroxy groups joined covalently to a central sulfur atom." []
subset: 3_STAR
synonym: "[S(OH)2O2]" RELATED [MolBase]
synonym: "[SO2(OH)2]" RELATED [IUPAC]
synonym: "Acide sulfurique" RELATED [ChemIDplus]
synonym: "Acido sulfurico" RELATED [ChemIDplus]
synonym: "Acidum sulfuricum" RELATED [ChemIDplus]
synonym: "dihydrogen tetraoxosulfate" EXACT IUPAC_NAME [IUPAC]
synonym: "dihydroxidodioxidosulfur" EXACT IUPAC_NAME [IUPAC]
synonym: "H2SO4" RELATED [IUPAC]
synonym: "hydrogen tetraoxosulfate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogen tetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC]
synonym: "Schwefelsaeureloesungen" RELATED [ChemIDplus]
synonym: "Sulfuric acid" EXACT [KEGG_COMPOUND]
synonym: "sulfuric acid" EXACT IUPAC_NAME [IUPAC]
synonym: "sulfuric acid" EXACT [ChEBI]
synonym: "sulphuric acid" RELATED [MolBase]
synonym: "tetraoxosulfuric acid" EXACT IUPAC_NAME [IUPAC]
xref: CAS:7664-93-9 {source="ChemIDplus"}
xref: CAS:7664-93-9 {source="KEGG COMPOUND"}
xref: CAS:7664-93-9 {source="NIST Chemistry WebBook"}
xref: Gmelin:2122 {source="Gmelin"}
xref: KEGG:C00059
xref: KEGG:D05963
xref: KNApSAcK:C00007530
xref: MolBase:4
xref: PMID:13568755 {source="Europe PMC"}
xref: PMID:16122922 {source="Europe PMC"}
xref: PMID:19397353 {source="Europe PMC"}
xref: PMID:22047659 {source="Europe PMC"}
xref: PMID:22136045 {source="Europe PMC"}
xref: PMID:22204399 {source="Europe PMC"}
xref: PMID:22267186 {source="Europe PMC"}
xref: PMID:22296037 {source="Europe PMC"}
xref: PMID:22364556 {source="Europe PMC"}
xref: PMID:22435616 {source="Europe PMC"}
xref: PPDB:606
xref: Reaxys:2037554 {source="Reaxys"}
xref: Wikipedia:Sulfuric_acid
is_a: CHEBI:33402 ! sulfur oxoacid
relationship: is_conjugate_acid_of CHEBI:45696 ! hydrogensulfate
relationship: RO:0000087 CHEBI:35223 ! has role catalyst
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O4S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "98.07948" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "97.96738" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OS(=O)(=O)O[H]" xsd:string

[Term]
id: CHEBI:26873
name: terpenoid
namespace: chebi_ontology
def: "Any isoprenoid that is a natural product or related compound formally derived from isoprene units. Terpenoids may contain oxygen in various functional groups. This class is subdivided according to the number of carbon atoms in the parent terpene. The skeleton of terpenoids may differ from strict additivity of isoprene units by the loss or shift of a fragment, generally a methyl group." []
subset: 3_STAR
synonym: "Terpenoid" EXACT [ChEBI]
synonym: "terpenoide" RELATED [IUPAC]
synonym: "terpenoides" RELATED [IUPAC]
synonym: "terpenoids" EXACT IUPAC_NAME [IUPAC]
xref: Wikipedia:Terpenoid
is_a: CHEBI:24913 ! isoprenoid
relationship: has_parent_hydride CHEBI:35186 ! terpene

[Term]
id: CHEBI:26932
name: tetrapyrrole
namespace: chebi_ontology
def: "A natural pigment containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next." []
subset: 3_STAR
synonym: "a tetrapyrrole" RELATED [UniProt]
synonym: "tetrapyrrole" EXACT IUPAC_NAME [IUPAC]
synonym: "tetrapyrroles" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33833 ! heteroarene
is_a: CHEBI:38077 ! polypyrrole

[Term]
id: CHEBI:27027
name: micronutrient
namespace: chebi_ontology
def: "Any nutrient required in small quantities by organisms throughout their life in order to orchestrate a range of physiological functions." []
subset: 3_STAR
synonym: "micronutrients" RELATED [ChEBI]
synonym: "trace elements" RELATED [ChEBI]
xref: Wikipedia:Micronutrient
is_a: CHEBI:33284 ! nutrient

[Term]
id: CHEBI:27081
name: transition element atom
namespace: chebi_ontology
def: "An element whose atom has an incomplete d sub-shell, or which can give rise to cations with an incomplete d sub-shell." []
subset: 3_STAR
synonym: "metal de transicion" RELATED [ChEBI]
synonym: "metal de transition" RELATED [ChEBI]
synonym: "metales de transicion" RELATED [ChEBI]
synonym: "metaux de transition" RELATED [ChEBI]
synonym: "transition element" EXACT IUPAC_NAME [IUPAC]
synonym: "transition element" RELATED [ChEBI]
synonym: "transition elements" RELATED [ChEBI]
synonym: "transition metal" RELATED [ChEBI]
synonym: "transition metals" RELATED [ChEBI]
synonym: "Uebergangselement" RELATED [ChEBI]
synonym: "Uebergangsmetalle" RELATED [ChEBI]
is_a: CHEBI:33521 ! metal atom

[Term]
id: CHEBI:27162
name: tryptamines
namespace: chebi_ontology
def: "Tryptamine and its substitution derivatives." []
subset: 3_STAR
is_a: CHEBI:24828 ! indoles

[Term]
id: CHEBI:27171
name: organic heterobicyclic compound
namespace: chebi_ontology
subset: 3_STAR
synonym: "heterobicyclic compounds" RELATED [ChEBI]
synonym: "organic heterobicyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33672 ! heterobicyclic compound
is_a: CHEBI:38166 ! organic heteropolycyclic compound

[Term]
id: CHEBI:27207
name: univalent carboacyl group
namespace: chebi_ontology
def: "A univalent carboacyl group is a group formed by loss of OH from the carboxy group of a carboxylic acid." []
subset: 3_STAR
synonym: "univalent acyl group" RELATED [ChEBI]
synonym: "univalent carboacyl groups" RELATED [ChEBI]
synonym: "univalent carboxylic acyl groups" RELATED [ChEBI]
is_a: CHEBI:37838 ! carboacyl group

[Term]
id: CHEBI:27369
name: zwitterion
namespace: chebi_ontology
def: "A neutral compound having formal unit electrical charges of opposite sign on non-adjacent atoms. Sometimes referred to as inner salts, dipolar ions (a misnomer)." []
subset: 3_STAR
synonym: "compose zwitterionique" RELATED [IUPAC]
synonym: "compuestos zwitterionicos" RELATED [IUPAC]
synonym: "zwitterion" EXACT IUPAC_NAME [IUPAC]
synonym: "zwitteriones" RELATED [IUPAC]
synonym: "zwitterionic compounds" RELATED [IUPAC]
synonym: "zwitterions" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:51151 ! dipolar compound

[Term]
id: CHEBI:27584
name: aldosterone
namespace: chebi_ontology
alt_id: CHEBI:22306
alt_id: CHEBI:2563
alt_id: CHEBI:40919
def: "A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure. The overall effect of aldosterone is to increase reabsorption of ions and water in the kidney." []
subset: 3_STAR
synonym: "(+)-aldosterone" RELATED [NIST_Chemistry_WebBook]
synonym: "(11beta)-11,21-dihydroxy-3,20-dioxopregn-4-en-18-al" RELATED [NIST_Chemistry_WebBook]
synonym: "11beta,21-Dihydroxy-3,20-dioxo-4-pregnen-18-al" RELATED [KEGG_COMPOUND]
synonym: "11beta,21-dihydroxy-3,20-dioxopregn-4-en-18-al" EXACT IUPAC_NAME [IUPAC]
synonym: "ALDOSTERONE" EXACT [PDBeChem]
synonym: "Aldosterone" EXACT [KEGG_COMPOUND]
synonym: "aldosterone" EXACT [UniProt]
xref: Beilstein:3224996 {source="ChemIDplus"}
xref: CAS:52-39-1 {source="ChemIDplus"}
xref: CAS:52-39-1 {source="NIST Chemistry WebBook"}
xref: CAS:52-39-1 {source="KEGG COMPOUND"}
xref: Drug_Central:111 {source="DrugCentral"}
xref: DrugBank:DB04630
xref: HMDB:HMDB0000037
xref: KEGG:C01780
xref: LINCS:LSM-42770
xref: LIPID_MAPS_instance:LMST02030026 {source="LIPID MAPS"}
xref: PDBeChem:AS4
xref: PMID:10438974 {source="Europe PMC"}
xref: Reaxys:3224996 {source="Reaxys"}
xref: Wikipedia:Aldosterone
is_a: CHEBI:131565 ! steroid aldehyde
is_a: CHEBI:139590 ! primary alpha-hydroxy ketone
is_a: CHEBI:25354 ! mineralocorticoid
is_a: CHEBI:35344 ! 21-hydroxy steroid
is_a: CHEBI:35346 ! 11beta-hydroxy steroid
is_a: CHEBI:36885 ! 20-oxo steroid
is_a: CHEBI:36887 ! 18-oxo steroid
is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid
is_a: CHEBI:64600 ! C21-steroid hormone
relationship: has_parent_hydride CHEBI:8386 ! pregnane
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H28O5" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H28O5/c1-20-7-6-13(24)8-12(20)2-3-14-15-4-5-16(18(26)10-22)21(15,11-23)9-17(25)19(14)20/h8,11,14-17,19,22,25H,2-7,9-10H2,1H3/t14-,15-,16+,17-,19+,20-,21+/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "PQSUYGKTWSAVDQ-ZVIOFETBSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "360.44400" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.19367" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4=CC(=O)CC[C@]4(C)[C@@]3([H])[C@@H](O)C[C@]12C=O)C(=O)CO" xsd:string

[Term]
id: CHEBI:27594
name: carbon atom
namespace: chebi_ontology
alt_id: CHEBI:23009
alt_id: CHEBI:3399
subset: 3_STAR
synonym: "6C" RELATED [IUPAC]
synonym: "C" RELATED [KEGG_COMPOUND]
synonym: "C" RELATED [IUPAC]
synonym: "Carbon" RELATED [KEGG_COMPOUND]
synonym: "carbon" EXACT IUPAC_NAME [IUPAC]
synonym: "carbon" RELATED [ChEBI]
synonym: "carbone" RELATED [ChEBI]
synonym: "carbonium" RELATED [ChEBI]
synonym: "carbono" RELATED [ChEBI]
synonym: "Kohlenstoff" RELATED [ChEBI]
xref: CAS:7440-44-0 {source="ChemIDplus"}
xref: CAS:7440-44-0 {source="KEGG COMPOUND"}
xref: KEGG:C06265
xref: WebElements:C
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33306 ! carbon group element atom
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OKTJSMMVPCPJKN-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "12.01070" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "12.00000" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[C]" xsd:string

[Term]
id: CHEBI:28087
name: glycogen
namespace: chebi_ontology
alt_id: CHEBI:24379
alt_id: CHEBI:5466
def: "A polydisperse, highly branched glucan composed of chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage, joined together by alpha(1->6) glycosidic linkages. A small number of alpha(1->3) glycosidic linkages and some cumulative alpha(1->6) links also may occur. The branches in glycogen typically contain 8 to 12 glucose residues." []
subset: 3_STAR
synonym: "animal starch" RELATED [ChemIDplus]
synonym: "Glycogen" EXACT [KEGG_COMPOUND]
synonym: "liver starch" RELATED [ChemIDplus]
synonym: "WURCS=2.0/1,4,3/[a2122h-1a_1-5]/1-1-1-1/a4-b1_b4-c1_b6-d1" RELATED [GlyTouCan]
xref: CAS:9005-79-2 {source="KEGG COMPOUND"}
xref: CAS:9005-79-2 {source="ChemIDplus"}
xref: GlyGen:G99991IU
xref: GlyTouCan:G99991IU
xref: HMDB:HMDB0000757
xref: KEGG:C00182
xref: MetaCyc:CPD0-971
xref: Wikipedia:Glycogen
is_a: CHEBI:24384 ! glycogens
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite

[Term]
id: CHEBI:28616
name: carbamic acid
namespace: chebi_ontology
alt_id: CHEBI:22504
alt_id: CHEBI:23002
alt_id: CHEBI:3386
alt_id: CHEBI:44573
def: "A one-carbon compound that is ammonia in which one of the hydrogens is replaced by a carboxy group. Although carbamic acid derivatives are common, carbamic acid itself has never been synthesised." []
subset: 3_STAR
synonym: "Aminoameisensaeure" RELATED [ChEBI]
synonym: "Aminoformic acid" RELATED [KEGG_COMPOUND]
synonym: "Carbamate" RELATED [KEGG_COMPOUND]
synonym: "CARBAMIC ACID" EXACT [PDBeChem]
synonym: "Carbamic acid" EXACT [KEGG_COMPOUND]
synonym: "carbamic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "Carbamidsaeure" RELATED [ChEBI]
xref: Beilstein:1734754 {source="Beilstein"}
xref: CAS:463-77-4 {source="KEGG COMPOUND"}
xref: CAS:463-77-4 {source="ChemIDplus"}
xref: DrugBank:DB04261
xref: Gmelin:130345 {source="Gmelin"}
xref: KEGG:C01563
xref: PDBeChem:OUT
xref: Wikipedia:Carbamic_acid
is_a: CHEBI:35352 ! organonitrogen compound
is_a: CHEBI:35605 ! carbon oxoacid
is_a: CHEBI:64708 ! one-carbon compound
relationship: is_conjugate_acid_of CHEBI:13941 ! carbamate
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KXDHJXZQYSOELW-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "61.04006" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "61.01638" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(O)=O" xsd:string

[Term]
id: CHEBI:28659
name: phosphorus atom
namespace: chebi_ontology
alt_id: CHEBI:26080
alt_id: CHEBI:8168
subset: 3_STAR
synonym: "15P" RELATED [IUPAC]
synonym: "fosforo" RELATED [ChEBI]
synonym: "P" RELATED [IUPAC]
synonym: "P" RELATED [KEGG_COMPOUND]
synonym: "Phosphor" RELATED [ChEBI]
synonym: "phosphore" RELATED [ChEBI]
synonym: "Phosphorus" RELATED [KEGG_COMPOUND]
synonym: "phosphorus" EXACT IUPAC_NAME [IUPAC]
synonym: "phosphorus" RELATED [ChEBI]
xref: CAS:7723-14-0 {source="ChemIDplus"}
xref: CAS:7723-14-0 {source="KEGG COMPOUND"}
xref: Gmelin:16235 {source="Gmelin"}
xref: KEGG:C06262
xref: WebElements:P
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33300 ! pnictogen
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OAICVXFJPJFONN-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "30.97376" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "30.97376" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[P]" xsd:string

[Term]
id: CHEBI:28790
name: serotonin
namespace: chebi_ontology
alt_id: CHEBI:1420
alt_id: CHEBI:26652
alt_id: CHEBI:49894
def: "A primary amino compound that is the 5-hydroxy derivative of tryptamine." []
subset: 3_STAR
synonym: "3-(2-Aminoethyl)-1H-indol-5-ol" RELATED [KEGG_COMPOUND]
synonym: "3-(2-aminoethyl)-1H-indol-5-ol" EXACT IUPAC_NAME [IUPAC]
synonym: "5-HT" RELATED [IUPHAR]
synonym: "5-Hydroxytryptamine" RELATED [KEGG_COMPOUND]
synonym: "Enteramine" RELATED [KEGG_COMPOUND]
synonym: "SEROTONIN" EXACT [PDBeChem]
synonym: "Serotonin" EXACT [KEGG_COMPOUND]
synonym: "serotonine" RELATED [ChEBI]
synonym: "thrombocytin" RELATED [ChemIDplus]
synonym: "thrombotonin" RELATED [ChemIDplus]
xref: Beilstein:143524 {source="Beilstein"}
xref: CAS:50-67-9 {source="KEGG COMPOUND"}
xref: CAS:50-67-9 {source="ChemIDplus"}
xref: Gmelin:1861995 {source="Gmelin"}
xref: HMDB:HMDB0000259
xref: KEGG:C00780
xref: KNApSAcK:C00001429
xref: LINCS:LSM-6589
xref: MetaCyc:SEROTONIN
xref: PDBeChem:SRO
xref: PMID:18593914 {source="Europe PMC"}
xref: PMID:22770225 {source="Europe PMC"}
xref: PMID:24136337 {source="Europe PMC"}
xref: Reaxys:143524 {source="Reaxys"}
xref: Wikipedia:Serotonin
is_a: CHEBI:25375 ! monoamine molecular messenger
is_a: CHEBI:27162 ! tryptamines
is_a: CHEBI:33853 ! phenols
is_a: CHEBI:50994 ! primary amino compound
is_a: CHEBI:84729 ! hydroxyindoles
relationship: has_functional_parent CHEBI:16765 ! tryptamine
relationship: is_conjugate_base_of CHEBI:350546 ! serotonin(1+)
relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H12N2O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2O/c11-4-3-7-6-12-10-2-1-8(13)5-9(7)10/h1-2,5-6,12-13H,3-4,11H2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZAYGJVTTNCVMB-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "176.215" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "176.09496" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=CC(=CC=2C(=CNC12)CCN)O" xsd:string

[Term]
id: CHEBI:28868
name: fatty acid anion
namespace: chebi_ontology
alt_id: CHEBI:13634
alt_id: CHEBI:24022
alt_id: CHEBI:4985
def: "The conjugate base of a fatty acid, arising from deprotonation of the carboxylic acid group of the corresponding fatty acid." []
subset: 3_STAR
synonym: "a fatty acid" RELATED [UniProt]
synonym: "acido graso anionico" RELATED [ChEBI]
synonym: "acidos grasos anionicos" RELATED [ChEBI]
synonym: "Alkanate" RELATED [KEGG_COMPOUND]
synonym: "anion de l'acide gras" RELATED [ChEBI]
synonym: "Fatty acid anion" EXACT [KEGG_COMPOUND]
synonym: "fatty acid anions" RELATED [ChEBI]
synonym: "Fettsaeureanion" RELATED [ChEBI]
synonym: "Fettsaeureanionen" RELATED [ChEBI]
xref: KEGG:C02403
xref: PMID:18628202 {source="Europe PMC"}
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:35757 ! monocarboxylic acid anion
relationship: is_conjugate_base_of CHEBI:35366 ! fatty acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.00950" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string

[Term]
id: CHEBI:28938
name: ammonium
namespace: chebi_ontology
alt_id: CHEBI:22534
alt_id: CHEBI:49783
alt_id: CHEBI:7435
def: "An onium cation obtained by protonation of ammonia." []
subset: 3_STAR
synonym: "[NH4](+)" RELATED [MolBase]
synonym: "ammonium" EXACT IUPAC_NAME [IUPAC]
synonym: "ammonium" EXACT [ChEBI]
synonym: "ammonium cation" RELATED [ChemIDplus]
synonym: "ammonium ion" RELATED [PDBeChem]
synonym: "Ammonium(1+)" RELATED [ChemIDplus]
synonym: "azanium" EXACT IUPAC_NAME [IUPAC]
synonym: "NH4(+)" RELATED [UniProt]
synonym: "NH4(+)" RELATED [IUPAC]
synonym: "NH4+" RELATED [KEGG_COMPOUND]
xref: CAS:14798-03-9 {source="NIST Chemistry WebBook"}
xref: CAS:14798-03-9 {source="ChemIDplus"}
xref: Gmelin:84 {source="Gmelin"}
xref: KEGG:C01342
xref: MetaCyc:AMMONIUM
xref: MolBase:929
xref: PDBeChem:NH4
xref: PMID:11319011 {source="Europe PMC"}
xref: PMID:11341317 {source="Europe PMC"}
xref: PMID:12096804 {source="Europe PMC"}
xref: PMID:14512268 {source="Europe PMC"}
xref: PMID:14879753 {source="Europe PMC"}
xref: PMID:16345391 {source="Europe PMC"}
xref: PMID:16903292 {source="Europe PMC"}
xref: PMID:17392693 {source="Europe PMC"}
xref: PMID:18515490 {source="Europe PMC"}
xref: PMID:19199063 {source="Europe PMC"}
xref: PMID:19596600 {source="Europe PMC"}
xref: PMID:19682559 {source="Europe PMC"}
xref: PMID:19716251 {source="Europe PMC"}
xref: PMID:21993530 {source="Europe PMC"}
xref: PMID:22265469 {source="Europe PMC"}
xref: PMID:22524020 {source="Europe PMC"}
xref: PMID:22562341 {source="Europe PMC"}
xref: PMID:22631217 {source="Europe PMC"}
xref: Reaxys:16093784 {source="Reaxys"}
xref: Wikipedia:Ammonium
is_a: CHEBI:35106 ! nitrogen hydride
is_a: CHEBI:50313 ! onium cation
is_a: CHEBI:60242 ! monovalent inorganic cation
relationship: is_conjugate_acid_of CHEBI:16134 ! ammonia
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H4N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3N/h1H3/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QGZKDVFQNNGYKY-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "18.03850" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "18.03383" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][N+]([H])([H])[H]" xsd:string

[Term]
id: CHEBI:28965
name: dicarboxylic acid dianion
namespace: chebi_ontology
alt_id: CHEBI:13632
alt_id: CHEBI:23688
alt_id: CHEBI:23689
alt_id: CHEBI:38711
def: "A carboxylic acid dianion obtained by deprotonation of both carboxy groups of any dicarboxylic acid." []
subset: 3_STAR
synonym: "a dicarboxylate" RELATED [UniProt]
synonym: "dicarboxylate" RELATED [ChEBI]
synonym: "dicarboxylates" RELATED [ChEBI]
synonym: "dicarboxylic acid dianion" EXACT [ChEBI]
synonym: "dicarboxylic acid dianions" RELATED [ChEBI]
is_a: CHEBI:35693 ! dicarboxylic acid anion
is_a: CHEBI:38716 ! carboxylic acid dianion
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2O4R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "88.019" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.97966" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C(=O)[*]C([O-])=O" xsd:string

[Term]
id: CHEBI:28976
name: carbonic acid
namespace: chebi_ontology
alt_id: CHEBI:13351
alt_id: CHEBI:23017
alt_id: CHEBI:23744
alt_id: CHEBI:3401
subset: 3_STAR
synonym: "[CO(OH)2]" RELATED [IUPAC]
synonym: "Carbonic acid" EXACT [KEGG_COMPOUND]
synonym: "carbonic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "Dihydrogen carbonate" RELATED [KEGG_COMPOUND]
synonym: "dihydroxidooxidocarbon" EXACT IUPAC_NAME [IUPAC]
synonym: "H2CO3" RELATED [KEGG_COMPOUND]
synonym: "H2CO3" RELATED [IUPAC]
synonym: "Koehlensaeure" RELATED [ChEBI]
xref: CAS:463-79-6 {source="ChemIDplus"}
xref: CAS:463-79-6 {source="KEGG COMPOUND"}
xref: Gmelin:25554 {source="Gmelin"}
xref: KEGG:C01353
xref: PDBeChem:CO3
is_a: CHEBI:35605 ! carbon oxoacid
is_a: CHEBI:36961 ! chalcocarbonic acid
relationship: is_conjugate_acid_of CHEBI:17544 ! hydrogencarbonate
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2O3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "62.02478" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "62.00039" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC(O)=O" xsd:string

[Term]
id: CHEBI:29057
name: keratan
namespace: chebi_ontology
alt_id: CHEBI:14490
alt_id: CHEBI:24954
subset: 1_STAR
is_a: CHEBI:18085 ! glycosaminoglycan

[Term]
id: CHEBI:29067
name: carboxylic acid anion
namespace: chebi_ontology
alt_id: CHEBI:13626
alt_id: CHEBI:13945
alt_id: CHEBI:23026
alt_id: CHEBI:58657
def: "The conjugate base formed when the carboxy group of a carboxylic acid is deprotonated." []
subset: 3_STAR
synonym: "a carboxylate" RELATED [UniProt]
synonym: "carboxylic acid anions" RELATED [ChEBI]
synonym: "carboxylic anions" RELATED [ChEBI]
is_a: CHEBI:25696 ! organic anion
is_a: CHEBI:35406 ! oxoanion
relationship: is_conjugate_base_of CHEBI:33575 ! carboxylic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.00950" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string

[Term]
id: CHEBI:29101
name: sodium(1+)
namespace: chebi_ontology
alt_id: CHEBI:26717
alt_id: CHEBI:49766
alt_id: CHEBI:9175
def: "A monoatomic monocation obtained from sodium." []
subset: 3_STAR
synonym: "Na(+)" RELATED [UniProt]
synonym: "Na(+)" RELATED [IUPAC]
synonym: "Na+" RELATED [KEGG_COMPOUND]
synonym: "sodium cation" EXACT IUPAC_NAME [IUPAC]
synonym: "SODIUM ION" RELATED [PDBeChem]
synonym: "sodium(1+)" EXACT IUPAC_NAME [IUPAC]
synonym: "sodium(1+) ion" EXACT IUPAC_NAME [IUPAC]
synonym: "sodium(I) cation" EXACT IUPAC_NAME [IUPAC]
xref: CAS:17341-25-2 {source="ChemIDplus"}
xref: CAS:17341-25-2 {source="NIST Chemistry WebBook"}
xref: Gmelin:15196 {source="Gmelin"}
xref: KEGG:C01330
xref: PDBeChem:NA
is_a: CHEBI:25414 ! monoatomic monocation
is_a: CHEBI:33504 ! alkali metal cation
is_a: CHEBI:37246 ! elemental sodium
is_a: CHEBI:60242 ! monovalent inorganic cation
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Na" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Na/q+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FKNQFGJONOIPTF-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "22.98977" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "22.98922" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Na+]" xsd:string

[Term]
id: CHEBI:29108
name: calcium(2+)
namespace: chebi_ontology
alt_id: CHEBI:22988
alt_id: CHEBI:3308
alt_id: CHEBI:48760
subset: 3_STAR
synonym: "Ca(2+)" RELATED [IUPAC]
synonym: "Ca(2+)" RELATED [UniProt]
synonym: "Ca2+" RELATED [KEGG_COMPOUND]
synonym: "CALCIUM ION" RELATED [PDBeChem]
synonym: "calcium(2+)" EXACT IUPAC_NAME [IUPAC]
synonym: "calcium(2+) ion" EXACT IUPAC_NAME [IUPAC]
synonym: "calcium(II) cation" EXACT IUPAC_NAME [IUPAC]
synonym: "calcium, doubly charged positive ion" RELATED [NIST_Chemistry_WebBook]
xref: CAS:14127-61-8 {source="ChemIDplus"}
xref: CAS:14127-61-8 {source="NIST Chemistry WebBook"}
xref: Gmelin:6850 {source="Gmelin"}
xref: KEGG:C00076
xref: PDBeChem:CA
is_a: CHEBI:30412 ! monoatomic dication
is_a: CHEBI:39123 ! calcium cation
is_a: CHEBI:60240 ! divalent metal cation
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Ca/q+2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BHPQYMZQTOCNFJ-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "40.07800" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96149" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Ca++]" xsd:string

[Term]
id: CHEBI:29337
name: azanide
namespace: chebi_ontology
subset: 3_STAR
synonym: "amide" EXACT IUPAC_NAME [IUPAC]
synonym: "azanide" EXACT IUPAC_NAME [IUPAC]
synonym: "dihydridonitrate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "NH2(-)" RELATED [IUPAC]
is_a: CHEBI:35106 ! nitrogen hydride
is_a: CHEBI:79389 ! monovalent inorganic anion
relationship: is_conjugate_acid_of CHEBI:29340 ! hydridonitrate(2-)
relationship: is_conjugate_base_of CHEBI:16134 ! ammonia
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H2N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2N/h1H2/q-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "HYGWNUKOUCZBND-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "16.02262" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "16.01927" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][N-][H]" xsd:string

[Term]
id: CHEBI:29340
name: hydridonitrate(2-)
namespace: chebi_ontology
def: "A divalent inorganic anion resulting from the removal of two protons from ammonia." []
subset: 3_STAR
synonym: "azanediide" EXACT IUPAC_NAME [IUPAC]
synonym: "hydridonitrate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "imide" RELATED [IUPAC]
synonym: "NH(2-)" RELATED [IUPAC]
is_a: CHEBI:35106 ! nitrogen hydride
is_a: CHEBI:79388 ! divalent inorganic anion
relationship: is_conjugate_base_of CHEBI:29337 ! azanide
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HN" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/HN/h1H/q-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DZQYTNGKSBCIOE-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "15.01468" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.01200" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[N--][H]" xsd:string

[Term]
id: CHEBI:29412
name: oxonium
namespace: chebi_ontology
subset: 3_STAR
synonym: "[OH3](+)" RELATED [MolBase]
synonym: "aquahydrogen(1+)" EXACT IUPAC_NAME [IUPAC]
synonym: "H3O(+)" RELATED [IUPAC]
synonym: "Hydronium cation" RELATED [NIST_Chemistry_WebBook]
synonym: "Hydronium ion" RELATED [ChemIDplus]
synonym: "oxidanium" EXACT IUPAC_NAME [IUPAC]
synonym: "oxonium" EXACT IUPAC_NAME [IUPAC]
synonym: "trihydridooxygen(1+)" EXACT IUPAC_NAME [IUPAC]
xref: CAS:13968-08-6 {source="ChemIDplus"}
xref: CAS:13968-08-6 {source="NIST Chemistry WebBook"}
xref: Gmelin:141 {source="Gmelin"}
xref: MolBase:1646
is_a: CHEBI:33693 ! oxygen hydride
is_a: CHEBI:50313 ! onium cation
relationship: is_conjugate_acid_of CHEBI:15377 ! water
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H3O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "19.02322" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "19.01784" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][O+]([H])[H]" xsd:string

[Term]
id: CHEBI:29793
name: hydridodioxygen(1+)
namespace: chebi_ontology
subset: 3_STAR
synonym: "[HO2](+)" RELATED [ChEBI]
synonym: "dioxidenium" EXACT IUPAC_NAME [IUPAC]
synonym: "HO2(+)" RELATED [IUPAC]
synonym: "HOO(+)" RELATED [ChEBI]
synonym: "hydridodioxygen(1+)" EXACT IUPAC_NAME [IUPAC]
xref: Gmelin:508 {source="Gmelin"}
is_a: CHEBI:33693 ! oxygen hydride
relationship: is_conjugate_acid_of CHEBI:15379 ! dioxygen
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O2/c1-2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MYMOFIZGZYHOMD-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "33.00674" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "32.99711" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][O+]=O" xsd:string

[Term]
id: CHEBI:29987
name: glutamate(2-)
namespace: chebi_ontology
def: "A dicarboxylic acid dianion that is the conjugate base of glutamate(1-)." []
subset: 3_STAR
synonym: "2-aminopentanedioate" EXACT IUPAC_NAME [IUPAC]
synonym: "glutamate" EXACT IUPAC_NAME [IUPAC]
synonym: "glutamate(2-)" EXACT [JCBN]
synonym: "glutamic acid dianion" RELATED [JCBN]
xref: Beilstein:4134100 {source="Beilstein"}
xref: Gmelin:327903 {source="Gmelin"}
xref: Reaxys:4134100 {source="Reaxys"}
is_a: CHEBI:28965 ! dicarboxylic acid dianion
relationship: is_conjugate_base_of CHEBI:14321 ! glutamate(1-)
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H7NO4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-L" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "145.11342" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "145.03860" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(CCC([O-])=O)C([O-])=O" xsd:string

[Term]
id: CHEBI:30089
name: acetate
namespace: chebi_ontology
alt_id: CHEBI:13704
alt_id: CHEBI:22165
alt_id: CHEBI:40480
def: "A monocarboxylic acid anion resulting from the removal of a proton from the carboxy group of acetic acid." []
subset: 3_STAR
synonym: "acetate" EXACT [UniProt]
synonym: "acetate" EXACT IUPAC_NAME [IUPAC]
synonym: "ACETATE ION" RELATED [PDBeChem]
synonym: "acetic acid, ion(1-)" RELATED [ChemIDplus]
synonym: "Azetat" RELATED [ChEBI]
synonym: "CH3-COO(-)" RELATED [IUPAC]
synonym: "Ethanoat" RELATED [ChEBI]
synonym: "ethanoate" RELATED [ChEBI]
synonym: "MeCO2 anion" RELATED [NIST_Chemistry_WebBook]
xref: Beilstein:1901470 {source="Beilstein"}
xref: CAS:71-50-1 {source="ChemIDplus"}
xref: CAS:71-50-1 {source="NIST Chemistry WebBook"}
xref: DrugBank:DB03166
xref: Gmelin:1379 {source="Gmelin"}
xref: KEGG:C00033
xref: MetaCyc:ACET
xref: PDBeChem:ACT
xref: PMID:17190852 {source="Europe PMC"}
xref: PMID:22211106 {source="Europe PMC"}
xref: PMID:22371380 {source="Europe PMC"}
xref: Reaxys:1901470 {source="Reaxys"}
xref: UM-BBD_compID:c0050 {source="UM-BBD"}
xref: Wikipedia:Acetate
is_a: CHEBI:35757 ! monocarboxylic acid anion
relationship: is_conjugate_base_of CHEBI:15366 ! acetic acid
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H4O2/c1-2(3)4/h1H3,(H,3,4)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QTBSBXVTEAMEQO-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "59.04402" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01385" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC([O-])=O" xsd:string

[Term]
id: CHEBI:30212
name: photon
namespace: chebi_ontology
alt_id: CHEBI:10581
alt_id: CHEBI:14383
def: "Particle of zero charge, zero rest mass, spin quantum number 1, energy hnu and momentum hnu/c (h is the Planck constant, nu the frequency of radiation and c the speed of light), carrier of electromagnetic force." []
subset: 3_STAR
synonym: "foton" RELATED [ChEBI]
synonym: "gamma" RELATED [IUPAC]
synonym: "hnu" RELATED [IUPAC]
synonym: "hnu" RELATED [UniProt]
synonym: "Lichtquant" RELATED [ChEBI]
synonym: "Light" RELATED [KEGG_COMPOUND]
synonym: "light quantum" RELATED [ChEBI]
synonym: "photon" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00205
is_a: CHEBI:36341 ! boson
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "0.0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "0.0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*" xsd:string

[Term]
id: CHEBI:30412
name: monoatomic dication
namespace: chebi_ontology
alt_id: CHEBI:23856
alt_id: CHEBI:4665
subset: 3_STAR
synonym: "Divalent cation" RELATED [KEGG_COMPOUND]
synonym: "divalent inorganic cations" RELATED [ChEBI]
synonym: "monoatomic dications" RELATED [ChEBI]
xref: KEGG:C00572
is_a: CHEBI:23906 ! monoatomic cation
property_value: http://purl.obolibrary.org/obo/chebi/charge "+2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "0.00000" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*++]" xsd:string

[Term]
id: CHEBI:30566
name: gamma-aminobutyrate
namespace: chebi_ontology
alt_id: CHEBI:11961
alt_id: CHEBI:20317
def: "An gamma-amino acid anion resulting from the deprotonation of the carboxy group of gamma-aminobutyric acid." []
subset: 3_STAR
synonym: "4-Amino-butyrat" RELATED [ChEBI]
synonym: "4-aminobutanoate" EXACT IUPAC_NAME [IUPAC]
synonym: "4-aminobutanoic acid ion (1-)" RELATED [ChEBI]
synonym: "4-Aminobutylate" RELATED [KEGG_COMPOUND]
synonym: "4-aminobutyrate" RELATED [ChEBI]
synonym: "gamma-aminobutanoate" RELATED [ChEBI]
synonym: "gamma-aminobutyrate anion" RELATED [ChEBI]
xref: Beilstein:3536873 {source="Beilstein"}
xref: Gmelin:559138 {source="Gmelin"}
xref: KEGG:C00334
xref: PMID:12509893 {source="Europe PMC"}
xref: Reaxys:3536873 {source="Reaxys"}
is_a: CHEBI:71666 ! gamma-amino acid anion
relationship: has_functional_parent CHEBI:17968 ! butyrate
relationship: is_conjugate_base_of CHEBI:16865 ! gamma-aminobutyric acid
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H8NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "102.11186" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "102.05605" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCCC([O-])=O" xsd:string

[Term]
id: CHEBI:30751
name: formic acid
namespace: chebi_ontology
alt_id: CHEBI:24082
alt_id: CHEBI:42460
alt_id: CHEBI:5145
def: "The simplest carboxylic acid, containing a single carbon. Occurs naturally in various sources including the venom of bee and ant stings, and is a useful organic synthetic reagent. Principally used as a preservative and antibacterial agent in livestock feed. Induces severe metabolic acidosis and ocular injury in human subjects." []
subset: 3_STAR
synonym: "Acide formique" RELATED [ChemIDplus]
synonym: "Ameisensaeure" RELATED [ChemIDplus]
synonym: "aminic acid" RELATED [ChemIDplus]
synonym: "bilorin" RELATED [ChemIDplus]
synonym: "FORMIC ACID" EXACT [PDBeChem]
synonym: "Formic acid" EXACT [KEGG_COMPOUND]
synonym: "formic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "formylic acid" RELATED [ChemIDplus]
synonym: "H-COOH" RELATED [IUPAC]
synonym: "HCO2H" RELATED [ChEBI]
synonym: "HCOOH" RELATED [NIST_Chemistry_WebBook]
synonym: "hydrogen carboxylic acid" RELATED [ChemIDplus]
synonym: "Methanoic acid" RELATED [KEGG_COMPOUND]
synonym: "methoic acid" RELATED [ChEBI]
xref: Beilstein:1209246 {source="Beilstein"}
xref: BPDB:1749
xref: CAS:64-18-6 {source="NIST Chemistry WebBook"}
xref: CAS:64-18-6 {source="ChemIDplus"}
xref: CAS:64-18-6 {source="KEGG COMPOUND"}
xref: DrugBank:DB01942
xref: Gmelin:1008 {source="Gmelin"}
xref: HMDB:HMDB0000142
xref: KEGG:C00058
xref: KNApSAcK:C00001182
xref: LIPID_MAPS_instance:LMFA01010040 {source="LIPID MAPS"}
xref: MetaCyc:FORMATE
xref: Patent:CN101481304
xref: PDBeChem:FMT
xref: PMID:12591956 {source="Europe PMC"}
xref: PMID:14637377 {source="Europe PMC"}
xref: PMID:15811469 {source="Europe PMC"}
xref: PMID:16120414 {source="Europe PMC"}
xref: PMID:16185830 {source="Europe PMC"}
xref: PMID:16222862 {source="Europe PMC"}
xref: PMID:16230297 {source="Europe PMC"}
xref: PMID:16445901 {source="Europe PMC"}
xref: PMID:16465784 {source="Europe PMC"}
xref: PMID:18034701 {source="Europe PMC"}
xref: PMID:18397576 {source="Europe PMC"}
xref: PMID:22080171 {source="Europe PMC"}
xref: PMID:22280475 {source="Europe PMC"}
xref: PMID:22304812 {source="Europe PMC"}
xref: PMID:22385261 {source="Europe PMC"}
xref: PMID:22447125 {source="Europe PMC"}
xref: PMID:22483350 {source="Europe PMC"}
xref: PMID:22499553 {source="Europe PMC"}
xref: PMID:22540994 {source="Europe PMC"}
xref: PMID:22606986 {source="Europe PMC"}
xref: PMID:22622393 {source="Europe PMC"}
xref: PMID:3946945 {source="Europe PMC"}
xref: PMID:7361809 {source="Europe PMC"}
xref: Reaxys:1209246 {source="Reaxys"}
xref: Wikipedia:Formic_acid
is_a: CHEBI:25384 ! monocarboxylic acid
relationship: is_conjugate_acid_of CHEBI:15740 ! formate
relationship: RO:0000087 CHEBI:25212 ! has role metabolite
relationship: RO:0000087 CHEBI:33282 ! has role antibacterial agent
relationship: RO:0000087 CHEBI:48356 ! has role protic solvent
relationship: RO:0000087 CHEBI:74783 ! has role astringent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O2/c2-1-3/h1H,(H,2,3)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BDAGIHXWWSANSR-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "46.02538" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "46.00548" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C(O)=O" xsd:string

[Term]
id: CHEBI:30772
name: butyric acid
namespace: chebi_ontology
alt_id: CHEBI:113450
alt_id: CHEBI:22948
alt_id: CHEBI:3234
alt_id: CHEBI:41208
def: "A straight-chain saturated fatty acid that is butane in which one of the terminal methyl groups has been oxidised to a carboxy group." []
subset: 3_STAR
synonym: "1-butanoic acid" RELATED [HMDB]
synonym: "1-butyric acid" RELATED [HMDB]
synonym: "1-propanecarboxylic acid" RELATED [MetaCyc]
synonym: "4:0" RELATED [ChEBI]
synonym: "acide butanoique" RELATED [IUPAC]
synonym: "acide butyrique" RELATED [ChEBI]
synonym: "butanic acid" RELATED [ChEBI]
synonym: "Butanoate" RELATED [KEGG_COMPOUND]
synonym: "BUTANOIC ACID" RELATED [PDBeChem]
synonym: "Butanoic acid" RELATED [KEGG_COMPOUND]
synonym: "butanoic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "butoic acid" RELATED [ChEBI]
synonym: "Buttersaeure" RELATED [ChEBI]
synonym: "Butyric acid" EXACT [KEGG_COMPOUND]
synonym: "butyric acid" EXACT [IUPAC]
synonym: "C4:0" RELATED [ChEBI]
synonym: "CH3-[CH2]2-COOH" RELATED [IUPAC]
synonym: "ethylacetic acid" RELATED [NIST_Chemistry_WebBook]
synonym: "n-butanoic acid" RELATED [NIST_Chemistry_WebBook]
synonym: "n-butyric acid" RELATED [NIST_Chemistry_WebBook]
synonym: "propanecarboxylic acid" RELATED [HMDB]
synonym: "propylformic acid" RELATED [MetaCyc]
xref: Beilstein:906770 {source="Beilstein"}
xref: CAS:107-92-6 {source="ChemIDplus"}
xref: CAS:107-92-6 {source="NIST Chemistry WebBook"}
xref: CAS:107-92-6 {source="KEGG COMPOUND"}
xref: DrugBank:DB03568
xref: Gmelin:26242 {source="Gmelin"}
xref: HMDB:HMDB0000039
xref: KEGG:C00246
xref: KNApSAcK:C00001180
xref: LIPID_MAPS_instance:LMFA01010004 {source="LIPID MAPS"}
xref: MetaCyc:BUTYRIC_ACID
xref: PDBeChem:BUA
xref: PMID:10736622 {source="Europe PMC"}
xref: PMID:10956204 {source="ChEMBL"}
xref: PMID:11201044 {source="Europe PMC"}
xref: PMID:11208715 {source="Europe PMC"}
xref: PMID:11238216 {source="Europe PMC"}
xref: PMID:11305323 {source="Europe PMC"}
xref: PMID:12068484 {source="Europe PMC"}
xref: PMID:13678314 {source="Europe PMC"}
xref: PMID:14962641 {source="Europe PMC"}
xref: PMID:1542095 {source="ChEMBL"}
xref: PMID:15809727 {source="Europe PMC"}
xref: PMID:15810631 {source="Europe PMC"}
xref: PMID:15938880 {source="Europe PMC"}
xref: PMID:19318247 {source="Europe PMC"}
xref: PMID:19366864 {source="Europe PMC"}
xref: PMID:19703412 {source="Europe PMC"}
xref: PMID:21699495 {source="Europe PMC"}
xref: PMID:22038864 {source="Europe PMC"}
xref: PMID:22194341 {source="Europe PMC"}
xref: PMID:22322557 {source="Europe PMC"}
xref: PMID:22339023 {source="Europe PMC"}
xref: PMID:22466881 {source="Europe PMC"}
xref: Reaxys:906770 {source="Reaxys"}
xref: Wikipedia:Butyric_acid
is_a: CHEBI:140601 ! fatty acid 4:0
is_a: CHEBI:39418 ! straight-chain saturated fatty acid
relationship: is_conjugate_acid_of CHEBI:17968 ! butyrate
relationship: RO:0000087 CHEBI:131604 ! has role Mycoplasma genitalium metabolite
relationship: RO:0000087 CHEBI:84087 ! has role human urinary metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H8O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H8O2/c1-2-3-4(5)6/h2-3H2,1H3,(H,5,6)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FERIUCNNQQJTOY-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "88.10510" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "88.05243" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCCC(O)=O" xsd:string

[Term]
id: CHEBI:30879
name: alcohol
namespace: chebi_ontology
alt_id: CHEBI:13804
alt_id: CHEBI:22288
alt_id: CHEBI:2553
def: "A compound in which a hydroxy group, -OH, is attached to a saturated carbon atom." []
subset: 3_STAR
synonym: "Alcohol" EXACT [KEGG_COMPOUND]
synonym: "alcohols" EXACT IUPAC_NAME [IUPAC]
synonym: "an alcohol" RELATED [UniProt]
xref: KEGG:C00069
is_a: CHEBI:33822 ! organic hydroxy compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HOR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "17.007" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00274" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "O[*]" xsd:string

[Term]
id: CHEBI:3098
name: bile acid
namespace: chebi_ontology
def: "Any member of a group of hydroxy-5beta-cholanic acids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration." []
subset: 3_STAR
synonym: "5beta-bile acid" RELATED [ChEBI]
synonym: "5beta-bile acids" RELATED [ChEBI]
synonym: "Bile acid" EXACT [KEGG_COMPOUND]
synonym: "bile acids" RELATED [ChEBI]
synonym: "Bile salt" RELATED [KEGG_COMPOUND]
synonym: "Gallensaeure" RELATED [ChEBI]
synonym: "Gallensaeuren" RELATED [ChEBI]
xref: KEGG:C01558
is_a: CHEBI:138366 ! bile acids
is_a: CHEBI:24663 ! hydroxy-5beta-cholanic acid

[Term]
id: CHEBI:32507
name: glycinium
namespace: chebi_ontology
def: "An alpha-amino-acid cation that is the conjugate acid of glycine, arising from protonation of the amino." []
subset: 3_STAR
synonym: "carboxymethanaminium" RELATED [IUPAC]
synonym: "glycine cation" RELATED [JCBN]
synonym: "glycinium" EXACT IUPAC_NAME [IUPAC]
synonym: "H2gly(+)" RELATED [IUPAC]
synonym: "NH3(+)-CH2-COOH" RELATED [IUPAC]
xref: Gmelin:323509 {source="Gmelin"}
is_a: CHEBI:33719 ! alpha-amino-acid cation
relationship: is_conjugate_acid_of CHEBI:15428 ! glycine
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H6NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "76.07458" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "76.03930" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CC(O)=O" xsd:string

[Term]
id: CHEBI:32508
name: glycinate
namespace: chebi_ontology
def: "An alpha-amino-acid anion that is the conjugate base of glycine, arising from deprotonation of the carboxy group." []
subset: 3_STAR
synonym: "aminoacetate" RELATED [IUPAC]
synonym: "gly(-)" RELATED [IUPAC]
synonym: "glycinate" EXACT IUPAC_NAME [IUPAC]
synonym: "glycine anion" RELATED [JCBN]
synonym: "H2N-CH2-COO(-)" RELATED [IUPAC]
xref: Beilstein:1852023 {source="Beilstein"}
xref: Gmelin:81890 {source="Gmelin"}
xref: Reaxys:1852023 {source="Reaxys"}
xref: UM-BBD_compID:c0559 {source="UM-BBD"}
is_a: CHEBI:33558 ! alpha-amino-acid anion
relationship: is_conjugate_base_of CHEBI:15428 ! glycine
relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02475" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC([O-])=O" xsd:string

[Term]
id: CHEBI:32952
name: amine
namespace: chebi_ontology
alt_id: CHEBI:13814
alt_id: CHEBI:22474
alt_id: CHEBI:2641
def: "A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups." []
subset: 3_STAR
synonym: "Amin" RELATED [ChEBI]
synonym: "Amine" EXACT [KEGG_COMPOUND]
synonym: "amines" EXACT IUPAC_NAME [IUPAC]
synonym: "Substituted amine" RELATED [KEGG_COMPOUND]
xref: KEGG:C00706
is_a: CHEBI:50047 ! organic amino compound

[Term]
id: CHEBI:32988
name: amide
namespace: chebi_ontology
alt_id: CHEBI:22473
alt_id: CHEBI:2633
def: "An amide is a derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group." []
subset: 3_STAR
synonym: "Amide" EXACT [KEGG_COMPOUND]
synonym: "amides" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00241
is_a: CHEBI:51143 ! nitrogen molecular entity

[Term]
id: CHEBI:3306
name: calcitonin
namespace: chebi_ontology
def: "A 32-membered heterodetic cyclic peptide comprising the sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 cyclised by a disulfide bridge between the two Cys residues at positions 1 and 7." []
subset: 3_STAR
synonym: "Calcitonin" EXACT [KEGG_COMPOUND]
synonym: "calcitonin" RELATED INN [ChemIDplus]
synonym: "Calcitonin, salmon" RELATED [KEGG_COMPOUND]
synonym: "Cibacalcin" RELATED [KEGG_COMPOUND]
synonym: "cyclo-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2" RELATED [ChEBI]
synonym: "N-{[(4R,7S,10S,13S,16S,19S,22R)-22-amino-16-(2-amino-2-oxoethyl)-7-[(1R)-1-hydroxyethyl]-10,19-bis(hydroxymethyl)-13-isobutyl-6,9,12,15,18,21-hexaoxo-1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosan-4-yl]carbonyl}-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparaginyl-L-threonylglycyl-L-serylglycyl-L-threonyl-L-prolinamide" EXACT IUPAC_NAME [IUPAC]
synonym: "Salmon calcitonin" RELATED [ChemIDplus]
synonym: "Salmon calcitonin-(1-32)" RELATED [ChemIDplus]
synonym: "Salmotonin" RELATED [DrugBank]
synonym: "Thyrocalcitonin (salmon)" RELATED [ChemIDplus]
xref: CAS:47931-85-1 {source="ChemIDplus"}
xref: CAS:47931-85-1 {source="KEGG COMPOUND"}
xref: CAS:9007-12-9 {source="KEGG COMPOUND"}
xref: Drug_Central:2989 {source="DrugCentral"}
xref: DrugBank:DB00017
xref: KEGG:C06865
xref: KEGG:D00249
xref: Reaxys:8186880 {source="Reaxys"}
xref: Wikipedia:Calcitonin
is_a: CHEBI:15841 ! polypeptide
is_a: CHEBI:24533 ! heterodetic cyclic peptide
is_a: CHEBI:25905 ! peptide hormone
relationship: RO:0000087 CHEBI:25212 ! has role metabolite
relationship: RO:0000087 CHEBI:50646 ! has role bone density conservation agent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C145H240N44O48S2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C145H240N44O48S2/c1-65(2)45-86(175-139(232)110(70(11)12)183-136(229)99-63-239-238-62-79(148)117(210)178-96(59-191)134(227)174-92(52-104(151)202)131(224)172-90(49-69(9)10)129(222)180-98(61-193)135(228)187-114(74(16)197)142(235)181-99)118(211)158-55-106(204)162-80(25-18-20-40-146)120(213)169-89(48-68(7)8)128(221)179-97(60-192)133(226)167-83(34-37-102(149)200)122(215)165-85(36-39-109(207)208)123(216)171-88(47-67(5)6)127(220)173-91(51-77-54-156-64-161-77)130(223)164-81(26-19-21-41-147)121(214)170-87(46-66(3)4)126(219)166-84(35-38-103(150)201)125(218)186-113(73(15)196)141(234)177-94(50-76-30-32-78(199)33-31-76)143(236)189-44-24-29-101(189)137(230)168-82(27-22-42-157-145(154)155)124(217)185-112(72(14)195)140(233)176-93(53-105(152)203)132(225)184-111(71(13)194)138(231)160-56-107(205)163-95(58-190)119(212)159-57-108(206)182-115(75(17)198)144(237)188-43-23-28-100(188)116(153)209/h30-33,54,64-75,79-101,110-115,190-199H,18-29,34-53,55-63,146-148H2,1-17H3,(H2,149,200)(H2,150,201)(H2,151,202)(H2,152,203)(H2,153,209)(H,156,161)(H,158,211)(H,159,212)(H,160,231)(H,162,204)(H,163,205)(H,164,223)(H,165,215)(H,166,219)(H,167,226)(H,168,230)(H,169,213)(H,170,214)(H,171,216)(H,172,224)(H,173,220)(H,174,227)(H,175,232)(H,176,233)(H,177,234)(H,178,210)(H,179,221)(H,180,222)(H,181,235)(H,182,206)(H,183,229)(H,184,225)(H,185,217)(H,186,218)(H,187,228)(H,207,208)(H4,154,155,157)/t71-,72-,73-,74-,75-,79+,80+,81+,82+,83+,84+,85+,86+,87+,88+,89+,90+,91+,92+,93+,94+,95+,96+,97+,98+,99+,100+,101+,110+,111+,112+,113+,114+,115+/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BBBFJLBPOGFECG-VJVYQDLKSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "3431.85300" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3429.71331" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1)C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O" xsd:string

[Term]
id: CHEBI:33232
name: application
namespace: chebi_ontology
def: "Intended use of the molecular entity or part thereof by humans." []
subset: 3_STAR
is_a: BFO:0000023 ! role
is_a: CHEBI:50906 ! role

[Term]
id: CHEBI:33233
name: fundamental particle
namespace: chebi_ontology
def: "A particle not known to have substructure." []
subset: 3_STAR
synonym: "elementary particle" EXACT IUPAC_NAME [IUPAC]
synonym: "elementary particles" RELATED [ChEBI]
is_a: CHEBI:36342 ! subatomic particle

[Term]
id: CHEBI:33238
name: monoatomic entity
namespace: chebi_ontology
def: "A monoatomic entity is a molecular entity consisting of a single atom." []
subset: 3_STAR
synonym: "atomic entity" RELATED [ChEBI]
synonym: "monoatomic entities" RELATED [ChEBI]
is_a: CHEBI:33259 ! elemental molecular entity

[Term]
id: CHEBI:33241
name: oxoacid derivative
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxoacid derivatives" RELATED [ChEBI]
is_a: CHEBI:37577 ! heteroatomic molecular entity
relationship: has_functional_parent CHEBI:24833 ! oxoacid

[Term]
id: CHEBI:33242
name: inorganic hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic hydrides" RELATED [ChEBI]
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:33692 ! hydrides

[Term]
id: CHEBI:33245
name: organic fundamental parent
namespace: chebi_ontology
def: "An organic fundamental parent is a structure used as a basis for substitutive names in organic nomenclature, containing, in addition to one or more hydrogen atoms, a single atom of an element, a number of atoms (alike or different) linked together to form an unbranched chain, a monocyclic or polycyclic ring system, or a ring assembly or ring/chain system." []
subset: 3_STAR
synonym: "organic fundamental parents" RELATED [ChEBI]
synonym: "organic parent hydrides" RELATED [ChEBI]
is_a: CHEBI:37175 ! organic hydride
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33246
name: inorganic group
namespace: chebi_ontology
def: "Any substituent group which does not contain carbon." []
subset: 3_STAR
synonym: "inorganic groups" RELATED [ChEBI]
is_a: CHEBI:24433 ! group

[Term]
id: CHEBI:33247
name: organic group
namespace: chebi_ontology
def: "Any substituent group or skeleton containing carbon." []
subset: 3_STAR
synonym: "organic groups" RELATED [ChEBI]
is_a: CHEBI:24433 ! group
relationship: is_substituent_group_from CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33249
name: organyl group
namespace: chebi_ontology
def: "Any organic substituent group, regardless of functional type, having one free valence at a carbon atom." []
subset: 3_STAR
synonym: "groupe organyle" RELATED [IUPAC]
synonym: "grupo organilo" RELATED [IUPAC]
synonym: "grupos organilo" RELATED [IUPAC]
synonym: "organyl group" EXACT IUPAC_NAME [IUPAC]
synonym: "organyl groups" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:51447 ! organic univalent group

[Term]
id: CHEBI:33250
name: atom
namespace: chebi_ontology
alt_id: CHEBI:22671
alt_id: CHEBI:23907
def: "A chemical entity constituting the smallest component of an element having the chemical properties of the element." []
subset: 3_STAR
synonym: "atom" EXACT IUPAC_NAME [IUPAC]
synonym: "atome" RELATED [IUPAC]
synonym: "atomo" RELATED [IUPAC]
synonym: "atoms" RELATED [ChEBI]
synonym: "atomus" RELATED [ChEBI]
synonym: "element" RELATED [ChEBI]
synonym: "elements" RELATED [ChEBI]
is_a: CHEBI:24431 ! chemical entity
relationship: has_part CHEBI:10545 ! electron
relationship: has_part CHEBI:33252 ! atomic nucleus

[Term]
id: CHEBI:33252
name: atomic nucleus
namespace: chebi_ontology
def: "A nucleus is the positively charged central portion of an atom, excluding the orbital electrons." []
subset: 3_STAR
synonym: "Atomkern" RELATED [ChEBI]
synonym: "Kern" RELATED [ChEBI]
synonym: "noyau" RELATED [IUPAC]
synonym: "noyau atomique" RELATED [ChEBI]
synonym: "nuclei" RELATED [ChEBI]
synonym: "nucleo" RELATED [IUPAC]
synonym: "nucleo atomico" RELATED [ChEBI]
synonym: "nucleus" EXACT IUPAC_NAME [IUPAC]
synonym: "nucleus atomi" RELATED [ChEBI]
is_a: CHEBI:36347 ! nuclear particle
relationship: has_part CHEBI:33253 ! nucleon

[Term]
id: CHEBI:33253
name: nucleon
namespace: chebi_ontology
def: "Heavy nuclear particle: proton or neutron." []
subset: 3_STAR
synonym: "nucleon" EXACT [IUPAC]
synonym: "nucleon" EXACT IUPAC_NAME [IUPAC]
synonym: "nucleons" RELATED [ChEBI]
synonym: "Nukleon" RELATED [ChEBI]
synonym: "Nukleonen" RELATED [ChEBI]
is_a: CHEBI:36339 ! baryon
is_a: CHEBI:36347 ! nuclear particle

[Term]
id: CHEBI:33256
name: primary amide
namespace: chebi_ontology
def: "A derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group." []
subset: 3_STAR
synonym: "primary amide" EXACT [IUPAC]
synonym: "primary amides" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:32988 ! amide

[Term]
id: CHEBI:33259
name: elemental molecular entity
namespace: chebi_ontology
def: "A molecular entity all atoms of which have the same atomic number." []
subset: 3_STAR
synonym: "homoatomic entity" RELATED [ChEBI]
synonym: "homoatomic molecular entities" RELATED [ChEBI]
synonym: "homoatomic molecular entity" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity

[Term]
id: CHEBI:33262
name: elemental oxygen
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:25806 ! oxygen molecular entity
is_a: CHEBI:33259 ! elemental molecular entity

[Term]
id: CHEBI:33263
name: diatomic oxygen
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:33262 ! elemental oxygen
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "31.999" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string

[Term]
id: CHEBI:33273
name: polyatomic anion
namespace: chebi_ontology
def: "An anion consisting of more than one atom." []
subset: 3_STAR
synonym: "polyatomic anions" RELATED [ChEBI]
is_a: CHEBI:22563 ! anion
is_a: CHEBI:36358 ! polyatomic ion

[Term]
id: CHEBI:33280
name: molecular messenger
namespace: chebi_ontology
subset: 3_STAR
synonym: "chemical messenger" RELATED [ChEBI]
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:33281
name: antimicrobial agent
namespace: chebi_ontology
alt_id: CHEBI:22582
def: "A substance that kills or slows the growth of microorganisms, including bacteria, viruses, fungi and protozoans." []
subset: 3_STAR
synonym: "antibiotic" RELATED [ChEBI]
synonym: "antibiotics" RELATED [ChEBI]
synonym: "Antibiotika" RELATED [ChEBI]
synonym: "Antibiotikum" RELATED [ChEBI]
synonym: "antibiotique" RELATED [IUPAC]
synonym: "antimicrobial" RELATED [ChEBI]
synonym: "antimicrobial agents" RELATED [ChEBI]
synonym: "antimicrobials" RELATED [ChEBI]
synonym: "microbicide" RELATED [ChEBI]
synonym: "microbicides" RELATED [ChEBI]
xref: PMID:12964249 {source="Europe PMC"}
xref: PMID:22117953 {source="Europe PMC"}
xref: PMID:22439833 {source="Europe PMC"}
xref: PMID:22849268 {source="Europe PMC"}
xref: PMID:22849276 {source="Europe PMC"}
xref: PMID:22958833 {source="Europe PMC"}
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:33282
name: antibacterial agent
namespace: chebi_ontology
def: "A substance (or active part thereof) that kills or slows the growth of bacteria." []
subset: 3_STAR
synonym: "antibacterial agents" RELATED [ChEBI]
synonym: "antibacterials" RELATED [ChEBI]
synonym: "bactericide" RELATED [ChEBI]
synonym: "bactericides" RELATED [ChEBI]
is_a: CHEBI:33281 ! antimicrobial agent

[Term]
id: CHEBI:33284
name: nutrient
namespace: chebi_ontology
def: "A nutrient is a food component that an organism uses to survive and grow." []
subset: 3_STAR
synonym: "nutrients" RELATED [ChEBI]
is_a: CHEBI:78295 ! food component

[Term]
id: CHEBI:33285
name: heteroorganic entity
namespace: chebi_ontology
def: "A heteroorganic entity is an organic molecular entity in which carbon atoms or organic groups are bonded directly to one or more heteroatoms." []
subset: 3_STAR
synonym: "heteroorganic entities" RELATED [ChEBI]
synonym: "organoelement compounds" RELATED [ChEBI]
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33286
name: agrochemical
namespace: chebi_ontology
def: "An agrochemical is a substance that is used in agriculture or horticulture." []
subset: 3_STAR
synonym: "agrichemical" RELATED [ChEBI]
synonym: "agrichemicals" RELATED [ChEBI]
synonym: "agricultural chemicals" RELATED [ChEBI]
synonym: "agrochemicals" RELATED [ChEBI]
xref: Wikipedia:Agrochemical
is_a: CHEBI:33232 ! application

[Term]
id: CHEBI:33287
name: fertilizer
namespace: chebi_ontology
def: "A fertilizer is any substance that is added to soil or water to assist the growth of plants." []
subset: 3_STAR
synonym: "fertiliser" RELATED [ChEBI]
synonym: "fertilizers" RELATED [ChEBI]
is_a: CHEBI:33286 ! agrochemical

[Term]
id: CHEBI:33295
name: diagnostic agent
namespace: chebi_ontology
def: "A substance administered to aid diagnosis of a disease." []
subset: 3_STAR
synonym: "diagnostic aid" RELATED [ChEBI]
is_a: CHEBI:52217 ! pharmaceutical

[Term]
id: CHEBI:33296
name: alkali metal molecular entity
namespace: chebi_ontology
def: "A molecular entity containing one or more atoms of an alkali metal." []
subset: 3_STAR
synonym: "alkali metal molecular entities" RELATED [ChEBI]
is_a: CHEBI:33674 ! s-block molecular entity
relationship: has_part CHEBI:22314 ! alkali metal atom

[Term]
id: CHEBI:33299
name: alkaline earth molecular entity
namespace: chebi_ontology
def: "An alkaline earth molecular entity is a molecular entity containing one or more atoms of an alkaline earth metal." []
subset: 3_STAR
synonym: "alkaline earth compounds" RELATED [ChEBI]
synonym: "alkaline earth molecular entities" RELATED [ChEBI]
synonym: "alkaline earth molecular entity" EXACT [ChEBI]
synonym: "alkaline-earth compounds" RELATED [ChEBI]
is_a: CHEBI:33674 ! s-block molecular entity
relationship: has_part CHEBI:22313 ! alkaline earth metal atom

[Term]
id: CHEBI:33300
name: pnictogen
namespace: chebi_ontology
def: "Any p-block element atom that is in group 15 of the periodic table: nitrogen, phosphorus, arsenic, antimony and bismuth." []
subset: 3_STAR
synonym: "group 15 elements" RELATED [ChEBI]
synonym: "group V elements" RELATED [ChEBI]
synonym: "nitrogenoideos" RELATED [ChEBI]
synonym: "nitrogenoides" RELATED [ChEBI]
synonym: "pnictogene" RELATED [ChEBI]
synonym: "pnictogenes" RELATED [ChEBI]
synonym: "pnictogens" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33560 ! p-block element atom

[Term]
id: CHEBI:33302
name: pnictogen molecular entity
namespace: chebi_ontology
def: "A p-block molecular entity containing any pnictogen." []
subset: 3_STAR
synonym: "pnictogen molecular entities" RELATED [ChEBI]
synonym: "pnictogen molecular entity" EXACT [ChEBI]
is_a: CHEBI:33675 ! p-block molecular entity
relationship: has_part CHEBI:33300 ! pnictogen

[Term]
id: CHEBI:33303
name: chalcogen
namespace: chebi_ontology
def: "Any p-block element belonging to the group 16 family of the periodic table." []
subset: 3_STAR
synonym: "anfigeno" RELATED [ChEBI]
synonym: "anfigenos" RELATED [ChEBI]
synonym: "calcogeno" RELATED [ChEBI]
synonym: "calcogenos" RELATED [ChEBI]
synonym: "chalcogen" EXACT IUPAC_NAME [IUPAC]
synonym: "chalcogene" RELATED [ChEBI]
synonym: "chalcogenes" RELATED [ChEBI]
synonym: "chalcogens" EXACT IUPAC_NAME [IUPAC]
synonym: "Chalkogen" RELATED [ChEBI]
synonym: "Chalkogene" RELATED [ChEBI]
synonym: "group 16 elements" RELATED [ChEBI]
synonym: "group VI elements" RELATED [ChEBI]
xref: PMID:17084588 {source="Europe PMC"}
is_a: CHEBI:33560 ! p-block element atom

[Term]
id: CHEBI:33304
name: chalcogen molecular entity
namespace: chebi_ontology
def: "Any p-block molecular entity containing a chalcogen." []
subset: 3_STAR
synonym: "chalcogen compounds" RELATED [ChEBI]
synonym: "chalcogen molecular entities" RELATED [ChEBI]
synonym: "chalcogen molecular entity" EXACT [ChEBI]
is_a: CHEBI:33675 ! p-block molecular entity
relationship: has_part CHEBI:33303 ! chalcogen

[Term]
id: CHEBI:33306
name: carbon group element atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbon group element" RELATED [ChEBI]
synonym: "carbon group elements" RELATED [ChEBI]
synonym: "carbonoides" RELATED [ChEBI]
synonym: "cristallogene" RELATED [ChEBI]
synonym: "cristallogenes" RELATED [ChEBI]
synonym: "group 14 elements" EXACT IUPAC_NAME [IUPAC]
synonym: "group IV elements" RELATED [ChEBI]
is_a: CHEBI:33560 ! p-block element atom

[Term]
id: CHEBI:33308
name: carboxylic ester
namespace: chebi_ontology
alt_id: CHEBI:13204
alt_id: CHEBI:23028
alt_id: CHEBI:3408
def: "An ester of a carboxylic acid, R(1)C(=O)OR(2), where R(1) = H or organyl and R(2) = organyl." []
subset: 3_STAR
synonym: "a carboxylic ester" RELATED [UniProt]
synonym: "carboxylic acid esters" RELATED [ChEBI]
synonym: "Carboxylic ester" EXACT [KEGG_COMPOUND]
synonym: "carboxylic esters" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C02391
xref: Wikipedia:Ester
is_a: CHEBI:35701 ! ester
is_a: CHEBI:36586 ! carbonyl compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.010" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C(=O)O[*]" xsd:string

[Term]
id: CHEBI:33318
name: main group element atom
namespace: chebi_ontology
def: "An atom belonging to one of the main groups (found in the s- and p- blocks) of the periodic table." []
subset: 3_STAR
synonym: "Hauptgruppenelement" RELATED [ChEBI]
synonym: "Hauptgruppenelemente" RELATED [ChEBI]
synonym: "main group element" RELATED [ChEBI]
synonym: "main group elements" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33250 ! atom

[Term]
id: CHEBI:33356
name: iron group element atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "group 8 elements" EXACT IUPAC_NAME [IUPAC]
synonym: "iron group element" RELATED [ChEBI]
synonym: "iron group elements" RELATED [ChEBI]
is_a: CHEBI:33561 ! d-block element atom

[Term]
id: CHEBI:33402
name: sulfur oxoacid
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxoacids of sulfur" RELATED [ChEBI]
synonym: "sulfur oxoacids" RELATED [ChEBI]
is_a: CHEBI:26835 ! sulfur molecular entity
is_a: CHEBI:33484 ! chalcogen oxoacid

[Term]
id: CHEBI:33408
name: pnictogen oxoacid
namespace: chebi_ontology
subset: 3_STAR
synonym: "pnictogen oxoacids" RELATED [ChEBI]
is_a: CHEBI:24833 ! oxoacid
is_a: CHEBI:33302 ! pnictogen molecular entity
relationship: RO:0000087 CHEBI:138103 ! has role inorganic acid

[Term]
id: CHEBI:33424
name: sulfur oxoacid derivative
namespace: chebi_ontology
subset: 3_STAR
synonym: "sulfur oxoacid derivative" EXACT [ChEBI]
synonym: "sulfur oxoacid derivatives" RELATED [ChEBI]
is_a: CHEBI:26835 ! sulfur molecular entity
is_a: CHEBI:33241 ! oxoacid derivative

[Term]
id: CHEBI:33457
name: phosphorus oxoacid
namespace: chebi_ontology
def: "A pnictogen oxoacid which contains phosphorus and oxygen, at least one hydrogen atom bound to oxygen, and forms an ion by the loss of one or more protons." []
subset: 3_STAR
synonym: "oxoacids of phosphorus" RELATED [ChEBI]
synonym: "Oxosaeure des Phosphors" RELATED [ChEBI]
synonym: "phosphorus oxoacid" EXACT [ChEBI]
synonym: "phosphorus oxoacids" RELATED [ChEBI]
is_a: CHEBI:33408 ! pnictogen oxoacid
is_a: CHEBI:36360 ! phosphorus oxoacids and derivatives

[Term]
id: CHEBI:33459
name: pnictogen oxoanion
namespace: chebi_ontology
subset: 3_STAR
synonym: "pnictogen oxoanion" EXACT [ChEBI]
synonym: "pnictogen oxoanions" RELATED [ChEBI]
is_a: CHEBI:33302 ! pnictogen molecular entity
is_a: CHEBI:35406 ! oxoanion

[Term]
id: CHEBI:33461
name: phosphorus oxoanion
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxoanions of phosphorus" RELATED [ChEBI]
synonym: "phosphorus oxoanion" EXACT [ChEBI]
synonym: "phosphorus oxoanions" RELATED [ChEBI]
is_a: CHEBI:24834 ! inorganic anion
is_a: CHEBI:26082 ! phosphorus molecular entity
is_a: CHEBI:33459 ! pnictogen oxoanion

[Term]
id: CHEBI:33482
name: sulfur oxoanion
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxoanions of sulfur" RELATED [ChEBI]
synonym: "sulfur oxoanion" EXACT [ChEBI]
synonym: "sulfur oxoanions" RELATED [ChEBI]
is_a: CHEBI:26835 ! sulfur molecular entity
is_a: CHEBI:33485 ! chalcogen oxoanion

[Term]
id: CHEBI:33484
name: chalcogen oxoacid
namespace: chebi_ontology
subset: 3_STAR
synonym: "chalcogen oxoacid" EXACT [ChEBI]
synonym: "chalcogen oxoacids" RELATED [ChEBI]
is_a: CHEBI:24833 ! oxoacid
relationship: RO:0000087 CHEBI:138103 ! has role inorganic acid

[Term]
id: CHEBI:33485
name: chalcogen oxoanion
namespace: chebi_ontology
subset: 3_STAR
synonym: "chalcogen oxoanion" EXACT [ChEBI]
synonym: "chalcogen oxoanions" RELATED [ChEBI]
is_a: CHEBI:35406 ! oxoanion

[Term]
id: CHEBI:33497
name: transition element molecular entity
namespace: chebi_ontology
def: "A molecular entity containing one or more atoms of a transition element." []
subset: 3_STAR
synonym: "transition element molecular entities" RELATED [ChEBI]
synonym: "transition metal molecular entity" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity
relationship: has_part CHEBI:27081 ! transition element atom

[Term]
id: CHEBI:33504
name: alkali metal cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "alkali metal cations" RELATED [ChEBI]
is_a: CHEBI:25213 ! metal cation

[Term]
id: CHEBI:33513
name: alkaline earth cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "alkaline earth cations" RELATED [ChEBI]
synonym: "alkaline earth metal cation" RELATED [ChEBI]
synonym: "alkaline-earth metal cations" RELATED [ChEBI]
is_a: CHEBI:25213 ! metal cation
is_a: CHEBI:33299 ! alkaline earth molecular entity

[Term]
id: CHEBI:33515
name: transition element cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "transition element cations" RELATED [ChEBI]
synonym: "transition metal cation" RELATED [ChEBI]
is_a: CHEBI:25213 ! metal cation

[Term]
id: CHEBI:33521
name: metal atom
namespace: chebi_ontology
alt_id: CHEBI:25217
alt_id: CHEBI:6788
def: "An atom of an element that exhibits typical metallic properties, being typically shiny, with high electrical and thermal conductivity." []
subset: 3_STAR
synonym: "elemental metal" RELATED [ChEBI]
synonym: "elemental metals" RELATED [ChEBI]
synonym: "metal element" RELATED [ChEBI]
synonym: "metal elements" RELATED [ChEBI]
synonym: "metals" RELATED [ChEBI]
xref: KEGG:C00050
xref: PMID:21784043 {source="Europe PMC"}
xref: Wikipedia:Metal
is_a: CHEBI:33250 ! atom

[Term]
id: CHEBI:33558
name: alpha-amino-acid anion
namespace: chebi_ontology
def: "An amino-acid anion obtained by deprotonation of any alpha-amino acid." []
subset: 3_STAR
synonym: "alpha-amino acid anions" RELATED [ChEBI]
synonym: "alpha-amino-acid anion" EXACT [ChEBI]
synonym: "alpha-amino-acid anions" RELATED [ChEBI]
is_a: CHEBI:37022 ! amino-acid anion
relationship: is_conjugate_base_of CHEBI:33704 ! alpha-amino acid

[Term]
id: CHEBI:33559
name: s-block element atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "s-block element" RELATED [ChEBI]
synonym: "s-block elements" RELATED [ChEBI]
is_a: CHEBI:33250 ! atom

[Term]
id: CHEBI:33560
name: p-block element atom
namespace: chebi_ontology
def: "Any main group element atom belonging to the p-block of the periodic table." []
subset: 3_STAR
synonym: "p-block element" RELATED [ChEBI]
synonym: "p-block elements" RELATED [ChEBI]
is_a: CHEBI:33318 ! main group element atom

[Term]
id: CHEBI:33561
name: d-block element atom
namespace: chebi_ontology
subset: 3_STAR
synonym: "d-block element" RELATED [ChEBI]
synonym: "d-block elements" RELATED [ChEBI]
is_a: CHEBI:27081 ! transition element atom

[Term]
id: CHEBI:33563
name: glycolipid
namespace: chebi_ontology
alt_id: CHEBI:24393
alt_id: CHEBI:5476
def: "Any member of class of 1,2-di-O-acylglycerols joined at oxygen 3 by a glycosidic linkage to a carbohydrate part (usually a mono-, di- or tri-saccharide). Some substances classified as bacterial glycolipids have the sugar part acylated by one or more fatty acids and the glycerol part may be absent." []
subset: 3_STAR
synonym: "Glycolipid" EXACT [KEGG_COMPOUND]
synonym: "glycolipids" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C05005
xref: Wikipedia:Glycolipids
is_a: CHEBI:35740 ! liposaccharide

[Term]
id: CHEBI:33566
name: catechols
namespace: chebi_ontology
alt_id: CHEBI:134187
alt_id: CHEBI:13628
alt_id: CHEBI:18862
def: "Any compound containing an o-diphenol component." []
subset: 3_STAR
synonym: "1,2-benzenediols" RELATED [ChEBI]
synonym: "a catechol" RELATED [UniProt]
synonym: "benzene-1,2-diols" RELATED [ChEBI]
xref: KEGG:C15571
is_a: CHEBI:33570 ! benzenediols
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H2O2R4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "106.079" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "106.00548" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC1=C(O)C(*)=C(*)C(*)=C1*" xsd:string

[Term]
id: CHEBI:33567
name: catecholamine
namespace: chebi_ontology
alt_id: CHEBI:23056
alt_id: CHEBI:3468
def: "4-(2-Aminoethyl)pyrocatechol [4-(2-aminoethyl)benzene-1,2-diol] and derivatives formed by substitution." []
subset: 3_STAR
synonym: "Catecholamine" EXACT [KEGG_COMPOUND]
synonym: "catecholamines" EXACT IUPAC_NAME [IUPAC]
synonym: "catecholamines" RELATED [ChEBI]
xref: KEGG:C02012
is_a: CHEBI:25375 ! monoamine molecular messenger
is_a: CHEBI:33566 ! catechols
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H9NO2R2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "151.163" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "151.06333" xsd:string

[Term]
id: CHEBI:33568
name: adrenaline
namespace: chebi_ontology
def: "A catecholamine in which the aminoethyl side-chain is hydroxy-substituted at C-1 and methylated on nitrogen." []
subset: 3_STAR
synonym: "(+-)-adrenaline" RELATED [IUPHAR]
synonym: "(+-)-epinephrine" RELATED [ChemIDplus]
synonym: "2-(methylamino)-1-(3,4-dihydroxyphenyl)ethanol" RELATED [ChemIDplus]
synonym: "4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC]
synonym: "dl-adrenaline" RELATED [ChemIDplus]
synonym: "epinephrine racemic" RELATED [ChemIDplus]
synonym: "racepinefrina" RELATED INN [ChemIDplus]
synonym: "racepinefrine" RELATED INN [ChemIDplus]
synonym: "racepinefrinum" RELATED INN [ChemIDplus]
xref: Beilstein:2212160 {source="ChemIDplus"}
xref: CAS:329-65-7 {source="ChemIDplus"}
xref: Drug_Central:4508 {source="DrugCentral"}
xref: Gmelin:51559 {source="Gmelin"}
xref: LINCS:LSM-4958
xref: PMID:10052027 {source="Europe PMC"}
xref: PMID:24252294 {source="Europe PMC"}
xref: PMID:24719616 {source="Europe PMC"}
xref: Reaxys:2212160 {source="Reaxys"}
is_a: CHEBI:33567 ! catecholamine
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C9H13NO3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C9H13NO3/c1-10-5-9(13)6-2-3-7(11)8(12)4-6/h2-4,9-13H,5H2,1H3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "UCTWMZQNUQWSLP-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "183.20446" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "183.08954" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CNCC(O)c1ccc(O)c(O)c1" xsd:string

[Term]
id: CHEBI:33569
name: noradrenaline
namespace: chebi_ontology
def: "A catecholamine in which C-1 of the aminoethyl side-chain is hydroxy-substituted." []
subset: 3_STAR
synonym: "4-(2-amino-1-hydroxyethyl)benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC]
synonym: "noradrenalina" RELATED [ChEBI]
synonym: "norepinephrine" RELATED [ChEBI]
xref: Beilstein:2210994 {source="Beilstein"}
xref: CAS:138-65-8 {source="NIST Chemistry WebBook"}
xref: CAS:138-65-8 {source="ChemIDplus"}
xref: Gmelin:863925 {source="Gmelin"}
xref: LINCS:LSM-5181
is_a: CHEBI:33567 ! catecholamine
relationship: is_conjugate_base_of CHEBI:166902 ! noradrenaline(1+)
relationship: RO:0000087 CHEBI:76967 ! has role human xenobiotic metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "169.17788" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "169.07389" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC(O)c1ccc(O)c(O)c1" xsd:string

[Term]
id: CHEBI:33570
name: benzenediols
namespace: chebi_ontology
alt_id: CHEBI:22705
alt_id: CHEBI:22711
subset: 3_STAR
is_a: CHEBI:33853 ! phenols

[Term]
id: CHEBI:33575
name: carboxylic acid
namespace: chebi_ontology
alt_id: CHEBI:13428
alt_id: CHEBI:13627
alt_id: CHEBI:23027
def: "A carbon oxoacid acid carrying at least one -C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid." []
subset: 3_STAR
synonym: "acide carboxylique" RELATED [IUPAC]
synonym: "acides carboxyliques" RELATED [IUPAC]
synonym: "acido carboxilico" RELATED [IUPAC]
synonym: "acidos carboxilicos" RELATED [IUPAC]
synonym: "Carbonsaeure" RELATED [ChEBI]
synonym: "Carbonsaeuren" RELATED [ChEBI]
synonym: "carboxylic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "carboxylic acids" EXACT IUPAC_NAME [IUPAC]
synonym: "Karbonsaeure" RELATED [ChEBI]
synonym: "RC(=O)OH" RELATED [IUPAC]
xref: PMID:17147560 {source="Europe PMC"}
xref: PMID:18433345 {source="Europe PMC"}
xref: Wikipedia:Carboxylic_acid
is_a: CHEBI:35605 ! carbon oxoacid
is_a: CHEBI:36586 ! carbonyl compound
is_a: CHEBI:64709 ! organic acid
relationship: has_part CHEBI:46883 ! carboxy group
relationship: is_conjugate_acid_of CHEBI:29067 ! carboxylic acid anion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01740" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string

[Term]
id: CHEBI:33579
name: main group molecular entity
namespace: chebi_ontology
def: "A molecular entity containing one or more atoms from any of groups 1, 2, 13, 14, 15, 16, 17, and 18 of the periodic table." []
subset: 3_STAR
synonym: "main group compounds" RELATED [ChEBI]
synonym: "main group molecular entities" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity
relationship: has_part CHEBI:33318 ! main group element atom

[Term]
id: CHEBI:33582
name: carbon group molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbon group molecular entities" RELATED [ChEBI]
synonym: "carbon group molecular entity" EXACT [ChEBI]
is_a: CHEBI:33675 ! p-block molecular entity
relationship: has_part CHEBI:33306 ! carbon group element atom

[Term]
id: CHEBI:33595
name: cyclic compound
namespace: chebi_ontology
def: "Any molecule that consists of a series of atoms joined together to form a ring." []
subset: 3_STAR
synonym: "cyclic compounds" RELATED [ChEBI]
xref: Wikipedia:Cyclic_compound
is_a: CHEBI:25367 ! molecule

[Term]
id: CHEBI:33608
name: hydrogen molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "hydrogen compounds" RELATED [ChEBI]
synonym: "hydrogen molecular entities" RELATED [ChEBI]
is_a: CHEBI:33674 ! s-block molecular entity
relationship: has_part CHEBI:49637 ! hydrogen atom

[Term]
id: CHEBI:33635
name: polycyclic compound
namespace: chebi_ontology
subset: 3_STAR
synonym: "polycyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33595 ! cyclic compound

[Term]
id: CHEBI:33636
name: bicyclic compound
namespace: chebi_ontology
def: "A molecule that features two fused rings." []
subset: 3_STAR
synonym: "bicyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33595 ! cyclic compound

[Term]
id: CHEBI:33653
name: aliphatic compound
namespace: chebi_ontology
def: "Any acyclic or cyclic, saturated or unsaturated carbon compound, excluding aromatic compounds." []
subset: 3_STAR
synonym: "aliphatic compounds" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33655
name: aromatic compound
namespace: chebi_ontology
def: "A cyclically conjugated molecular entity with a stability (due to delocalization) significantly greater than that of a hypothetical localized structure (e.g. Kekule structure) is said to possess aromatic character." []
subset: 3_STAR
synonym: "aromatic compounds" EXACT IUPAC_NAME [IUPAC]
synonym: "aromatic molecular entity" EXACT IUPAC_NAME [IUPAC]
synonym: "aromatics" RELATED [ChEBI]
synonym: "aromatische Verbindungen" RELATED [ChEBI]
is_a: CHEBI:33595 ! cyclic compound

[Term]
id: CHEBI:33659
name: organic aromatic compound
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic aromatic compounds" RELATED [ChEBI]
is_a: CHEBI:33655 ! aromatic compound
is_a: CHEBI:33832 ! organic cyclic compound

[Term]
id: CHEBI:33671
name: heteropolycyclic compound
namespace: chebi_ontology
def: "A polycyclic compound in which at least one of the rings contains at least one non-carbon atom." []
subset: 3_STAR
synonym: "heteropolycyclic compounds" EXACT IUPAC_NAME [IUPAC]
synonym: "polyheterocyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33635 ! polycyclic compound
is_a: CHEBI:5686 ! heterocyclic compound

[Term]
id: CHEBI:33672
name: heterobicyclic compound
namespace: chebi_ontology
def: "A bicyclic compound in which at least one of the rings contains at least one skeletal heteroatom." []
subset: 3_STAR
synonym: "heterobicyclic compounds" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33636 ! bicyclic compound
is_a: CHEBI:5686 ! heterocyclic compound

[Term]
id: CHEBI:33674
name: s-block molecular entity
namespace: chebi_ontology
def: "An s-block molecular entity is a molecular entity containing one or more atoms of an s-block element." []
subset: 3_STAR
synonym: "s-block compounds" RELATED [ChEBI]
synonym: "s-block molecular entities" RELATED [ChEBI]
synonym: "s-block molecular entity" EXACT [ChEBI]
is_a: CHEBI:33579 ! main group molecular entity
relationship: has_part CHEBI:33559 ! s-block element atom

[Term]
id: CHEBI:33675
name: p-block molecular entity
namespace: chebi_ontology
def: "A main group molecular entity that contains one or more atoms of a p-block element." []
subset: 3_STAR
synonym: "p-block compounds" RELATED [ChEBI]
synonym: "p-block molecular entities" RELATED [ChEBI]
synonym: "p-block molecular entitiy" RELATED [ChEBI]
is_a: CHEBI:33579 ! main group molecular entity
relationship: has_part CHEBI:33560 ! p-block element atom

[Term]
id: CHEBI:33676
name: d-block molecular entity
namespace: chebi_ontology
def: "A d-block molecular entity is a molecular entity containing one or more atoms of a d-block element." []
subset: 3_STAR
synonym: "d-block compounds" RELATED [ChEBI]
synonym: "d-block molecular entities" RELATED [ChEBI]
synonym: "d-block molecular entity" EXACT [ChEBI]
is_a: CHEBI:33497 ! transition element molecular entity
relationship: has_part CHEBI:33561 ! d-block element atom

[Term]
id: CHEBI:33692
name: hydrides
namespace: chebi_ontology
def: "Hydrides are chemical compounds of hydrogen with other chemical elements." []
subset: 3_STAR
is_a: CHEBI:33608 ! hydrogen molecular entity
is_a: CHEBI:37577 ! heteroatomic molecular entity

[Term]
id: CHEBI:33693
name: oxygen hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "hydrides of oxygen" RELATED [ChEBI]
synonym: "oxygen hydride" EXACT [ChEBI]
synonym: "oxygen hydrides" RELATED [ChEBI]
is_a: CHEBI:36902 ! chalcogen hydride

[Term]
id: CHEBI:33694
name: biomacromolecule
namespace: chebi_ontology
def: "A macromolecule formed by a living organism." []
subset: 3_STAR
synonym: "biomacromolecules" RELATED [ChEBI]
synonym: "biopolymer" EXACT IUPAC_NAME [IUPAC]
synonym: "Biopolymere" RELATED [ChEBI]
synonym: "biopolymers" RELATED [ChEBI]
is_a: CHEBI:33839 ! macromolecule
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33695
name: information biomacromolecule
namespace: chebi_ontology
subset: 3_STAR
synonym: "genetically encoded biomacromolecules" RELATED [ChEBI]
synonym: "genetically encoded biopolymers" RELATED [ChEBI]
synonym: "information biomacromolecules" RELATED [ChEBI]
synonym: "information biopolymers" RELATED [ChEBI]
synonym: "information macromolecule" RELATED [ChEBI]
synonym: "information macromolecules" RELATED [ChEBI]
is_a: CHEBI:33694 ! biomacromolecule

[Term]
id: CHEBI:33696
name: nucleic acid
namespace: chebi_ontology
def: "A macromolecule made up of nucleotide units and hydrolysable into certain pyrimidine or purine bases (usually adenine, cytosine, guanine, thymine, uracil), D-ribose or 2-deoxy-D-ribose and phosphoric acid." []
subset: 3_STAR
synonym: "acide nucleique" RELATED [ChEBI]
synonym: "acides nucleiques" RELATED [ChEBI]
synonym: "acido nucleico" RELATED [ChEBI]
synonym: "acidos nucleicos" RELATED [ChEBI]
synonym: "NA" RELATED [ChEBI]
synonym: "nucleic acids" EXACT IUPAC_NAME [IUPAC]
synonym: "Nukleinsaeure" RELATED [ChEBI]
synonym: "Nukleinsaeuren" RELATED [ChEBI]
is_a: CHEBI:15986 ! polynucleotide
relationship: has_part CHEBI:33791 ! canonical nucleoside residue
relationship: has_part CHEBI:50297 ! canonical nucleotide residue

[Term]
id: CHEBI:33697
name: ribonucleic acid
namespace: chebi_ontology
def: "High molecular weight, linear polymers, composed of nucleotides containing ribose and linked by phosphodiester bonds; RNA is central to the synthesis of proteins." []
subset: 3_STAR
synonym: "pentosenucleic acids" RELATED [ChemIDplus]
synonym: "ribonucleic acid" EXACT [IUPAC]
synonym: "ribonucleic acids" EXACT IUPAC_NAME [IUPAC]
synonym: "ribonucleic acids" RELATED [ChEBI]
synonym: "Ribonukleinsaeure" RELATED [ChEBI]
synonym: "ribose nucleic acid" RELATED [ChEBI]
synonym: "RNA" RELATED [IUPAC]
synonym: "RNS" RELATED [ChEBI]
synonym: "yeast nucleic acid" RELATED [ChEBI]
xref: CAS:63231-63-0 {source="ChemIDplus"}
is_a: CHEBI:33696 ! nucleic acid
relationship: has_part CHEBI:33792 ! canonical ribonucleoside residue
relationship: has_part CHEBI:50299 ! canonical ribonucleotide residue

[Term]
id: CHEBI:33700
name: proteinogenic amino-acid residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical amino-acid residue" RELATED [ChEBI]
synonym: "canonical amino-acid residues" RELATED [ChEBI]
synonym: "common amino acid residues" RELATED [ChEBI]
synonym: "proteinogenic amino-acid residues" RELATED [ChEBI]
synonym: "standard amino acid residues" RELATED [ChEBI]
synonym: "standard amino-acid residues" RELATED [ChEBI]
is_a: CHEBI:33710 ! alpha-amino-acid residue

[Term]
id: CHEBI:33702
name: polyatomic cation
namespace: chebi_ontology
def: "A cation consisting of more than one atom." []
subset: 3_STAR
synonym: "polyatomic cations" RELATED [ChEBI]
is_a: CHEBI:36358 ! polyatomic ion
is_a: CHEBI:36916 ! cation

[Term]
id: CHEBI:33703
name: amino-acid cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "amino acid cation" RELATED [ChEBI]
synonym: "amino-acid cation" EXACT [ChEBI]
synonym: "amino-acid cations" RELATED [ChEBI]
is_a: CHEBI:33702 ! polyatomic cation

[Term]
id: CHEBI:33704
name: alpha-amino acid
namespace: chebi_ontology
alt_id: CHEBI:10208
alt_id: CHEBI:13779
alt_id: CHEBI:22442
alt_id: CHEBI:2642
def: "An amino acid in which the amino group is located on the carbon atom at the position alpha to the carboxy group." []
subset: 3_STAR
synonym: "alpha-amino acid" EXACT IUPAC_NAME [IUPAC]
synonym: "alpha-amino acids" RELATED [JCBN]
synonym: "alpha-amino acids" RELATED [ChEBI]
synonym: "alpha-amino carboxylic acids" RELATED [IUPAC]
synonym: "Amino acid" RELATED [KEGG_COMPOUND]
synonym: "Amino acids" RELATED [KEGG_COMPOUND]
xref: KEGG:C00045
xref: KEGG:C05167
is_a: CHEBI:33709 ! amino acid
relationship: is_conjugate_acid_of CHEBI:33558 ! alpha-amino-acid anion
relationship: is_tautomer_of CHEBI:78608 ! alpha-amino acid zwitterion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC([*])C(O)=O" xsd:string

[Term]
id: CHEBI:33707
name: gamma-amino acid
namespace: chebi_ontology
def: "A non-proteinogenic amino-acid in which the amino group is located on the carbon atom at the position gamma to the carboxy group." []
subset: 3_STAR
synonym: "gamma-amino acid" EXACT [ChEBI]
synonym: "gamma-amino acids" RELATED [ChEBI]
is_a: CHEBI:83820 ! non-proteinogenic amino acid
relationship: is_conjugate_acid_of CHEBI:71666 ! gamma-amino acid anion

[Term]
id: CHEBI:33708
name: amino-acid residue
namespace: chebi_ontology
def: "When two or more amino acids combine to form a peptide, the elements of water are removed, and what remains of each amino acid is called an amino-acid residue." []
subset: 3_STAR
synonym: "amino acid residue" RELATED [ChEBI]
synonym: "amino-acid residue" EXACT IUPAC_NAME [IUPAC]
synonym: "amino-acid residues" RELATED [JCBN]
is_a: CHEBI:33247 ! organic group
relationship: is_substituent_group_from CHEBI:33709 ! amino acid

[Term]
id: CHEBI:33709
name: amino acid
namespace: chebi_ontology
alt_id: CHEBI:13815
alt_id: CHEBI:22477
def: "A carboxylic acid containing one or more amino groups." []
subset: 3_STAR
synonym: "amino acids" RELATED [ChEBI]
synonym: "Aminocarbonsaeure" RELATED [ChEBI]
synonym: "Aminokarbonsaeure" RELATED [ChEBI]
synonym: "Aminosaeure" RELATED [ChEBI]
xref: Wikipedia:Amino_acid
is_a: CHEBI:33575 ! carboxylic acid
is_a: CHEBI:50047 ! organic amino compound
relationship: is_conjugate_acid_of CHEBI:37022 ! amino-acid anion

[Term]
id: CHEBI:33710
name: alpha-amino-acid residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "alpha-amino-acid residues" RELATED [ChEBI]
is_a: CHEBI:33708 ! amino-acid residue
relationship: is_substituent_group_from CHEBI:33704 ! alpha-amino acid

[Term]
id: CHEBI:33719
name: alpha-amino-acid cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "alpha-amino acid cations" RELATED [ChEBI]
synonym: "alpha-amino-acid cation" EXACT [ChEBI]
synonym: "alpha-amino-acid cations" RELATED [ChEBI]
is_a: CHEBI:33703 ! amino-acid cation

[Term]
id: CHEBI:33720
name: carbohydrate acid
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbohydrate acid" EXACT [ChEBI]
synonym: "carbohydrate acids" RELATED [ChEBI]
is_a: CHEBI:16646 ! carbohydrate
is_a: CHEBI:33575 ! carboxylic acid
relationship: is_conjugate_acid_of CHEBI:33721 ! carbohydrate acid anion

[Term]
id: CHEBI:33721
name: carbohydrate acid anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbohydrate acid anion" EXACT [ChEBI]
synonym: "carbohydrate acid anions" RELATED [ChEBI]
is_a: CHEBI:29067 ! carboxylic acid anion
relationship: is_conjugate_base_of CHEBI:33720 ! carbohydrate acid

[Term]
id: CHEBI:33744
name: iron group molecular entity
namespace: chebi_ontology
subset: 3_STAR
synonym: "iron group molecular entities" RELATED [ChEBI]
synonym: "iron group molecular entity" EXACT [ChEBI]
is_a: CHEBI:33676 ! d-block molecular entity
relationship: has_part CHEBI:33356 ! iron group element atom

[Term]
id: CHEBI:33791
name: canonical nucleoside residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical nucleoside residues" RELATED [ChEBI]
synonym: "common nucleoside residues" RELATED [CBN]
synonym: "nucleoside residue" RELATED [CBN]
synonym: "standard nucleoside residues" RELATED [ChEBI]
is_a: CHEBI:50320 ! nucleoside residue

[Term]
id: CHEBI:33792
name: canonical ribonucleoside residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical ribonucleoside residues" RELATED [ChEBI]
synonym: "common ribonucleoside residue" RELATED [CBN]
synonym: "common ribonucleoside residues" RELATED [CBN]
synonym: "N" RELATED [CBN]
synonym: "Nuc" RELATED [CBN]
synonym: "standard ribonucleoside residues" RELATED [ChEBI]
is_a: CHEBI:33791 ! canonical nucleoside residue

[Term]
id: CHEBI:33793
name: canonical deoxyribonucleoside residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical deoxyribonucleoside residues" RELATED [ChEBI]
synonym: "common 2'-deoxyribonucleoside residue" RELATED [CBN]
synonym: "common 2'-deoxyribonucleoside residues" RELATED [CBN]
synonym: "dN" RELATED [CBN]
synonym: "dNuc" RELATED [CBN]
synonym: "standard deoxyribonucleoside residues" RELATED [ChEBI]
is_a: CHEBI:33791 ! canonical nucleoside residue

[Term]
id: CHEBI:33822
name: organic hydroxy compound
namespace: chebi_ontology
alt_id: CHEBI:64710
def: "An organic compound having at least one hydroxy group attached to a carbon atom." []
subset: 3_STAR
synonym: "hydroxy compounds" EXACT IUPAC_NAME [IUPAC]
synonym: "organic alcohol" RELATED [ChEBI]
synonym: "organic hydroxy compounds" RELATED [ChEBI]
is_a: CHEBI:24651 ! hydroxides
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:33832
name: organic cyclic compound
namespace: chebi_ontology
def: "Any organic molecule that consists of atoms connected in the form of a ring." []
subset: 3_STAR
synonym: "organic cyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33595 ! cyclic compound
is_a: CHEBI:72695 ! organic molecule

[Term]
id: CHEBI:33833
name: heteroarene
namespace: chebi_ontology
def: "A heterocyclic compound formally derived from an arene by replacement of one or more methine (-C=) and/or vinylene (-CH=CH-) groups by trivalent or divalent heteroatoms, respectively, in such a way as to maintain the continuous pi-electron system characteristic of aromatic systems and a number of out-of-plane pi-electrons corresponding to the Hueckel rule (4n+2)." []
subset: 3_STAR
synonym: "hetarenes" RELATED [IUPAC]
synonym: "heteroarenes" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:24532 ! organic heterocyclic compound
is_a: CHEBI:33659 ! organic aromatic compound

[Term]
id: CHEBI:33837
name: conjugated protein
namespace: chebi_ontology
def: "Conjugated protein is a protein that contains a non-peptide component, usually in stoichiometric proportion." []
subset: 3_STAR
synonym: "complex protein" RELATED [COMe]
synonym: "conjugated proteins" EXACT IUPAC_NAME [IUPAC]
xref: COMe:PRX000001
is_a: CHEBI:36080 ! protein
is_a: PR:000000001 ! protein

[Term]
id: CHEBI:33839
name: macromolecule
namespace: chebi_ontology
def: "A macromolecule is a molecule of high relative molecular mass, the structure of which essentially comprises the multiple repetition of units derived, actually or conceptually, from molecules of low relative molecular mass." []
subset: 3_STAR
synonym: "macromolecule" EXACT IUPAC_NAME [IUPAC]
synonym: "macromolecules" RELATED [ChEBI]
synonym: "polymer" RELATED [ChEBI]
synonym: "polymer molecule" RELATED [IUPAC]
synonym: "polymers" RELATED [ChEBI]
xref: Wikipedia:Macromolecule
is_a: CHEBI:36357 ! polyatomic entity

[Term]
id: CHEBI:33853
name: phenols
namespace: chebi_ontology
alt_id: CHEBI:13664
alt_id: CHEBI:13825
alt_id: CHEBI:25969
alt_id: CHEBI:2857
def: "Organic aromatic compounds having one or more hydroxy groups attached to a benzene or other arene ring." []
subset: 3_STAR
synonym: "a phenol" RELATED [UniProt]
synonym: "arenols" RELATED [IUPAC]
synonym: "Aryl alcohol" RELATED [KEGG_COMPOUND]
synonym: "phenols" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C15584
xref: MetaCyc:Phenols
xref: Wikipedia:Phenols
is_a: CHEBI:33659 ! organic aromatic compound
is_a: CHEBI:33822 ! organic hydroxy compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C6HOR5" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "89.072" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "89.00274" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1(=C(C(=C(C(=C1*)*)*)*)*)O" xsd:string

[Term]
id: CHEBI:33893
name: reagent
namespace: chebi_ontology
def: "A substance used in a chemical reaction to detect, measure, examine, or produce other substances." []
subset: 3_STAR
synonym: "reactif" RELATED [IUPAC]
synonym: "reactivo" RELATED [IUPAC]
synonym: "reagent" EXACT IUPAC_NAME [IUPAC]
synonym: "reagents" RELATED [ChEBI]
is_a: CHEBI:33232 ! application

[Term]
id: CHEBI:33917
name: aldohexose
namespace: chebi_ontology
alt_id: CHEBI:2558
def: "A hexose with a (potential) aldehyde group at one end." []
subset: 3_STAR
synonym: "aldohexose" EXACT [ChEBI]
synonym: "aldohexoses" RELATED [ChEBI]
is_a: CHEBI:15693 ! aldose
is_a: CHEBI:18133 ! hexose

[Term]
id: CHEBI:33937
name: macronutrient
namespace: chebi_ontology
def: "Any nutrient required in large quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Macronutrients are usually chemical elements (carbon, hydrogen, nitrogen, oxygen, phosphorus and sulfur) that humans consume in the largest quantities. Calcium, sodium, magnesium and potassium are sometimes included as macronutrients because they are required in relatively large quantities compared with other vitamins and minerals." []
subset: 3_STAR
synonym: "macronutrients" RELATED [ChEBI]
is_a: CHEBI:33284 ! nutrient

[Term]
id: CHEBI:350546
name: serotonin(1+)
namespace: chebi_ontology
def: "An ammonium ion that is the conjugate acid of serotonin; major species at pH 7.3." []
subset: 3_STAR
synonym: "2-(5-hydroxy-1H-indol-3-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC]
synonym: "serotonin" RELATED [UniProt]
synonym: "serotonin cation" RELATED [ChEBI]
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:28790 ! serotonin
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H13N2O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2O/c11-4-3-7-6-12-10-2-1-8(13)5-9(7)10/h1-2,5-6,12-13H,3-4,11H2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZAYGJVTTNCVMB-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "177.22250" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "177.10224" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]c2ccc(O)cc12" xsd:string

[Term]
id: CHEBI:35106
name: nitrogen hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "nitrogen hydrides" RELATED [ChEBI]
is_a: CHEBI:35881 ! pnictogen hydride
is_a: CHEBI:51143 ! nitrogen molecular entity

[Term]
id: CHEBI:35107
name: azane
namespace: chebi_ontology
def: "Saturated acyclic nitrogen hydrides having the general formula NnHn+2." []
subset: 3_STAR
synonym: "azanes" RELATED [ChEBI]
is_a: CHEBI:35106 ! nitrogen hydride

[Term]
id: CHEBI:35155
name: elemental calcium
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:22985 ! calcium molecular entity

[Term]
id: CHEBI:35186
name: terpene
namespace: chebi_ontology
def: "A hydrocarbon of biological origin having carbon skeleton formally derived from isoprene [CH2=C(CH3)CH=CH2]." []
subset: 3_STAR
synonym: "Terpen" RELATED [ChEBI]
synonym: "terpene" EXACT [IUPAC]
synonym: "terpenes" EXACT IUPAC_NAME [IUPAC]
synonym: "terpenes" RELATED [IUPAC]
synonym: "terpeno" RELATED [IUPAC]
synonym: "terpenos" RELATED [IUPAC]
is_a: CHEBI:24632 ! hydrocarbon
is_a: CHEBI:24913 ! isoprenoid

[Term]
id: CHEBI:35189
name: sesquiterpene
namespace: chebi_ontology
def: "A C15 terpene." []
subset: 3_STAR
synonym: "Sesquiterpen" RELATED [ChEBI]
synonym: "sesquiterpenes" EXACT IUPAC_NAME [IUPAC]
synonym: "sesquiterpenes" RELATED [IUPAC]
synonym: "sesquiterpeno" RELATED [IUPAC]
synonym: "sesquiterpenos" RELATED [IUPAC]
is_a: CHEBI:35186 ! terpene

[Term]
id: CHEBI:35191
name: triterpene
namespace: chebi_ontology
def: "A C30 terpene." []
subset: 3_STAR
synonym: "Triterpen" RELATED [ChEBI]
synonym: "triterpenes" EXACT IUPAC_NAME [IUPAC]
synonym: "triterpenes" RELATED [IUPAC]
synonym: "triterpeno" RELATED [IUPAC]
synonym: "triterpenos" RELATED [IUPAC]
is_a: CHEBI:35186 ! terpene

[Term]
id: CHEBI:35196
name: nitrogen oxide
namespace: chebi_ontology
subset: 3_STAR
synonym: "nitrogen oxides" RELATED [ChEBI]
synonym: "oxides of nitrogen" RELATED [ChEBI]
is_a: CHEBI:24836 ! inorganic oxide
is_a: CHEBI:51143 ! nitrogen molecular entity

[Term]
id: CHEBI:35222
name: inhibitor
namespace: chebi_ontology
def: "A substance that diminishes the rate of a chemical reaction." []
subset: 3_STAR
synonym: "inhibidor" RELATED [ChEBI]
synonym: "inhibiteur" RELATED [ChEBI]
synonym: "inhibitor" EXACT IUPAC_NAME [IUPAC]
synonym: "inhibitors" RELATED [ChEBI]
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:35223
name: catalyst
namespace: chebi_ontology
def: "A substance that increases the rate of a reaction without modifying the overall standard Gibbs energy change in the reaction." []
subset: 3_STAR
synonym: "catalizador" RELATED [ChEBI]
synonym: "catalyseur" RELATED [ChEBI]
synonym: "catalyst" EXACT IUPAC_NAME [IUPAC]
synonym: "Katalysator" RELATED [ChEBI]
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:35238
name: amino acid zwitterion
namespace: chebi_ontology
def: "The zwitterionic form of an amino acid having a negatively charged carboxyl group and a positively charged amino group." []
subset: 3_STAR
synonym: "amino acid zwitterion" EXACT [ChEBI]
is_a: CHEBI:27369 ! zwitterion

[Term]
id: CHEBI:35267
name: quaternary ammonium ion
namespace: chebi_ontology
alt_id: CHEBI:26470
alt_id: CHEBI:8693
def: "A derivative of ammonium, NH4(+), in which all four of the hydrogens bonded to nitrogen have been replaced with univalent (usually organyl) groups." []
subset: 3_STAR
synonym: "Quaternary amine" RELATED [KEGG_COMPOUND]
synonym: "quaternary ammonium" RELATED [UniProt]
synonym: "quaternary ammonium ion" EXACT IUPAC_NAME [IUPAC]
synonym: "quaternary ammonium ions" RELATED [ChEBI]
xref: KEGG:C06703
is_a: CHEBI:25697 ! organic cation
is_a: CHEBI:35274 ! ammonium ion derivative
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "NR4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "14.00670" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "14.00307" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*][N+]([*])([*])[*]" xsd:string

[Term]
id: CHEBI:35274
name: ammonium ion derivative
namespace: chebi_ontology
def: "A derivative of ammonium, NH4(+), in which one (or more) of the hydrogens bonded to the nitrogen have been replaced with univalent organyl groups. The substituting carbon of the organyl group must not itself be directly attached to a heteroatom (thereby excluding protonated amides, hemiaminals, etc)." []
subset: 3_STAR
synonym: "ammonium ion derivatives" RELATED [ChEBI]
synonym: "azanium ion derivative" RELATED [ChEBI]
synonym: "azanium ion derivatives" RELATED [ChEBI]
is_a: CHEBI:33702 ! polyatomic cation
is_a: CHEBI:51143 ! nitrogen molecular entity
relationship: has_parent_hydride CHEBI:28938 ! ammonium

[Term]
id: CHEBI:35287
name: acylcholine
namespace: chebi_ontology
alt_id: CHEBI:13245
alt_id: CHEBI:22227
alt_id: CHEBI:2463
def: "A choline ester formed from choline and a carboxylic acid." []
subset: 3_STAR
synonym: "acylcholines" RELATED [ChEBI]
synonym: "an acylcholine" RELATED [UniProt]
xref: KEGG:C01777
is_a: CHEBI:35267 ! quaternary ammonium ion
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H13NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "131.17290" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "131.09463" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[N+](C)(C)CCOC([*])=O" xsd:string

[Term]
id: CHEBI:35341
name: steroid
namespace: chebi_ontology
alt_id: CHEBI:13687
alt_id: CHEBI:26768
alt_id: CHEBI:9263
def: "Any of naturally occurring compounds and synthetic analogues, based on the cyclopenta[a]phenanthrene carbon skeleton, partially or completely hydrogenated; there are usually methyl groups at C-10 and C-13, and often an alkyl group at C-17. By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred. Natural steroids are derived biogenetically from squalene which is a triterpene." []
subset: 3_STAR
synonym: "a steroid" RELATED [UniProt]
synonym: "Steroid" EXACT [KEGG_COMPOUND]
synonym: "steroids" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00377
xref: MetaCyc:Steroids
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:51958 ! organic polycyclic compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H31R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "259.450" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "259.24258" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCCC4)C" xsd:string

[Term]
id: CHEBI:35343
name: 17beta-hydroxy steroid
namespace: chebi_ontology
alt_id: CHEBI:19176
alt_id: CHEBI:794
def: "A 17-hydroxy steroid in which the hydroxy group at position 17 has a beta-configuration." []
subset: 3_STAR
synonym: "17beta-hydroxy steroid" EXACT [UniProt]
synonym: "17beta-hydroxy steroids" RELATED [ChEBI]
synonym: "17beta-hydroxysteroid" RELATED [KEGG_COMPOUND]
synonym: "17beta-hydroxysteroids" RELATED [ChEBI]
xref: KEGG:C03051
xref: MetaCyc:17-beta-Hydroxysteroids
is_a: CHEBI:36838 ! 17-hydroxy steroid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H29OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "261.423" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "261.22184" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC12CCC3C(CCC4CCCCC34[*])C1CC[C@@H]2O" xsd:string

[Term]
id: CHEBI:35344
name: 21-hydroxy steroid
namespace: chebi_ontology
alt_id: CHEBI:1300
alt_id: CHEBI:13596
alt_id: CHEBI:19803
subset: 3_STAR
synonym: "21-hydroxy steroids" RELATED [ChEBI]
synonym: "21-Hydroxysteroid" RELATED [KEGG_COMPOUND]
synonym: "21-hydroxysteroids" RELATED [ChEBI]
xref: KEGG:C02506
is_a: CHEBI:35350 ! hydroxy steroid

[Term]
id: CHEBI:35346
name: 11beta-hydroxy steroid
namespace: chebi_ontology
alt_id: CHEBI:13774
alt_id: CHEBI:19134
alt_id: CHEBI:738
def: "Any 11-hydroxy steroid in which the hydroxy group at position 11 has beta- configuration." []
subset: 3_STAR
synonym: "11beta-hydroxy steroids" RELATED [ChEBI]
synonym: "11beta-Hydroxysteroid" RELATED [KEGG_COMPOUND]
synonym: "11beta-hydroxysteroids" RELATED [ChEBI]
synonym: "an 11beta-hydroxysteroid" RELATED [UniProt]
xref: KEGG:C01058
is_a: CHEBI:36841 ! 11-hydroxy steroid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H31OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "275.450" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "275.23749" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12(CCCCC1CCC3C2[C@H](CC4(C3CCC4*)C)O)C" xsd:string

[Term]
id: CHEBI:35350
name: hydroxy steroid
namespace: chebi_ontology
alt_id: CHEBI:24748
alt_id: CHEBI:5814
subset: 3_STAR
synonym: "hydroxy steroids" RELATED [ChEBI]
synonym: "Hydroxysteroid" RELATED [KEGG_COMPOUND]
synonym: "hydroxysteroids" RELATED [ChEBI]
xref: KEGG:C02159
is_a: CHEBI:33822 ! organic hydroxy compound
is_a: CHEBI:35341 ! steroid

[Term]
id: CHEBI:35352
name: organonitrogen compound
namespace: chebi_ontology
def: "Any heteroorganic entity containing at least one carbon-nitrogen bond." []
subset: 3_STAR
synonym: "organonitrogen compounds" EXACT IUPAC_NAME [IUPAC]
synonym: "organonitrogens" RELATED [ChEBI]
is_a: CHEBI:33285 ! heteroorganic entity
is_a: CHEBI:51143 ! nitrogen molecular entity

[Term]
id: CHEBI:35366
name: fatty acid
namespace: chebi_ontology
alt_id: CHEBI:13633
alt_id: CHEBI:24024
alt_id: CHEBI:4984
def: "Any aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax. Natural fatty acids commonly have a chain of 4 to 28 carbons (usually unbranched and even-numbered), which may be saturated or unsaturated. By extension, the term is sometimes used to embrace all acyclic aliphatic carboxylic acids." []
subset: 3_STAR
synonym: "acide gras" RELATED [ChEBI]
synonym: "acides gras" RELATED [ChemIDplus]
synonym: "acido graso" RELATED [ChEBI]
synonym: "acidos grasos" RELATED [ChEBI]
synonym: "Fatty acid" EXACT [KEGG_COMPOUND]
synonym: "fatty acids" EXACT IUPAC_NAME [IUPAC]
synonym: "fatty acids" RELATED [ChEBI]
synonym: "Fettsaeure" RELATED [ChEBI]
synonym: "Fettsaeuren" RELATED [ChEBI]
xref: KEGG:C00162
xref: PMID:14287444 {source="Europe PMC"}
xref: PMID:14300208 {source="Europe PMC"}
xref: PMID:14328676 {source="Europe PMC"}
xref: Wikipedia:Fatty_acid
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:25384 ! monocarboxylic acid
relationship: is_conjugate_acid_of CHEBI:28868 ! fatty acid anion
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01740" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string

[Term]
id: CHEBI:35381
name: monosaccharide
namespace: chebi_ontology
alt_id: CHEBI:25407
alt_id: CHEBI:6984
def: "Parent monosaccharides are polyhydroxy aldehydes H[CH(OH)]nC(=O)H or polyhydroxy ketones H-[CHOH]n-C(=O)[CHOH]m-H with three or more carbon atoms. The generic term 'monosaccharide' (as opposed to oligosaccharide or polysaccharide) denotes a single unit, without glycosidic connection to other such units. It includes aldoses, dialdoses, aldoketoses, ketoses and diketoses, as well as deoxy sugars, provided that the parent compound has a (potential) carbonyl group." []
subset: 3_STAR
synonym: "monosacarido" RELATED [ChEBI]
synonym: "monosacaridos" RELATED [IUPAC]
synonym: "Monosaccharid" RELATED [ChEBI]
synonym: "Monosaccharide" EXACT [KEGG_COMPOUND]
synonym: "monosaccharides" EXACT IUPAC_NAME [IUPAC]
synonym: "Monosacharid" RELATED [ChEBI]
xref: KEGG:C06698
is_a: CHEBI:16646 ! carbohydrate

[Term]
id: CHEBI:35406
name: oxoanion
namespace: chebi_ontology
alt_id: CHEBI:33274
alt_id: CHEBI:33436
def: "An oxoanion is an anion derived from an oxoacid by loss of hydron(s) bound to oxygen." []
subset: 3_STAR
synonym: "oxoacid anions" RELATED [ChEBI]
synonym: "oxoanion" EXACT [ChEBI]
synonym: "oxoanions" RELATED [ChEBI]
is_a: CHEBI:25741 ! oxide
is_a: CHEBI:33273 ! polyatomic anion

[Term]
id: CHEBI:35470
name: central nervous system drug
namespace: chebi_ontology
def: "A class of drugs producing both physiological and psychological effects through a variety of mechanisms involving the central nervous system." []
subset: 3_STAR
synonym: "central nervous system agents" RELATED [ChEBI]
synonym: "CNS agent" RELATED [ChEBI]
synonym: "CNS drugs" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:35472
name: anti-inflammatory drug
namespace: chebi_ontology
def: "A substance that reduces or suppresses inflammation." []
subset: 3_STAR
synonym: "anti-inflammatory drugs" RELATED [ChEBI]
synonym: "antiinflammatory agent" RELATED [ChEBI]
synonym: "antiinflammatory drug" RELATED [ChEBI]
synonym: "antiinflammatory drugs" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug
is_a: CHEBI:67079 ! anti-inflammatory agent

[Term]
id: CHEBI:35479
name: alkali metal salt
namespace: chebi_ontology
subset: 3_STAR
synonym: "alkali metal salts" RELATED [ChEBI]
is_a: CHEBI:24866 ! salt
is_a: CHEBI:33296 ! alkali metal molecular entity

[Term]
id: CHEBI:35488
name: central nervous system depressant
namespace: chebi_ontology
def: "A loosely defined group of drugs that tend to reduce the activity of the central nervous system." []
subset: 3_STAR
synonym: "central nervous system depressants" RELATED [ChEBI]
synonym: "CNS depressants" RELATED [ChEBI]
is_a: CHEBI:35470 ! central nervous system drug

[Term]
id: CHEBI:35507
name: natural product fundamental parent
namespace: chebi_ontology
subset: 3_STAR
synonym: "natural product fundamental parents" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33245 ! organic fundamental parent

[Term]
id: CHEBI:35508
name: steroid fundamental parent
namespace: chebi_ontology
subset: 3_STAR
synonym: "steroid fundamental parents" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid
is_a: CHEBI:35507 ! natural product fundamental parent

[Term]
id: CHEBI:35509
name: androstane
namespace: chebi_ontology
subset: 3_STAR
synonym: "androstane" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:5247532 {source="Beilstein"}
xref: CAS:24887-75-0 {source="ChemIDplus"}
xref: LIPID_MAPS_instance:LMST02020000 {source="LIPID MAPS"}
is_a: CHEBI:35508 ! steroid fundamental parent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H32" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C19H32/c1-18-11-5-7-16(18)15-9-8-14-6-3-4-12-19(14,2)17(15)10-13-18/h14-17H,3-13H2,1-2H3/t14?,15-,16-,17-,18-,19-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZLYKIGBANMMBK-FZFXZXLVSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "260.45738" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "260.25040" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3CCCC[C@]3(C)[C@@]1([H])CC[C@]1(C)CCC[C@@]21[H]" xsd:string

[Term]
id: CHEBI:35519
name: cholane
namespace: chebi_ontology
subset: 3_STAR
synonym: "cholane" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:35508 ! steroid fundamental parent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H42" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18?,19+,20-,21+,22+,23+,24-/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QSHQKIURKJITMZ-BRPMRXRMSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "330.59028" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "330.32865" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC" xsd:string

[Term]
id: CHEBI:35522
name: beta-adrenergic agonist
namespace: chebi_ontology
def: "An agent that selectively binds to and activates beta-adrenergic receptors." []
subset: 3_STAR
synonym: "beta-adrenergic agonists" RELATED [ChEBI]
synonym: "beta-adrenergic receptor agonist" RELATED [ChEBI]
synonym: "beta-adrenoceptor agonists" RELATED [IUPHAR]
is_a: CHEBI:37886 ! adrenergic agonist
is_a: CHEBI:48540 ! beta-adrenergic drug

[Term]
id: CHEBI:35523
name: bronchodilator agent
namespace: chebi_ontology
def: "An agent that causes an increase in the expansion of a bronchus or bronchial tubes." []
subset: 3_STAR
synonym: "bronchodilator" RELATED [ChEBI]
synonym: "bronchodilator agents" RELATED [ChEBI]
synonym: "broncholytic agent" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:35524
name: sympathomimetic agent
namespace: chebi_ontology
def: "A drug that mimics the effects of stimulating postganglionic adrenergic sympathetic nerves. Included in this class are drugs that directly stimulate adrenergic receptors and drugs that act indirectly by provoking the release of adrenergic transmitters." []
subset: 3_STAR
synonym: "sympathomimetic" RELATED [ChEBI]
synonym: "sympathomimetics" RELATED [ChEBI]
is_a: CHEBI:37962 ! adrenergic agent

[Term]
id: CHEBI:35554
name: cardiovascular drug
namespace: chebi_ontology
def: "A drug that affects the rate or intensity of cardiac contraction, blood vessel diameter or blood volume." []
subset: 3_STAR
synonym: "cardiovascular agent" RELATED [ChEBI]
synonym: "cardiovascular drugs" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:35604
name: carbon oxoanion
namespace: chebi_ontology
def: "A negative ion consisting solely of carbon and oxygen  atoms, and therefore having the general formula CxOy(n-) for some integers x, y and n." []
subset: 3_STAR
synonym: "carbon oxoanion" EXACT [ChEBI]
synonym: "carbon oxoanions" RELATED [ChEBI]
synonym: "oxocarbon anion" RELATED [ChEBI]
synonym: "oxocarbon anions" RELATED [ChEBI]
is_a: CHEBI:25696 ! organic anion
is_a: CHEBI:35406 ! oxoanion
is_a: CHEBI:36963 ! organooxygen compound

[Term]
id: CHEBI:35605
name: carbon oxoacid
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbon oxoacids" RELATED [ChEBI]
synonym: "oxoacids of carbon" RELATED [ChEBI]
is_a: CHEBI:24833 ! oxoacid
is_a: CHEBI:36963 ! organooxygen compound

[Term]
id: CHEBI:35610
name: antineoplastic agent
namespace: chebi_ontology
def: "A substance that inhibits or prevents the proliferation of neoplasms." []
subset: 3_STAR
synonym: "anticancer agent" RELATED [ChEBI]
synonym: "anticancer agents" RELATED [ChEBI]
synonym: "antineoplastic" RELATED [ChEBI]
synonym: "antineoplastic agents" RELATED [ChEBI]
synonym: "cytostatic" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:35620
name: vasodilator agent
namespace: chebi_ontology
def: "A drug used to cause dilation of the blood vessels." []
subset: 3_STAR
synonym: "vasodilator" RELATED [ChEBI]
synonym: "vasodilator agents" RELATED [ChEBI]
is_a: CHEBI:35554 ! cardiovascular drug

[Term]
id: CHEBI:35623
name: anticonvulsant
namespace: chebi_ontology
def: "A drug used to prevent seizures or reduce their severity." []
subset: 3_STAR
synonym: "anti-convulsant" RELATED [ChEBI]
synonym: "anti-convulsants" RELATED [ChEBI]
synonym: "anti-convulsive agent" RELATED [ChEBI]
synonym: "anti-convulsive agents" RELATED [ChEBI]
synonym: "anticonvulsants" RELATED [ChEBI]
synonym: "anticonvulsive agent" RELATED [ChEBI]
synonym: "anticonvulsive agents" RELATED [ChEBI]
synonym: "antiepileptic" RELATED [ChEBI]
synonym: "antiepileptics" RELATED [ChEBI]
synonym: "Antiepileptika" RELATED [ChEBI]
synonym: "Antiepileptikum" RELATED [ChEBI]
synonym: "antiepileptique" RELATED [ChEBI]
synonym: "antiepileptiques" RELATED [ChEBI]
synonym: "Antikonvulsiva" RELATED [ChEBI]
synonym: "Antikonvulsivum" RELATED [ChEBI]
is_a: CHEBI:35488 ! central nervous system depressant

[Term]
id: CHEBI:35692
name: dicarboxylic acid
namespace: chebi_ontology
alt_id: CHEBI:23692
alt_id: CHEBI:36172
alt_id: CHEBI:4501
def: "Any carboxylic acid containing two carboxy groups." []
subset: 3_STAR
synonym: "Dicarboxylic acid" EXACT [KEGG_COMPOUND]
synonym: "dicarboxylic acids" RELATED [ChEBI]
xref: KEGG:C02028
is_a: CHEBI:131927 ! dicarboxylic acids and O-substituted derivatives
is_a: CHEBI:33575 ! carboxylic acid
relationship: is_conjugate_acid_of CHEBI:35693 ! dicarboxylic acid anion

[Term]
id: CHEBI:35693
name: dicarboxylic acid anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "dicarboxylic acid anion" EXACT [ChEBI]
synonym: "dicarboxylic acid anions" RELATED [ChEBI]
is_a: CHEBI:29067 ! carboxylic acid anion
relationship: is_conjugate_base_of CHEBI:35692 ! dicarboxylic acid

[Term]
id: CHEBI:35701
name: ester
namespace: chebi_ontology
alt_id: CHEBI:23960
alt_id: CHEBI:4859
def: "A compound formally derived from an oxoacid RkE(=O)l(OH)m (l > 0) and an alcohol, phenol, heteroarenol, or enol by linking with formal loss of water from an acidic hydroxy group of the former and a hydroxy group of the latter." []
subset: 3_STAR
synonym: "Ester" EXACT [KEGG_COMPOUND]
synonym: "esters" RELATED [ChEBI]
xref: KEGG:C00287
xref: Wikipedia:Ester
is_a: CHEBI:36963 ! organooxygen compound

[Term]
id: CHEBI:35722
name: sulfated glycosaminoglycan
namespace: chebi_ontology
subset: 3_STAR
synonym: "glycosaminoglycan sulfate" RELATED [ChEBI]
synonym: "glycosaminoglycan sulfates" RELATED [ChEBI]
synonym: "sulfated glycosaminoglycans" RELATED [ChEBI]
is_a: CHEBI:18085 ! glycosaminoglycan
is_a: CHEBI:35724 ! carbohydrate sulfate

[Term]
id: CHEBI:35724
name: carbohydrate sulfate
namespace: chebi_ontology
subset: 3_STAR
synonym: "carbohydrate sulfates" RELATED [ChEBI]
synonym: "carbohydrate sulphates" RELATED [ChEBI]
is_a: CHEBI:25704 ! organic sulfate
is_a: CHEBI:26819 ! sulfuric ester
is_a: CHEBI:63299 ! carbohydrate derivative

[Term]
id: CHEBI:35740
name: liposaccharide
namespace: chebi_ontology
subset: 3_STAR
synonym: "liposaccharides" RELATED [ChEBI]
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:63299 ! carbohydrate derivative

[Term]
id: CHEBI:35757
name: monocarboxylic acid anion
namespace: chebi_ontology
alt_id: CHEBI:13657
alt_id: CHEBI:25382
alt_id: CHEBI:3407
def: "A carboxylic acid anion formed when the carboxy group of a monocarboxylic acid is deprotonated." []
subset: 3_STAR
synonym: "a monocarboxylate" RELATED [UniProt]
synonym: "Carboxylate" RELATED [KEGG_COMPOUND]
synonym: "Monocarboxylate" RELATED [KEGG_COMPOUND]
synonym: "monocarboxylates" RELATED [ChEBI]
synonym: "monocarboxylic acid anions" RELATED [ChEBI]
xref: KEGG:C00060
is_a: CHEBI:29067 ! carboxylic acid anion
relationship: is_conjugate_base_of CHEBI:25384 ! monocarboxylic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.01000" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string

[Term]
id: CHEBI:35780
name: phosphate ion
namespace: chebi_ontology
def: "A phosphorus oxoanion that is the conjugate base of phosphoric acid." []
subset: 3_STAR
synonym: "phosphate" RELATED [ChEBI]
synonym: "phosphate ions" RELATED [ChEBI]
synonym: "Pi" RELATED [ChEBI]
is_a: CHEBI:33461 ! phosphorus oxoanion
relationship: is_conjugate_base_of CHEBI:26078 ! phosphoric acid
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite

[Term]
id: CHEBI:35789
name: oxo steroid
namespace: chebi_ontology
alt_id: CHEBI:24979
alt_id: CHEBI:25804
subset: 3_STAR
synonym: "keto steroids" RELATED [ChEBI]
synonym: "ketosteroids" RELATED [ChEBI]
synonym: "oxo steroids" RELATED [ChEBI]
synonym: "oxosteroids" RELATED [ChEBI]
is_a: CHEBI:17087 ! ketone
is_a: CHEBI:35341 ! steroid

[Term]
id: CHEBI:35881
name: pnictogen hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "pnictogen hydride" EXACT [ChEBI]
synonym: "pnictogen hydrides" RELATED [ChEBI]
is_a: CHEBI:33242 ! inorganic hydride
is_a: CHEBI:33302 ! pnictogen molecular entity

[Term]
id: CHEBI:35942
name: neurotransmitter agent
namespace: chebi_ontology
def: "A substance used for its pharmacological action on any aspect of neurotransmitter systems. Neurotransmitter agents include agonists, antagonists, degradation inhibitors, uptake inhibitors, depleters, precursors, and modulators of receptor function." []
subset: 3_STAR
synonym: "neurotransmitter agents" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug
is_a: CHEBI:52210 ! pharmacological role

[Term]
id: CHEBI:36063
name: oxytocic
namespace: chebi_ontology
def: "A drug that stimulates contraction of the myometrium. Oxytocics are used to induce labour, obstetric at term, to prevent or control postpartum or postabortion haemorrhage, and to assess foetal status in high risk pregnancies. They may also be used alone or with other drugs to induce abortions (abortifacients)." []
subset: 3_STAR
synonym: "oxytocic" EXACT [ChEBI]
synonym: "oxytocic agents" RELATED [ChEBI]
synonym: "oxytocic drugs" RELATED [ChEBI]
synonym: "uterine stimulants" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:36078
name: cholanoid
namespace: chebi_ontology
alt_id: CHEBI:22867
alt_id: CHEBI:50419
subset: 3_STAR
synonym: "bile acids and derivatives" RELATED [LIPID_MAPS]
synonym: "cholanoids" RELATED [ChEBI]
xref: LIPID_MAPS_class:LMST04 {source="LIPID MAPS"}
is_a: CHEBI:35341 ! steroid
relationship: has_parent_hydride CHEBI:35519 ! cholane

[Term]
id: CHEBI:36080
name: protein
namespace: chebi_ontology
alt_id: CHEBI:13677
alt_id: CHEBI:14911
def: "A biological macromolecule minimally consisting of one polypeptide chain synthesized at the ribosome." []
subset: 3_STAR
synonym: "proteins" EXACT IUPAC_NAME [IUPAC]
is_a: PR:000000001 ! protein
equivalent_to: PR:000000001 ! protein

[Term]
id: CHEBI:36235
name: bile acid anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "bile acid anions" RELATED [ChEBI]
is_a: CHEBI:35757 ! monocarboxylic acid anion
is_a: CHEBI:50160 ! steroid acid anion

[Term]
id: CHEBI:36237
name: cholanic acid
namespace: chebi_ontology
def: "A steroid acid that consists of cholane having a carboxy group in place of the methyl group at position 24." []
subset: 3_STAR
synonym: "cholan-24-oic acid" EXACT IUPAC_NAME [IUPAC]
xref: CAS:25312-65-6 {source="ChemIDplus"}
xref: Patent:JP2008069152
xref: Reaxys:13246008 {source="Reaxys"}
is_a: CHEBI:36278 ! cholanic acids
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H40O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17?,18+,19-,20+,21+,23+,24-/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RPKLZQLYODPWTM-KBMWBBLPSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "360.57320" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.30283" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC(O)=O" xsd:string

[Term]
id: CHEBI:36238
name: 5beta-cholanic acid
namespace: chebi_ontology
subset: 3_STAR
synonym: "(5beta)-cholan-24-oic acid" RELATED [ChemIDplus]
synonym: "(5beta,17beta)-gamma-methylandrostane-17-butanoic acid" RELATED [ChemIDplus]
synonym: "5beta-cholan-24-oic acid" EXACT IUPAC_NAME [IUPAC]
synonym: "5beta-cholanic acid" EXACT [ChemIDplus]
synonym: "5beta-cholanoic acid" RELATED [ChemIDplus]
synonym: "ursocholanic acid" RELATED [ChemIDplus]
xref: Beilstein:3214794 {source="Beilstein"}
xref: CAS:546-18-9 {source="ChemIDplus"}
xref: LIPID_MAPS_instance:LMST04010441 {source="LIPID MAPS"}
is_a: CHEBI:36237 ! cholanic acid
is_a: CHEBI:36248 ! 5beta-cholanic acids
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H40O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17+,18+,19-,20+,21+,23+,24-/m1/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RPKLZQLYODPWTM-LVVAJZGHSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "360.57320" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.30283" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC(O)=O" xsd:string

[Term]
id: CHEBI:36248
name: 5beta-cholanic acids
namespace: chebi_ontology
def: "Members of the class of cholanic acids based on a 5beta-cholane skeleton." []
subset: 3_STAR
is_a: CHEBI:136889 ! 5beta steroid
is_a: CHEBI:36278 ! cholanic acids
relationship: has_parent_hydride CHEBI:20664 ! 5beta-cholane

[Term]
id: CHEBI:36277
name: bile acid salt
namespace: chebi_ontology
def: "A salt of a bile acid." []
subset: 3_STAR
synonym: "bile acid salts" RELATED [ChEBI]
is_a: CHEBI:24868 ! organic salt
is_a: CHEBI:36078 ! cholanoid

[Term]
id: CHEBI:36278
name: cholanic acids
namespace: chebi_ontology
alt_id: CHEBI:23166
alt_id: CHEBI:23211
subset: 1_STAR
is_a: CHEBI:36078 ! cholanoid
is_a: CHEBI:47891 ! steroid acid

[Term]
id: CHEBI:36338
name: lepton
namespace: chebi_ontology
def: "Lepton is a fermion that does not experience the strong force (strong interaction). The term is derived from the Greek lambdaepsilonpitauomicronsigma (small, thin)." []
subset: 3_STAR
synonym: "leptons" RELATED [ChEBI]
is_a: CHEBI:33233 ! fundamental particle
is_a: CHEBI:36340 ! fermion

[Term]
id: CHEBI:36339
name: baryon
namespace: chebi_ontology
def: "Baryon is a fermion that does experience the strong force (strong interaction). The term is derived from the Greek betaalpharhoupsilonsigma (heavy)." []
subset: 3_STAR
synonym: "baryons" RELATED [ChEBI]
is_a: CHEBI:36340 ! fermion
is_a: CHEBI:36344 ! hadron

[Term]
id: CHEBI:36340
name: fermion
namespace: chebi_ontology
def: "Particle of half-integer spin quantum number following Fermi-Dirac statistics. Fermions are named after Enrico Fermi." []
subset: 3_STAR
synonym: "fermion" EXACT IUPAC_NAME [IUPAC]
synonym: "fermions" RELATED [ChEBI]
is_a: CHEBI:36342 ! subatomic particle

[Term]
id: CHEBI:36341
name: boson
namespace: chebi_ontology
def: "Particle of integer spin quantum number following Bose-Einstein statistics. Bosons are named after Satyendra Nath Bose." []
subset: 3_STAR
synonym: "boson" EXACT IUPAC_NAME [IUPAC]
synonym: "bosons" RELATED [ChEBI]
is_a: CHEBI:36342 ! subatomic particle

[Term]
id: CHEBI:36342
name: subatomic particle
namespace: chebi_ontology
def: "A particle smaller than an atom." []
subset: 3_STAR
synonym: "subatomic particles" RELATED [ChEBI]
xref: Wikipedia:Subatomic_particle

[Term]
id: CHEBI:36343
name: composite particle
namespace: chebi_ontology
def: "A subatomic particle known to have substructure (i.e. consisting of smaller particles)." []
subset: 3_STAR
synonym: "composite particles" RELATED [ChEBI]
is_a: CHEBI:36342 ! subatomic particle

[Term]
id: CHEBI:36344
name: hadron
namespace: chebi_ontology
def: "Hadron is a subatomic particle which experiences the strong force." []
subset: 3_STAR
synonym: "hadrons" RELATED [ChEBI]
is_a: CHEBI:36343 ! composite particle

[Term]
id: CHEBI:36347
name: nuclear particle
namespace: chebi_ontology
def: "A nucleus or any of its constituents in any of their energy states." []
subset: 3_STAR
synonym: "nuclear particle" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:36342 ! subatomic particle

[Term]
id: CHEBI:36357
name: polyatomic entity
namespace: chebi_ontology
def: "Any molecular entity consisting of more than one atom." []
subset: 3_STAR
synonym: "polyatomic entities" RELATED [ChEBI]
is_a: CHEBI:23367 ! molecular entity
relationship: has_part CHEBI:24433 ! group

[Term]
id: CHEBI:36358
name: polyatomic ion
namespace: chebi_ontology
def: "An ion consisting of more than one atom." []
subset: 3_STAR
synonym: "polyatomic ions" RELATED [ChEBI]
is_a: CHEBI:24870 ! ion
is_a: CHEBI:36357 ! polyatomic entity

[Term]
id: CHEBI:36359
name: phosphorus oxoacid derivative
namespace: chebi_ontology
subset: 3_STAR
synonym: "phosphorus oxoacid derivative" EXACT [ChEBI]
is_a: CHEBI:33241 ! oxoacid derivative
is_a: CHEBI:36360 ! phosphorus oxoacids and derivatives
relationship: has_functional_parent CHEBI:33457 ! phosphorus oxoacid

[Term]
id: CHEBI:36360
name: phosphorus oxoacids and derivatives
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:26082 ! phosphorus molecular entity

[Term]
id: CHEBI:36586
name: carbonyl compound
namespace: chebi_ontology
def: "Any compound containing the carbonyl group, C=O. The term is commonly used in the restricted sense of aldehydes and ketones, although it actually includes carboxylic acids and derivatives." []
subset: 3_STAR
synonym: "carbonyl compounds" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:36587 ! organic oxo compound
is_a: CHEBI:36963 ! organooxygen compound
relationship: has_part CHEBI:23019 ! carbonyl group

[Term]
id: CHEBI:36587
name: organic oxo compound
namespace: chebi_ontology
def: "Organic compounds containing an oxygen atom, =O, doubly bonded to carbon or another element." []
subset: 3_STAR
synonym: "organic oxo compounds" RELATED [ChEBI]
synonym: "oxo compounds" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:72695 ! organic molecule
relationship: has_part CHEBI:46629 ! oxo group

[Term]
id: CHEBI:36699
name: corticosteroid hormone
namespace: chebi_ontology
def: "Any of a class of steroid hormones that are produced in the adrenal cortex." []
subset: 3_STAR
synonym: "adrenal cortex hormones" RELATED [ChEBI]
synonym: "corticosteroid hormones" RELATED [ChEBI]
is_a: CHEBI:26764 ! steroid hormone
is_a: CHEBI:50858 ! corticosteroid

[Term]
id: CHEBI:36735
name: biladienes
namespace: chebi_ontology
def: "Compounds based on a biladiene skeleton." []
subset: 3_STAR
is_a: CHEBI:25046 ! linear tetrapyrrole

[Term]
id: CHEBI:36756
name: farnesane
namespace: chebi_ontology
def: "A sesquiterpene that is dodecane substituted by methyl groups at positions 2, 6 and 10." []
subset: 3_STAR
synonym: "2,6,10-trimethyldodecane" EXACT IUPAC_NAME [IUPAC]
synonym: "Farnesan" RELATED [NIST_Chemistry_WebBook]
synonym: "farnesane" EXACT [NIST_Chemistry_WebBook]
xref: Beilstein:1719672 {source="Beilstein"}
xref: CAS:3891-98-3 {source="NIST Chemistry WebBook"}
xref: CAS:3891-98-3 {source="ChemIDplus"}
xref: LIPID_MAPS_instance:LMPR0103010000 {source="LIPID MAPS"}
xref: MetaCyc:CPD-8764
xref: Patent:US2008098645
xref: Patent:US7399323
xref: Reaxys:1719672 {source="Reaxys"}
is_a: CHEBI:18310 ! alkane
is_a: CHEBI:35189 ! sesquiterpene
relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C15H32" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C15H32/c1-6-14(4)10-8-12-15(5)11-7-9-13(2)3/h13-15H,6-12H2,1-5H3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YFHFHLSMISYUAQ-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "212.41458" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "212.25040" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCC(C)CCCC(C)CCCC(C)C" xsd:string

[Term]
id: CHEBI:36757
name: farnesane sesquiterpenoid
namespace: chebi_ontology
subset: 3_STAR
synonym: "farnesane sesquiterpenoid" EXACT [ChEBI]
synonym: "farnesane sesquiterpenoids" RELATED [ChEBI]
is_a: CHEBI:26658 ! sesquiterpenoid
relationship: has_parent_hydride CHEBI:36756 ! farnesane

[Term]
id: CHEBI:36834
name: 3-hydroxy steroid
namespace: chebi_ontology
def: "Any hydroxy steroid carrying a hydroxy group at position 3." []
subset: 3_STAR
synonym: "3-hydroxy steroids" RELATED [ChEBI]
is_a: CHEBI:35350 ! hydroxy steroid

[Term]
id: CHEBI:36838
name: 17-hydroxy steroid
namespace: chebi_ontology
def: "A hydroxy steroid carrying a hydroxy group at position 17." []
subset: 3_STAR
synonym: "17-hydroxy steroids" RELATED [ChEBI]
is_a: CHEBI:35350 ! hydroxy steroid

[Term]
id: CHEBI:36841
name: 11-hydroxy steroid
namespace: chebi_ontology
subset: 3_STAR
synonym: "11-hydroxy steroids" RELATED [ChEBI]
is_a: CHEBI:35350 ! hydroxy steroid

[Term]
id: CHEBI:36871
name: inorganic radical
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic radicals" RELATED [ChEBI]
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:26519 ! radical

[Term]
id: CHEBI:36873
name: radical anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "anion radical" RELATED [IUPAC]
synonym: "radical anion" EXACT IUPAC_NAME [IUPAC]
synonym: "radical anions" RELATED [ChEBI]
is_a: CHEBI:22563 ! anion
is_a: CHEBI:36875 ! radical ion

[Term]
id: CHEBI:36875
name: radical ion
namespace: chebi_ontology
def: "A radical that carries an electric charge." []
subset: 3_STAR
synonym: "ion radical" RELATED [IUPAC]
synonym: "radical ion" EXACT IUPAC_NAME [IUPAC]
synonym: "radical ions" RELATED [IUPAC]
is_a: CHEBI:24870 ! ion
is_a: CHEBI:26519 ! radical

[Term]
id: CHEBI:36876
name: inorganic radical anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic anion radical" RELATED [ChEBI]
synonym: "inorganic radical anions" RELATED [ChEBI]
is_a: CHEBI:36873 ! radical anion
is_a: CHEBI:36878 ! inorganic radical ion

[Term]
id: CHEBI:36878
name: inorganic radical ion
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic ion radical" RELATED [ChEBI]
synonym: "inorganic radical ions" RELATED [ChEBI]
is_a: CHEBI:36871 ! inorganic radical
is_a: CHEBI:36875 ! radical ion

[Term]
id: CHEBI:36885
name: 20-oxo steroid
namespace: chebi_ontology
def: "An oxo steroid carrying an oxo group at position 20." []
subset: 3_STAR
synonym: "20-oxo steroids" RELATED [ChEBI]
is_a: CHEBI:35789 ! oxo steroid

[Term]
id: CHEBI:36887
name: 18-oxo steroid
namespace: chebi_ontology
subset: 3_STAR
synonym: "18-oxo steroids" RELATED [ChEBI]
is_a: CHEBI:35789 ! oxo steroid

[Term]
id: CHEBI:36902
name: chalcogen hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "chalcogen hydride" EXACT [ChEBI]
synonym: "chalcogen hydrides" RELATED [ChEBI]
is_a: CHEBI:33242 ! inorganic hydride
is_a: CHEBI:33304 ! chalcogen molecular entity

[Term]
id: CHEBI:36914
name: inorganic ion
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic ions" RELATED [ChEBI]
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:24870 ! ion

[Term]
id: CHEBI:36915
name: inorganic cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic cations" RELATED [ChEBI]
is_a: CHEBI:36914 ! inorganic ion
is_a: CHEBI:36916 ! cation

[Term]
id: CHEBI:36916
name: cation
namespace: chebi_ontology
alt_id: CHEBI:23058
alt_id: CHEBI:3473
def: "A monoatomic or polyatomic species having one or more elementary charges of the proton." []
subset: 3_STAR
synonym: "Cation" EXACT [KEGG_COMPOUND]
synonym: "cation" EXACT IUPAC_NAME [IUPAC]
synonym: "cation" EXACT [ChEBI]
synonym: "cationes" RELATED [ChEBI]
synonym: "cations" RELATED [ChEBI]
synonym: "Kation" RELATED [ChEBI]
synonym: "Kationen" RELATED [ChEBI]
xref: KEGG:C01373
is_a: CHEBI:24870 ! ion

[Term]
id: CHEBI:36961
name: chalcocarbonic acid
namespace: chebi_ontology
subset: 3_STAR
synonym: "chalcocarbonic acid" EXACT [ChEBI]
synonym: "chalcocarbonic acids" EXACT IUPAC_NAME [IUPAC]
synonym: "chalcocarbonic acids" RELATED [ChEBI]
is_a: CHEBI:36962 ! organochalcogen compound

[Term]
id: CHEBI:36962
name: organochalcogen compound
namespace: chebi_ontology
def: "An organochalcogen compound is a compound containing at least one carbon-chalcogen bond." []
subset: 3_STAR
synonym: "organochalcogen compound" EXACT [ChEBI]
synonym: "organochalcogen compounds" RELATED [ChEBI]
is_a: CHEBI:33285 ! heteroorganic entity
is_a: CHEBI:33304 ! chalcogen molecular entity

[Term]
id: CHEBI:36963
name: organooxygen compound
namespace: chebi_ontology
def: "An organochalcogen compound containing at least one carbon-oxygen bond." []
subset: 3_STAR
synonym: "organooxygen compound" EXACT [ChEBI]
synonym: "organooxygen compounds" RELATED [ChEBI]
xref: PMID:17586126 {source="Europe PMC"}
is_a: CHEBI:25806 ! oxygen molecular entity
is_a: CHEBI:36962 ! organochalcogen compound

[Term]
id: CHEBI:37022
name: amino-acid anion
namespace: chebi_ontology
subset: 3_STAR
synonym: "amino acid anions" RELATED [ChEBI]
synonym: "amino-acid anion" EXACT [ChEBI]
synonym: "amino-acid anions" RELATED [ChEBI]
is_a: CHEBI:29067 ! carboxylic acid anion
is_a: CHEBI:35352 ! organonitrogen compound
relationship: is_conjugate_base_of CHEBI:33709 ! amino acid

[Term]
id: CHEBI:37163
name: glucan
namespace: chebi_ontology
alt_id: CHEBI:24255
alt_id: CHEBI:5392
def: "A polysaccharide composed of glucose residues." []
subset: 3_STAR
synonym: "Glucan" EXACT [KEGG_COMPOUND]
synonym: "glucan" EXACT IUPAC_NAME [IUPAC]
synonym: "glucans" RELATED [ChEBI]
xref: CAS:9037-91-6 {source="ChemIDplus"}
xref: KEGG:C01379
is_a: CHEBI:37164 ! homopolysaccharide
property_value: http://purl.obolibrary.org/obo/chebi/formula "C12H22O11(C6H10O5)n" xsd:string

[Term]
id: CHEBI:37164
name: homopolysaccharide
namespace: chebi_ontology
def: "Glycans composed of a single type of monosaccharide residue. They are named by replacing the ending '-ose' of the sugar by '-an'." []
subset: 3_STAR
synonym: "homoglycan" RELATED [IUPAC]
synonym: "homopolysaccharide" EXACT IUPAC_NAME [IUPAC]
synonym: "homopolysaccharides" RELATED [ChEBI]
is_a: CHEBI:18154 ! polysaccharide

[Term]
id: CHEBI:37175
name: organic hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic hydrides" RELATED [ChEBI]
is_a: CHEBI:33692 ! hydrides

[Term]
id: CHEBI:37176
name: mononuclear parent hydride
namespace: chebi_ontology
subset: 3_STAR
synonym: "mononuclear hydride" RELATED [ChEBI]
synonym: "mononuclear hydrides" RELATED [IUPAC]
synonym: "mononuclear parent hydrides" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:33692 ! hydrides

[Term]
id: CHEBI:37246
name: elemental sodium
namespace: chebi_ontology
subset: 3_STAR
is_a: CHEBI:26712 ! sodium molecular entity

[Term]
id: CHEBI:37395
name: mucopolysaccharide
namespace: chebi_ontology
alt_id: CHEBI:25425
alt_id: CHEBI:7011
def: "Any of the group of polysaccharides composed of alternating units from uronic acids and glycosamines, and commonly partially esterified with sulfuric acid." []
subset: 3_STAR
synonym: "mucopolisacarido" RELATED [ChEBI]
synonym: "mucopolisacaridos" RELATED [IUPAC]
synonym: "Mucopolysaccharid" RELATED [ChEBI]
synonym: "Mucopolysaccharide" EXACT [KEGG_COMPOUND]
synonym: "mucopolysaccharides" EXACT IUPAC_NAME [IUPAC]
synonym: "Mukopolysaccharid" RELATED [ChEBI]
xref: KEGG:C05114
is_a: CHEBI:18085 ! glycosaminoglycan

[Term]
id: CHEBI:37396
name: proteoglycan
namespace: chebi_ontology
alt_id: CHEBI:26351
alt_id: CHEBI:8582
def: "A glycoprotein in which the carbohydrate units are polysaccharides that contain amino sugars. The protein is glycosylated by one or more (up to about 100) glycosaminoglycans." []
subset: 3_STAR
synonym: "Proteoglycan" EXACT [KEGG_COMPOUND]
synonym: "proteoglycans" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C00866
is_a: CHEBI:17089 ! glycoprotein
is_a: CHEBI:65212 ! polysaccharide derivative

[Term]
id: CHEBI:37397
name: chondroitin sulfate
namespace: chebi_ontology
alt_id: CHEBI:23224
alt_id: CHEBI:3676
def: "Any of a class of 10--60 kDa glycosaminoglycan sulfates, widely distributed in cartilage and other mammalian connective tissues." []
subset: 3_STAR
synonym: "chondroitin polysulfate" RELATED [ChemIDplus]
synonym: "Chondroitin sulfate" EXACT [KEGG_COMPOUND]
synonym: "chondroitin sulfates" RELATED [ChemIDplus]
synonym: "chondroitin sulfuric acid" RELATED [ChemIDplus]
synonym: "chondroitin sulphate" RELATED [ChemIDplus]
synonym: "Chondroitinsulfat" RELATED [ChEBI]
xref: CAS:9007-28-7 {source="ChemIDplus"}
xref: CAS:9007-28-7 {source="KEGG COMPOUND"}
xref: KEGG:C00607
xref: PMID:11514091 {source="Europe PMC"}
xref: PMID:7538297 {source="Europe PMC"}
is_a: CHEBI:35722 ! sulfated glycosaminoglycan
is_a: CHEBI:37395 ! mucopolysaccharide
relationship: has_functional_parent CHEBI:16137 ! chondroitin D-glucuronate

[Term]
id: CHEBI:37527
name: acid
namespace: chebi_ontology
alt_id: CHEBI:13800
alt_id: CHEBI:13801
alt_id: CHEBI:22209
alt_id: CHEBI:2426
def: "An acid is a molecular entity capable of donating a hydron (Bronsted acid) or capable of forming a covalent bond with an electron pair (Lewis acid)." []
subset: 3_STAR
synonym: "Acid" EXACT [KEGG_COMPOUND]
synonym: "acid" EXACT IUPAC_NAME [IUPAC]
synonym: "acide" RELATED [IUPAC]
synonym: "acido" RELATED [ChEBI]
synonym: "acids" RELATED [ChEBI]
synonym: "Saeure" RELATED [ChEBI]
synonym: "Saeuren" RELATED [ChEBI]
xref: KEGG:C00174
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:37577
name: heteroatomic molecular entity
namespace: chebi_ontology
def: "A molecular entity consisting of two or more chemical elements." []
subset: 3_STAR
synonym: "chemical compound" RELATED [ChEBI]
synonym: "heteroatomic molecular entities" RELATED [ChEBI]
is_a: CHEBI:36357 ! polyatomic entity

[Term]
id: CHEBI:37622
name: carboxamide
namespace: chebi_ontology
alt_id: CHEBI:35354
alt_id: CHEBI:35355
def: "An amide of a carboxylic acid, having the structure RC(=O)NR2. The term is used as a suffix in systematic name formation to denote the -C(=O)NH2 group including its carbon atom." []
subset: 3_STAR
synonym: "carboxamides" EXACT IUPAC_NAME [IUPAC]
synonym: "carboxamides" RELATED [ChEBI]
synonym: "primary carboxamide" RELATED [ChEBI]
is_a: CHEBI:33256 ! primary amide
is_a: CHEBI:35352 ! organonitrogen compound
is_a: CHEBI:36963 ! organooxygen compound
relationship: has_part CHEBI:23004 ! carbamoyl group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CNOR3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "42.01680" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "41.99799" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C(=O)N([*])[*]" xsd:string

[Term]
id: CHEBI:37826
name: sulfuric acid derivative
namespace: chebi_ontology
subset: 3_STAR
synonym: "sulfuric acid derivative" EXACT [ChEBI]
synonym: "sulfuric acid derivatives" RELATED [ChEBI]
is_a: CHEBI:33424 ! sulfur oxoacid derivative
relationship: has_functional_parent CHEBI:26836 ! sulfuric acid

[Term]
id: CHEBI:37838
name: carboacyl group
namespace: chebi_ontology
def: "A carboacyl group is a group formed by loss of at least one OH from the carboxy group of a carboxylic acid." []
subset: 3_STAR
synonym: "carboacyl groups" EXACT IUPAC_NAME [IUPAC]
synonym: "carboxylic acyl group" EXACT IUPAC_NAME [IUPAC]
synonym: "carboxylic acyl groups" RELATED [IUPAC]
is_a: CHEBI:22221 ! acyl group
relationship: is_substituent_group_from CHEBI:33575 ! carboxylic acid

[Term]
id: CHEBI:37886
name: adrenergic agonist
namespace: chebi_ontology
def: "An agent that selectively binds to and activates adrenergic receptors." []
subset: 3_STAR
synonym: "adrenergic agonists" RELATED [ChEBI]
synonym: "adrenergic receptor agonist" RELATED [ChEBI]
synonym: "adrenoceptor agonists" RELATED [IUPHAR]
synonym: "adrenomimetic" RELATED [ChEBI]
synonym: "adrenomimetics" RELATED [ChEBI]
is_a: CHEBI:37962 ! adrenergic agent

[Term]
id: CHEBI:37962
name: adrenergic agent
namespace: chebi_ontology
def: "Any agent that acts on an adrenergic receptor or affects the life cycle of an adrenergic transmitter." []
subset: 3_STAR
synonym: "adrenergic agents" RELATED [ChEBI]
synonym: "adrenergic drug" RELATED [ChEBI]
synonym: "adrenergic drugs" RELATED [ChEBI]
synonym: "adrenergic neuron agents" RELATED [ChEBI]
synonym: "adrenergics" RELATED [ChEBI]
is_a: CHEBI:35942 ! neurotransmitter agent

[Term]
id: CHEBI:38077
name: polypyrrole
namespace: chebi_ontology
def: "A compound composed of two or more pyrrole units." []
subset: 3_STAR
synonym: "poly(pyrrole)s" RELATED [ChEBI]
synonym: "polypyrroles" RELATED [ChEBI]
synonym: "PPys" RELATED [ChEBI]
xref: Beilstein:8538310 {source="Beilstein"}
is_a: CHEBI:38101 ! organonitrogen heterocyclic compound

[Term]
id: CHEBI:38101
name: organonitrogen heterocyclic compound
namespace: chebi_ontology
def: "Any organonitrogen compound containing a cyclic component with nitrogen and at least one other element as ring member atoms." []
subset: 3_STAR
synonym: "heterocyclic organonitrogen compounds" RELATED [ChEBI]
synonym: "organonitrogen heterocyclic compounds" RELATED [ChEBI]
is_a: CHEBI:24532 ! organic heterocyclic compound
is_a: CHEBI:35352 ! organonitrogen compound

[Term]
id: CHEBI:38147
name: cardiotonic drug
namespace: chebi_ontology
def: "A drug that has a strengthening effect on the heart or that can increase cardiac output." []
subset: 3_STAR
synonym: "cardiotonic drugs" RELATED [ChEBI]
is_a: CHEBI:35554 ! cardiovascular drug

[Term]
id: CHEBI:38166
name: organic heteropolycyclic compound
namespace: chebi_ontology
alt_id: CHEBI:25429
alt_id: CHEBI:38075
subset: 3_STAR
synonym: "organic heteropolycyclic compounds" RELATED [ChEBI]
is_a: CHEBI:24532 ! organic heterocyclic compound
is_a: CHEBI:33671 ! heteropolycyclic compound

[Term]
id: CHEBI:38179
name: monocyclic heteroarene
namespace: chebi_ontology
subset: 3_STAR
synonym: "monocyclic heteroarenes" RELATED [ChEBI]
is_a: CHEBI:33833 ! heteroarene

[Term]
id: CHEBI:38180
name: polycyclic heteroarene
namespace: chebi_ontology
subset: 3_STAR
synonym: "polycyclic heteroarenes" RELATED [ChEBI]
is_a: CHEBI:33833 ! heteroarene

[Term]
id: CHEBI:38323
name: cholinergic drug
namespace: chebi_ontology
def: "Any drug used for its actions on cholinergic systems. Included here are agonists and antagonists, drugs that affect the life cycle of acetylcholine, and drugs that affect the survival of cholinergic neurons." []
subset: 3_STAR
synonym: "cholinergic agent" RELATED [ChEBI]
synonym: "cholinergic drugs" RELATED [ChEBI]
synonym: "cholinomimetic" RELATED [ChEBI]
is_a: CHEBI:35942 ! neurotransmitter agent

[Term]
id: CHEBI:38324
name: cholinergic agonist
namespace: chebi_ontology
def: "Any drug that binds to and activates cholinergic receptors." []
subset: 3_STAR
synonym: "acetylcholine agonist" RELATED [ChEBI]
synonym: "acetylcholine agonists" RELATED [ChEBI]
synonym: "acetylcholine receptor agonist" RELATED [IUPHAR]
synonym: "cholinergic agonists" RELATED [ChEBI]
synonym: "cholinomimetic" RELATED [ChEBI]
synonym: "cholinomimetics" RELATED [ChEBI]
is_a: CHEBI:38323 ! cholinergic drug

[Term]
id: CHEBI:38325
name: muscarinic agonist
namespace: chebi_ontology
def: "Any drug that binds to and activates a muscarinic cholinergic receptor." []
subset: 3_STAR
synonym: "muscarinic acetylcholine receptor agonist" RELATED [ChEBI]
synonym: "muscarinic agonists" RELATED [ChEBI]
synonym: "muscarinic cholinergic agonist" RELATED [ChEBI]
synonym: "muscarinic cholinergic agonists" RELATED [ChEBI]
is_a: CHEBI:38324 ! cholinergic agonist

[Term]
id: CHEBI:38560
name: simple protein
namespace: chebi_ontology
subset: 3_STAR
synonym: "simple proteins" RELATED [ChEBI]
is_a: CHEBI:36080 ! protein
is_a: PR:000000001 ! protein

[Term]
id: CHEBI:38631
name: aminoalkylindole
namespace: chebi_ontology
alt_id: CHEBI:22503
alt_id: CHEBI:24792
subset: 3_STAR
synonym: "aminoalkylindoles" RELATED [ChEBI]
is_a: CHEBI:24828 ! indoles

[Term]
id: CHEBI:38700
name: organic sodium salt
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic sodium salt" EXACT [ChEBI]
synonym: "organic sodium salts" RELATED [ChEBI]
is_a: CHEBI:24868 ! organic salt
is_a: CHEBI:26714 ! sodium salt

[Term]
id: CHEBI:38716
name: carboxylic acid dianion
namespace: chebi_ontology
def: "Any dianion containing at least one carboxy group." []
subset: 3_STAR
synonym: "carboxylic acid dianion" EXACT [ChEBI]
synonym: "carboxylic acid dianions" RELATED [ChEBI]
is_a: CHEBI:29067 ! carboxylic acid anion

[Term]
id: CHEBI:3892
name: corticotropin
namespace: chebi_ontology
def: "A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency." []
subset: 3_STAR
synonym: "ACTH" RELATED [KEGG_COMPOUND]
synonym: "Adrenocorticotropic hormone" RELATED [KEGG_COMPOUND]
synonym: "adrenocorticotropin" RELATED [ChemIDplus]
synonym: "corticotrofina" RELATED INN [ChemIDplus]
synonym: "corticotrophine" RELATED INN [ChemIDplus]
synonym: "corticotrophinum" RELATED INN [ChemIDplus]
synonym: "Corticotropin" EXACT [KEGG_COMPOUND]
synonym: "corticotropin" RELATED INN [ChemIDplus]
synonym: "cortrophin" RELATED [ChemIDplus]
synonym: "L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-alpha-aspartylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine" EXACT IUPAC_NAME [IUPAC]
synonym: "SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF" RELATED [DrugBank]
xref: CAS:9002-60-2 {source="ChemIDplus"}
xref: CAS:9002-60-2 {source="KEGG COMPOUND"}
xref: Drug_Central:4931 {source="DrugCentral"}
xref: DrugBank:DB01285
xref: KEGG:C02017
xref: KEGG:D00146
is_a: CHEBI:15841 ! polypeptide
is_a: CHEBI:25905 ! peptide hormone
is_a: CHEBI:33694 ! biomacromolecule
relationship: RO:0000087 CHEBI:33295 ! has role diagnostic agent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C207H308N56O58S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C207H308N56O58S/c1-108(2)89-140(186(302)240-135(69-74-163(279)280)182(298)254-149(204(320)321)94-117-43-20-15-21-44-117)250-193(309)152-54-35-86-262(152)202(318)147(92-116-41-18-14-19-42-116)252-171(287)114(11)230-175(291)132(66-71-160(273)274)234-170(286)113(10)231-191(307)150(105-265)255-183(299)136(70-75-164(281)282)241-190(306)146(98-165(283)284)249-180(296)133(67-72-161(275)276)235-169(285)112(9)229-157(270)101-225-174(290)145(97-156(213)269)251-194(310)153-55-36-87-263(153)203(319)148(93-119-60-64-123(268)65-61-119)253-199(315)167(110(5)6)257-185(301)129(49-26-30-79-210)243-198(314)168(111(7)8)259-196(312)155-57-38-85-261(155)201(317)139(53-34-83-223-207(218)219)244-178(294)130(51-32-81-221-205(214)215)237-177(293)128(48-25-29-78-209)236-176(292)127(47-24-28-77-208)232-158(271)103-227-197(313)166(109(3)4)258-195(311)154-56-37-84-260(154)200(316)138(50-27-31-80-211)233-159(272)102-226-173(289)143(95-120-99-224-126-46-23-22-45-124(120)126)247-179(295)131(52-33-82-222-206(216)217)238-187(303)142(90-115-39-16-13-17-40-115)246-189(305)144(96-121-100-220-107-228-121)248-181(297)134(68-73-162(277)278)239-184(300)137(76-88-322-12)242-192(308)151(106-266)256-188(304)141(245-172(288)125(212)104-264)91-118-58-62-122(267)63-59-118/h13-23,39-46,58-65,99-100,107-114,125,127-155,166-168,224,264-268H,24-38,47-57,66-98,101-106,208-212H2,1-12H3,(H2,213,269)(H,220,228)(H,225,290)(H,226,289)(H,227,313)(H,229,270)(H,230,291)(H,231,307)(H,232,271)(H,233,272)(H,234,286)(H,235,285)(H,236,292)(H,237,293)(H,238,303)(H,239,300)(H,240,302)(H,241,306)(H,242,308)(H,243,314)(H,244,294)(H,245,288)(H,246,305)(H,247,295)(H,248,297)(H,249,296)(H,250,309)(H,251,310)(H,252,287)(H,253,315)(H,254,298)(H,255,299)(H,256,304)(H,257,301)(H,258,311)(H,259,312)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,320,321)(H4,214,215,221)(H4,216,217,222)(H4,218,219,223)/t112-,113-,114-,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,166-,167-,168-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "IDLFZVILOHSSID-OVLDLUHVSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "4541.06600" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "4538.25937" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(O)=O" xsd:string

[Term]
id: CHEBI:38958
name: indole alkaloid
namespace: chebi_ontology
alt_id: CHEBI:24795
alt_id: CHEBI:5901
def: "An alkaloid containing an indole skeleton." []
subset: 3_STAR
synonym: "Indole alkaloid" EXACT [KEGG_COMPOUND]
synonym: "indole alkaloids" RELATED [ChEBI]
xref: KEGG:C06073
xref: Wikipedia:Indole_alkaloid
is_a: CHEBI:22315 ! alkaloid
relationship: has_part CHEBI:73398 ! indole skeleton

[Term]
id: CHEBI:39015
name: apolipoprotein
namespace: chebi_ontology
def: "Protein component on the surface of lipoprotein." []
subset: 3_STAR
synonym: "apolipoproteins" RELATED [ChEBI]
is_a: CHEBI:13850 ! apoprotein

[Term]
id: CHEBI:39022
name: inclusion compound
namespace: chebi_ontology
def: "A complex in which one component (the host) forms a cavity or, in the case of a crystal, a crystal lattice containing spaces in the shape of long tunnels or channels in which molecular entities of a second chemical species (the guest) are located. There is no covalent bonding between guest and host, the attraction being generally due to van der Waals forces." []
subset: 3_STAR
synonym: "compose d'inclusion" RELATED [IUPAC]
synonym: "compuesto de inclusion" RELATED [IUPAC]
synonym: "compuestos de inclusion" RELATED [IUPAC]
synonym: "inclusion complex" RELATED [IUPAC]
synonym: "inclusion compound" EXACT IUPAC_NAME [IUPAC]
synonym: "inclusion compounds" RELATED [ChEBI]
is_a: CHEBI:50967 ! non-covalently-bound molecular entity

[Term]
id: CHEBI:39024
name: clathrate compound
namespace: chebi_ontology
def: "Inclusion compound in which the guest molecule is in a cage formed by the host molecule or by a lattice of host molecules." []
subset: 3_STAR
synonym: "cage compound" RELATED [IUPAC]
synonym: "Clathrat" RELATED [ChEBI]
synonym: "clathrate" RELATED [IUPAC]
synonym: "clathrate compounds" RELATED [ChEBI]
synonym: "clathrates" EXACT IUPAC_NAME [IUPAC]
synonym: "Clathratverbindung" RELATED [ChEBI]
synonym: "clatrato" RELATED [IUPAC]
synonym: "clatratos" RELATED [IUPAC]
synonym: "compuesto de clatrato" RELATED [ChEBI]
synonym: "Klathrat" RELATED [ChEBI]
synonym: "Klathratverbindung" RELATED [ChEBI]
is_a: CHEBI:39022 ! inclusion compound

[Term]
id: CHEBI:39123
name: calcium cation
namespace: chebi_ontology
subset: 3_STAR
synonym: "calcium cation" EXACT [ChEBI]
synonym: "calcium cations" RELATED [ChEBI]
is_a: CHEBI:33513 ! alkaline earth cation
is_a: CHEBI:39124 ! calcium ion
property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "40.078" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string

[Term]
id: CHEBI:39124
name: calcium ion
namespace: chebi_ontology
subset: 3_STAR
synonym: "calcium ion" EXACT [ChEBI]
synonym: "calcium ions" RELATED [ChEBI]
is_a: CHEBI:25213 ! metal cation
is_a: CHEBI:35155 ! elemental calcium
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "40.078" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string

[Term]
id: CHEBI:39141
name: Bronsted acid
namespace: chebi_ontology
def: "A molecular entity capable of donating a hydron to an acceptor (Bronsted base)." []
subset: 3_STAR
synonym: "acide de Bronsted" RELATED [IUPAC]
synonym: "Bronsted acid" EXACT IUPAC_NAME [IUPAC]
synonym: "Bronsted-Saeure" RELATED [ChEBI]
synonym: "donneur d'hydron" RELATED [IUPAC]
synonym: "hydron donor" RELATED [IUPAC]
is_a: CHEBI:17891 ! donor
is_a: CHEBI:37527 ! acid

[Term]
id: CHEBI:39142
name: Bronsted base
namespace: chebi_ontology
def: "A molecular entity capable of accepting a hydron from a donor (Bronsted acid)." []
subset: 3_STAR
synonym: "accepteur d'hydron" RELATED [IUPAC]
synonym: "base de Bronsted" RELATED [IUPAC]
synonym: "Bronsted base" EXACT IUPAC_NAME [IUPAC]
synonym: "Bronsted-Base" RELATED [ChEBI]
synonym: "hydron acceptor" RELATED [IUPAC]
is_a: CHEBI:15339 ! acceptor
is_a: CHEBI:22695 ! base

[Term]
id: CHEBI:39144
name: Lewis base
namespace: chebi_ontology
def: "A molecular entity able to provide a pair of electrons and thus capable of forming a covalent bond with an electron-pair acceptor (Lewis acid), thereby producing a Lewis adduct." []
subset: 3_STAR
synonym: "base de Lewis" RELATED [IUPAC]
synonym: "donneur d'une paire d'electrons" RELATED [ChEBI]
synonym: "electron donor" RELATED [ChEBI]
synonym: "Lewis base" EXACT IUPAC_NAME [IUPAC]
synonym: "Lewis-Base" RELATED [ChEBI]
is_a: CHEBI:17891 ! donor
is_a: CHEBI:22695 ! base

[Term]
id: CHEBI:39418
name: straight-chain saturated fatty acid
namespace: chebi_ontology
def: "Any saturated fatty acid lacking a side-chain." []
subset: 3_STAR
synonym: "straight-chain saturated fatty acid" EXACT [ChEBI]
synonym: "straight-chain saturated fatty acids" RELATED [ChEBI]
xref: PMID:15644336 {source="Europe PMC"}
is_a: CHEBI:26607 ! saturated fatty acid
is_a: CHEBI:59202 ! straight-chain fatty acid
relationship: is_conjugate_acid_of CHEBI:58954 ! straight-chain saturated fatty acid anion

[Term]
id: CHEBI:39745
name: dihydrogenphosphate
namespace: chebi_ontology
alt_id: CHEBI:29137
alt_id: CHEBI:39739
def: "A monovalent inorganic anion that consists of phosphoric acid in which one of the three OH groups has been deprotonated." []
subset: 3_STAR
synonym: "[PO2(OH)2](-)" RELATED [IUPAC]
synonym: "dihydrogen(tetraoxidophosphate)(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "dihydrogenphosphate" EXACT IUPAC_NAME [IUPAC]
synonym: "DIHYDROGENPHOSPHATE ION" RELATED [PDBeChem]
synonym: "dihydrogentetraoxophosphate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "dihydrogentetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC]
synonym: "dihydroxidodioxidophosphate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "H2PO4(-)" RELATED [IUPAC]
xref: DrugBank:DB02831
xref: Gmelin:1999 {source="Gmelin"}
xref: PDBeChem:2HP
is_a: CHEBI:35780 ! phosphate ion
is_a: CHEBI:79389 ! monovalent inorganic anion
relationship: is_conjugate_acid_of CHEBI:43474 ! hydrogenphosphate
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O4P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "96.98724" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "96.96962" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OP([O-])(=O)O[H]" xsd:string

[Term]
id: CHEBI:3992
name: cyclic ketone
namespace: chebi_ontology
subset: 3_STAR
synonym: "Cyclic ketone" EXACT [KEGG_COMPOUND]
synonym: "cyclic ketones" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C02019
is_a: CHEBI:17087 ! ketone

[Term]
id: CHEBI:41609
name: carbonate
namespace: chebi_ontology
alt_id: CHEBI:29201
alt_id: CHEBI:41605
subset: 3_STAR
synonym: "[CO3](2-)" RELATED [IUPAC]
synonym: "carbonate" EXACT [IUPAC]
synonym: "CARBONATE ION" RELATED [PDBeChem]
synonym: "CO3(2-)" RELATED [ChEBI]
synonym: "Karbonat" RELATED [ChEBI]
synonym: "trioxidocarbonate(2-)" EXACT IUPAC_NAME [IUPAC]
xref: Beilstein:3600898 {source="Beilstein"}
xref: CAS:3812-32-6 {source="ChemIDplus"}
xref: Gmelin:1559 {source="Gmelin"}
xref: PDBeChem:CO3
is_a: CHEBI:35604 ! carbon oxoanion
relationship: is_conjugate_base_of CHEBI:17544 ! hydrogencarbonate
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-L" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "60.00890" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.98584" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([O-])=O" xsd:string

[Term]
id: CHEBI:42485
name: formyl group
namespace: chebi_ontology
alt_id: CHEBI:24089
alt_id: CHEBI:42480
subset: 3_STAR
synonym: "-CH(O)" RELATED [IUPAC]
synonym: "-CHO" RELATED [IUPAC]
synonym: "aldehyde group" EXACT IUPAC_NAME [IUPAC]
synonym: "carbaldehyde" EXACT IUPAC_NAME [IUPAC]
synonym: "Fo" RELATED [CBN]
synonym: "formyl" EXACT IUPAC_NAME [IUPAC]
synonym: "FORMYL GROUP" EXACT [PDBeChem]
synonym: "H-CO-" RELATED [IUPAC]
synonym: "methanoyl" RELATED [IUPAC]
xref: PDBeChem:FOR
is_a: CHEBI:27207 ! univalent carboacyl group
relationship: is_substituent_group_from CHEBI:30751 ! formic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "29.01804" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.00274" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C(*)=O" xsd:string

[Term]
id: CHEBI:43176
name: hydroxy group
namespace: chebi_ontology
alt_id: CHEBI:24706
alt_id: CHEBI:43171
subset: 3_STAR
synonym: "-OH" RELATED [IUPAC]
synonym: "hydroxy" EXACT IUPAC_NAME [IUPAC]
synonym: "HYDROXY GROUP" EXACT [PDBeChem]
synonym: "hydroxy group" EXACT [UniProt]
synonym: "hydroxyl" RELATED [ChEBI]
synonym: "hydroxyl group" RELATED [ChEBI]
xref: PDBeChem:OH
is_a: CHEBI:33246 ! inorganic group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HO" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "17.00734" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00274" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*O[H]" xsd:string

[Term]
id: CHEBI:43474
name: hydrogenphosphate
namespace: chebi_ontology
alt_id: CHEBI:29139
alt_id: CHEBI:43470
def: "A phosphate ion that is the conjugate base of dihydrogenphosphate." []
subset: 3_STAR
synonym: "[P(OH)O3](2-)" RELATED [MolBase]
synonym: "[PO3(OH)](2-)" RELATED [IUPAC]
synonym: "HPO4(2-)" RELATED [IUPAC]
synonym: "hydrogen phosphate" RELATED [ChEBI]
synonym: "hydrogen(tetraoxidophosphate)(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogenphosphate" EXACT IUPAC_NAME [IUPAC]
synonym: "HYDROGENPHOSPHATE ION" RELATED [PDBeChem]
synonym: "hydrogentetraoxophosphate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogentetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydroxidotrioxidophosphate(2-)" EXACT IUPAC_NAME [IUPAC]
synonym: "INORGANIC PHOSPHATE GROUP" RELATED [PDBeChem]
synonym: "phosphate" RELATED [UniProt]
xref: Gmelin:1998 {source="Gmelin"}
xref: MolBase:1628
xref: PDBeChem:PI
xref: PDBeChem:PO4
is_a: CHEBI:35780 ! phosphate ion
is_a: CHEBI:79388 ! divalent inorganic anion
relationship: is_conjugate_acid_of CHEBI:18367 ! phosphate(3-)
relationship: is_conjugate_base_of CHEBI:39745 ! dihydrogenphosphate
relationship: RO:0000087 CHEBI:23357 ! has role cofactor
relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HO4P" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-L" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "95.97930" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.96234" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "OP([O-])([O-])=O" xsd:string

[Term]
id: CHEBI:45696
name: hydrogensulfate
namespace: chebi_ontology
alt_id: CHEBI:29199
alt_id: CHEBI:45693
subset: 3_STAR
synonym: "[SO3(OH)](-)" RELATED [IUPAC]
synonym: "HSO4(-)" RELATED [IUPAC]
synonym: "HYDROGEN SULFATE" RELATED [PDBeChem]
synonym: "hydrogen(tetraoxidosulfate)(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogensulfate" EXACT [IUPAC]
synonym: "hydrogensulfate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogentetraoxosulfate(1-)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogentetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC]
synonym: "hydroxidotrioxidosulfate(1-)" EXACT IUPAC_NAME [IUPAC]
xref: Gmelin:2121 {source="Gmelin"}
is_a: CHEBI:33482 ! sulfur oxoanion
relationship: is_conjugate_acid_of CHEBI:16189 ! sulfate
relationship: is_conjugate_base_of CHEBI:26836 ! sulfuric acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "HO4S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-M" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "97.07154" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "96.96010" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OS([O-])(=O)=O" xsd:string

[Term]
id: CHEBI:46629
name: oxo group
namespace: chebi_ontology
alt_id: CHEBI:29353
alt_id: CHEBI:44607
subset: 3_STAR
synonym: "=O" RELATED [IUPAC]
synonym: "oxo" EXACT IUPAC_NAME [IUPAC]
synonym: "OXO GROUP" EXACT [PDBeChem]
xref: PDBeChem:O
is_a: CHEBI:33246 ! inorganic group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "15.99940" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.99491" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=*" xsd:string

[Term]
id: CHEBI:46662
name: mineral
namespace: chebi_ontology
def: "In general, a mineral is a chemical substance that is normally crystalline formed and has been formed as a result of geological processes. The term also includes metamict substances (naturally occurring, formerly crystalline substances whose crystallinity has been destroyed by ionising radiation) and can include naturally occurring amorphous substances that have never been crystalline ('mineraloids') such as georgite and calciouranoite as well as substances formed by the action of geological processes on bigenic compounds ('biogenic minerals')." []
subset: 3_STAR
synonym: "mineral" EXACT [ChEBI]
synonym: "Minerale" RELATED [ChEBI]
synonym: "minerales" RELATED [ChEBI]
synonym: "minerals" RELATED [ChEBI]
synonym: "mineraux" RELATED [ChEBI]
xref: Wikipedia:Mineral
is_a: CHEBI:59999 ! chemical substance

[Term]
id: CHEBI:46723
name: phosphate mineral
namespace: chebi_ontology
subset: 3_STAR
synonym: "phosphate minerals" RELATED [ChEBI]
is_a: CHEBI:46662 ! mineral

[Term]
id: CHEBI:46787
name: solvent
namespace: chebi_ontology
def: "A liquid that can dissolve other substances (solutes) without any change in their chemical composition." []
subset: 3_STAR
synonym: "Loesungsmittel" RELATED [ChEBI]
synonym: "solvant" RELATED [ChEBI]
synonym: "solvents" RELATED [ChEBI]
xref: Wikipedia:Solvent
is_a: CHEBI:33232 ! application
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:46883
name: carboxy group
namespace: chebi_ontology
alt_id: CHEBI:23025
alt_id: CHEBI:41420
subset: 3_STAR
synonym: "-C(O)OH" RELATED [IUPAC]
synonym: "-CO2H" RELATED [ChEBI]
synonym: "-COOH" RELATED [IUPAC]
synonym: "carboxy" EXACT IUPAC_NAME [IUPAC]
synonym: "CARBOXY GROUP" EXACT [PDBeChem]
synonym: "carboxyl group" RELATED [ChEBI]
xref: PDBeChem:FMT
is_a: CHEBI:33249 ! organyl group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01744" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(=O)O" xsd:string

[Term]
id: CHEBI:47622
name: acetate ester
namespace: chebi_ontology
alt_id: CHEBI:13244
alt_id: CHEBI:13799
alt_id: CHEBI:22189
alt_id: CHEBI:2406
def: "Any carboxylic ester where the carboxylic acid component is acetic acid." []
subset: 3_STAR
synonym: "acetate" RELATED [ChEBI]
synonym: "acetate esters" RELATED [ChEBI]
synonym: "acetates" RELATED [ChEBI]
synonym: "Acetic ester" RELATED [KEGG_COMPOUND]
synonym: "Acetyl ester" RELATED [KEGG_COMPOUND]
synonym: "acetyl esters" RELATED [ChEBI]
synonym: "an acetyl ester" RELATED [UniProt]
xref: KEGG:C01883
xref: Wikipedia:Acetate#Esters
is_a: CHEBI:33308 ! carboxylic ester
relationship: has_functional_parent CHEBI:15366 ! acetic acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "59.04400" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01330" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(=O)O[*]" xsd:string

[Term]
id: CHEBI:47788
name: 3-oxo steroid
namespace: chebi_ontology
alt_id: CHEBI:13607
alt_id: CHEBI:1653
alt_id: CHEBI:20182
alt_id: CHEBI:71186
def: "Any oxo steroid where an oxo substituent is located at position 3." []
subset: 3_STAR
synonym: "3-oxo steroids" RELATED [ChEBI]
synonym: "3-Oxosteroid" RELATED [KEGG_COMPOUND]
synonym: "3-oxosteroids" RELATED [ChEBI]
synonym: "a 3-oxosteroid" RELATED [UniProt]
xref: KEGG:C01876
xref: MetaCyc:3-Oxosteroids
xref: PMID:9811880 {source="SUBMITTER"}
is_a: CHEBI:35789 ! oxo steroid
is_a: CHEBI:3992 ! cyclic ketone
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H29OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "273.434" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "273.22184" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCC(C4)=O)C" xsd:string

[Term]
id: CHEBI:47891
name: steroid acid
namespace: chebi_ontology
def: "Any steroid substituted by at least one carboxy group." []
subset: 3_STAR
synonym: "steroid acids" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid
is_a: CHEBI:64709 ! organic acid
relationship: is_conjugate_acid_of CHEBI:50160 ! steroid acid anion

[Term]
id: CHEBI:47909
name: 3-oxo-Delta(4) steroid
namespace: chebi_ontology
alt_id: CHEBI:13604
alt_id: CHEBI:1626
alt_id: CHEBI:20157
def: "A 3-oxo steroid conjugated to a C=C double bond at the alpha,beta position." []
subset: 3_STAR
synonym: "3-oxo Delta(4)-steroid" RELATED [ChEBI]
synonym: "3-oxo Delta(4)-steroids" RELATED [ChEBI]
synonym: "3-oxo-Delta(4) steroids" RELATED [ChEBI]
synonym: "3-Oxo-delta4-steroid" RELATED [KEGG_COMPOUND]
synonym: "a 3-oxo-Delta(4)-steroid" RELATED [UniProt]
xref: KEGG:C00619
xref: MetaCyc:3-Oxo-Delta-4-Steroids
is_a: CHEBI:47788 ! 3-oxo steroid
is_a: CHEBI:51689 ! enone
relationship: has_part CHEBI:136849 ! 3-oxo-Delta(4)-steroid group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H27OR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "271.418" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "271.20619" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC=4C2(CCC(C4)=O)C" xsd:string

[Term]
id: CHEBI:48154
name: sulfur oxide
namespace: chebi_ontology
subset: 3_STAR
synonym: "oxides of sulfur" RELATED [ChEBI]
synonym: "Schwefeloxide" RELATED [ChEBI]
synonym: "sulfur oxides" RELATED [ChEBI]
is_a: CHEBI:24836 ! inorganic oxide
is_a: CHEBI:26835 ! sulfur molecular entity

[Term]
id: CHEBI:48354
name: polar solvent
namespace: chebi_ontology
def: "A solvent that is composed of polar molecules. Polar solvents can dissolve ionic compounds or ionisable covalent compounds." []
subset: 3_STAR
synonym: "polar solvent" EXACT IUPAC_NAME [IUPAC]
synonym: "polar solvents" RELATED [ChEBI]
is_a: CHEBI:46787 ! solvent

[Term]
id: CHEBI:48356
name: protic solvent
namespace: chebi_ontology
def: "A polar solvent that is capable of acting as a hydron (proton) donor." []
subset: 3_STAR
synonym: "protogenic solvent" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:39141 ! Bronsted acid
is_a: CHEBI:48354 ! polar solvent

[Term]
id: CHEBI:48359
name: protophilic solvent
namespace: chebi_ontology
def: "Solvent that is capable of acting as a hydron (proton) acceptor." []
subset: 3_STAR
synonym: "HBA solvent" RELATED [ChEBI]
synonym: "hydrogen bond acceptor solvent" RELATED [ChEBI]
synonym: "protophilic solvent" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:39142 ! Bronsted base
is_a: CHEBI:48354 ! polar solvent

[Term]
id: CHEBI:48360
name: amphiprotic solvent
namespace: chebi_ontology
def: "Self-ionizing solvent possessing both characteristics of Bronsted acids and bases." []
subset: 3_STAR
synonym: "amphiprotic solvent" EXACT IUPAC_NAME [IUPAC]
is_a: CHEBI:48356 ! protic solvent
is_a: CHEBI:48359 ! protophilic solvent

[Term]
id: CHEBI:48540
name: beta-adrenergic drug
namespace: chebi_ontology
def: "Any of the drugs that act on beta-adrenergic receptors." []
subset: 3_STAR
synonym: "beta-adrenergic drugs" RELATED [ChEBI]
is_a: CHEBI:37962 ! adrenergic agent

[Term]
id: CHEBI:48560
name: dopaminergic agent
namespace: chebi_ontology
def: "A drug used for its effects on dopamine receptors, on the life cycle of dopamine, or on the survival of dopaminergic neurons." []
subset: 3_STAR
synonym: "dopamine agent" RELATED [ChEBI]
synonym: "dopamine agents" RELATED [ChEBI]
synonym: "dopamine drug" RELATED [ChEBI]
synonym: "dopamine drugs" RELATED [ChEBI]
synonym: "dopaminergic agents" RELATED [ChEBI]
is_a: CHEBI:35942 ! neurotransmitter agent

[Term]
id: CHEBI:48578
name: radical scavenger
namespace: chebi_ontology
def: "A role played by a substance that can react readily with, and thereby eliminate, radicals." []
subset: 3_STAR
synonym: "free radical scavengers" RELATED [ChEBI]
synonym: "free-radical scavenger" RELATED [ChEBI]
is_a: CHEBI:22586 ! antioxidant

[Term]
id: CHEBI:48705
name: agonist
namespace: chebi_ontology
def: "Substance which binds to cell receptors normally responding to naturally occurring substances and which produces a response of its own." []
subset: 3_STAR
synonym: "agonist" EXACT IUPAC_NAME [IUPAC]
synonym: "agonista" RELATED [ChEBI]
synonym: "agoniste" RELATED [ChEBI]
synonym: "agonists" RELATED [ChEBI]
is_a: CHEBI:52210 ! pharmacological role

[Term]
id: CHEBI:49323
name: contraceptive drug
namespace: chebi_ontology
def: "A chemical substance that prevents or reduces the probability of conception." []
subset: 3_STAR
synonym: "contraceptive agent" RELATED [ChEBI]
synonym: "contraceptive drugs" RELATED [ChEBI]
is_a: CHEBI:50689 ! reproductive control drug

[Term]
id: CHEBI:49637
name: hydrogen atom
namespace: chebi_ontology
alt_id: CHEBI:24634
alt_id: CHEBI:49636
subset: 3_STAR
synonym: "1H" RELATED [IUPAC]
synonym: "H" RELATED [IUPAC]
synonym: "hidrogeno" RELATED [ChEBI]
synonym: "hydrogen" EXACT IUPAC_NAME [IUPAC]
synonym: "hydrogen" RELATED [ChEBI]
synonym: "hydrogene" RELATED [ChEBI]
synonym: "Wasserstoff" RELATED [ChEBI]
xref: WebElements:H
is_a: CHEBI:24835 ! inorganic molecular entity
is_a: CHEBI:25585 ! nonmetal atom
is_a: CHEBI:33559 ! s-block element atom
relationship: RO:0000087 CHEBI:33937 ! has role macronutrient
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YZCKVEUIGOORGS-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "1.00794" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1.00783" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]" xsd:string

[Term]
id: CHEBI:50047
name: organic amino compound
namespace: chebi_ontology
def: "A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by organyl groups." []
subset: 3_STAR
synonym: "organic amino compounds" RELATED [ChEBI]
is_a: CHEBI:35352 ! organonitrogen compound
relationship: has_parent_hydride CHEBI:16134 ! ammonia
relationship: RO:0000087 CHEBI:39142 ! has role Bronsted base

[Term]
id: CHEBI:50103
name: excitatory amino acid agonist
namespace: chebi_ontology
def: "An agent that binds to and activates excitatory amino acid receptors." []
subset: 3_STAR
synonym: "excitatory amino acid agonists" RELATED [ChEBI]
synonym: "excitatory amino acid receptor agonist" RELATED [ChEBI]
synonym: "excitatory amino acid receptor agonists" RELATED [ChEBI]
is_a: CHEBI:35942 ! neurotransmitter agent

[Term]
id: CHEBI:50112
name: sex hormone
namespace: chebi_ontology
def: "Any hormone that is responsible for controlling sexual characteristics and reproductive function." []
subset: 3_STAR
synonym: "Geschlechtshormon" RELATED [ChEBI]
synonym: "Geschlechtshormone" RELATED [ChEBI]
synonym: "hormone sexuelle" RELATED [ChEBI]
synonym: "hormones sexuelles" RELATED [ChEBI]
synonym: "sex hormones" RELATED [ChEBI]
synonym: "Sexualhormon" RELATED [ChEBI]
synonym: "Sexualhormone" RELATED [ChEBI]
is_a: CHEBI:24621 ! hormone

[Term]
id: CHEBI:50113
name: androgen
namespace: chebi_ontology
def: "A sex hormone that stimulates or controls the development and maintenance of masculine characteristics in vertebrates by binding to androgen receptors." []
subset: 3_STAR
synonym: "Androgen" EXACT [ChEBI]
synonym: "Androgene" RELATED [ChEBI]
synonym: "androgene" RELATED [ChEBI]
synonym: "androgenes" RELATED [ChEBI]
synonym: "androgeno" RELATED [ChEBI]
synonym: "androgenos" RELATED [ChEBI]
synonym: "androgens" RELATED [ChEBI]
is_a: CHEBI:50112 ! sex hormone

[Term]
id: CHEBI:50114
name: estrogen
namespace: chebi_ontology
def: "A hormone that stimulates or controls the development and maintenance of female sex characteristics in mammals by binding to oestrogen receptors. The oestrogens are named for their importance in the oestrous cycle. The oestrogens that occur naturally in the body, notably estrone, estradiol, estriol, and estetrol are steroids. Other compounds with oestrogenic activity are produced by plants (phytoestrogens) and fungi (mycoestrogens); synthetic compounds with oestrogenic activity are known as xenoestrogens." []
subset: 3_STAR
synonym: "Estrogene" RELATED [ChEBI]
synonym: "estrogene" RELATED [ChEBI]
synonym: "estrogenes" RELATED [ChEBI]
synonym: "estrogenes Hormon" RELATED [ChEBI]
synonym: "estrogeno" RELATED [ChEBI]
synonym: "estrogenos" RELATED [ChEBI]
synonym: "estrogens" RELATED [ChEBI]
synonym: "Oestrogen" RELATED [ChEBI]
synonym: "oestrogen" RELATED [ChEBI]
synonym: "Oestrogene" RELATED [ChEBI]
synonym: "oestrogene" RELATED [ChEBI]
synonym: "oestrogenes" RELATED [ChEBI]
synonym: "oestrogens" RELATED [ChEBI]
xref: Wikipedia:Estrogen
is_a: CHEBI:50112 ! sex hormone

[Term]
id: CHEBI:50160
name: steroid acid anion
namespace: chebi_ontology
def: "Any anion formed by loss of a proton from a steroid acid." []
subset: 3_STAR
synonym: "steroid acid anions" RELATED [ChEBI]
is_a: CHEBI:18059 ! lipid
is_a: CHEBI:29067 ! carboxylic acid anion
relationship: is_conjugate_base_of CHEBI:47891 ! steroid acid

[Term]
id: CHEBI:50267
name: protective agent
namespace: chebi_ontology
def: "Synthetic or natural substance which is given to prevent a disease or disorder or are used in the process of treating a disease or injury due to a poisonous agent." []
subset: 3_STAR
synonym: "chemoprotectant" RELATED [ChEBI]
synonym: "chemoprotectants" RELATED [ChEBI]
synonym: "chemoprotective agent" RELATED [ChEBI]
synonym: "chemoprotective agents" RELATED [ChEBI]
synonym: "protective agents" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:50297
name: canonical nucleotide residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical nucleotide residues" RELATED [ChEBI]
is_a: CHEBI:50319 ! nucleotide residue

[Term]
id: CHEBI:50298
name: canonical deoxyribonucleotide residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical deoxyribonucleotide residues" RELATED [ChEBI]
is_a: CHEBI:50297 ! canonical nucleotide residue

[Term]
id: CHEBI:50299
name: canonical ribonucleotide residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "canonical ribonucleotide residues" RELATED [ChEBI]
is_a: CHEBI:50297 ! canonical nucleotide residue

[Term]
id: CHEBI:50312
name: onium compound
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:37577 ! heteroatomic molecular entity

[Term]
id: CHEBI:50313
name: onium cation
namespace: chebi_ontology
def: "Mononuclear cations derived by addition of a hydron to a mononuclear parent hydride of the pnictogen, chalcogen and halogen families." []
subset: 3_STAR
synonym: "onium cations" EXACT IUPAC_NAME [IUPAC]
synonym: "onium cations" RELATED [ChEBI]
synonym: "onium ion" RELATED [ChEBI]
synonym: "onium ions" RELATED [ChEBI]
is_a: CHEBI:50312 ! onium compound

[Term]
id: CHEBI:50319
name: nucleotide residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "nucleotide residues" RELATED [ChEBI]
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:50320
name: nucleoside residue
namespace: chebi_ontology
subset: 3_STAR
synonym: "nucleoside residues" RELATED [ChEBI]
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:50325
name: proteinogenic amino-acid side-chain group
namespace: chebi_ontology
def: "A univalent organyl group obtained by cleaving the bond from C-2 to the side chain of a proteinogenic amino-acid." []
subset: 3_STAR
synonym: "canonical amino-acid side-chain" RELATED [ChEBI]
synonym: "canonical amino-acid side-chains" RELATED [ChEBI]
synonym: "proteinogenic amino-acid side-chain" RELATED [ChEBI]
synonym: "proteinogenic amino-acid side-chain groups" RELATED [ChEBI]
synonym: "proteinogenic amino-acid side-chains" RELATED [ChEBI]
is_a: CHEBI:33249 ! organyl group

[Term]
id: CHEBI:50329
name: 2-carboxyethyl group
namespace: chebi_ontology
subset: 3_STAR
synonym: "2-carboxyethyl" EXACT IUPAC_NAME [IUPAC]
synonym: "glutamic acid side-chain" RELATED [ChEBI]
is_a: CHEBI:50325 ! proteinogenic amino-acid side-chain group
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C3H5O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "73.07060" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "73.02895" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(CC(=O)O)*" xsd:string

[Term]
id: CHEBI:50402
name: androstanoid
namespace: chebi_ontology
def: "Any steroid based on an  androstane skeleton and its derivatives." []
subset: 3_STAR
synonym: "androstanoids" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid
relationship: has_parent_hydride CHEBI:35509 ! androstane

[Term]
id: CHEBI:50646
name: bone density conservation agent
namespace: chebi_ontology
alt_id: CHEBI:72497
def: "An agent that inhibits bone resorption and/or favor bone mineralization and bone regeneration. Used to heal bone fractures and to treat bone diseases such as osteopenia and osteoporosis." []
subset: 3_STAR
synonym: "anti-osteopenia agent" RELATED [ChEBI]
synonym: "anti-osteopenia agents" RELATED [ChEBI]
synonym: "anti-osteopenia drug" RELATED [ChEBI]
synonym: "anti-osteopenia drugs" RELATED [ChEBI]
synonym: "anti-osteoporosis agent" RELATED [ChEBI]
synonym: "anti-osteoporosis agents" RELATED [ChEBI]
synonym: "anti-osteoporosis drug" RELATED [ChEBI]
synonym: "anti-osteoporosis drugs" RELATED [ChEBI]
synonym: "anti-osteoporotic" RELATED [ChEBI]
synonym: "anti-osteoporotic agent" RELATED [ChEBI]
synonym: "anti-osteoporotic agents" RELATED [ChEBI]
synonym: "anti-osteoporotic drug" RELATED [ChEBI]
synonym: "anti-osteoporotic drugs" RELATED [ChEBI]
synonym: "anti-osteoporotics" RELATED [ChEBI]
synonym: "antiosteoporotic" RELATED [ChEBI]
synonym: "antiosteoporotics" RELATED [ChEBI]
synonym: "bone density conservation agents" RELATED [ChEBI]
synonym: "bone density conservation drug" RELATED [ChEBI]
synonym: "bone density conservation drugs" RELATED [ChEBI]
xref: Wikipedia:Osteoporosis
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:50689
name: reproductive control drug
namespace: chebi_ontology
def: "A substance used either in the prevention or facilitation of pregnancy." []
subset: 3_STAR
synonym: "reproductive control agent" RELATED [ChEBI]
synonym: "reproductive control drugs" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:50733
name: nutraceutical
namespace: chebi_ontology
def: "A product in capsule, tablet or liquid form that provide essential nutrients, such as a vitamin, an essential mineral, a protein, an herb, or similar nutritional substance." []
subset: 3_STAR
synonym: "Dietary Supplement" RELATED [ChEBI]
synonym: "Food Supplementation" RELATED [ChEBI]
synonym: "Nutritional supplement" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:50745
name: progestogen
namespace: chebi_ontology
def: "A compound that interacts with progesterone receptors in target tissues to bring about effects similar to those of progesterone." []
subset: 3_STAR
synonym: "gestagen" RELATED [ChEBI]
synonym: "gestagens" RELATED [ChEBI]
synonym: "progestagen" RELATED [ChEBI]
synonym: "progestagens" RELATED [ChEBI]
synonym: "progestogens" RELATED [ChEBI]
is_a: CHEBI:50112 ! sex hormone

[Term]
id: CHEBI:50779
name: appetite enhancer
namespace: chebi_ontology
def: "A drug which increases appetite." []
subset: 3_STAR
synonym: "appetite enhancing drug" RELATED [ChEBI]
synonym: "appetite stimulant" RELATED [ChEBI]
synonym: "orexigenic" RELATED [ChEBI]
xref: Wikipedia:Appetite_stimulants
is_a: CHEBI:50780 ! appetite regulator

[Term]
id: CHEBI:50780
name: appetite regulator
namespace: chebi_ontology
def: "An agent which regulates the physiologic mechanisms that control the appetite and food intake." []
subset: 3_STAR
synonym: "appetite regulators" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:50846
name: immunomodulator
namespace: chebi_ontology
def: "Biologically active substance whose activity affects or plays a role in the functioning of the immune system." []
subset: 3_STAR
synonym: "Biomodulator" RELATED [ChEBI]
synonym: "Immune factor" RELATED [ChEBI]
synonym: "Immunologic factor" RELATED [ChEBI]
synonym: "Immunological factor" RELATED [ChEBI]
synonym: "immunomodulators" RELATED [ChEBI]
xref: Wikipedia:Immunotherapy
is_a: CHEBI:23888 ! drug
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:50847
name: immunological adjuvant
namespace: chebi_ontology
def: "A substance that augments, stimulates, activates, potentiates, or modulates the immune response at either the cellular or humoral level. A classical agent (Freund's adjuvant, BCG, Corynebacterium parvum, et al.) contains bacterial antigens. It could also be endogenous (e.g., histamine, interferon, transfer factor, tuftsin, interleukin-1). Its mode of action is either non-specific, resulting in increased immune responsiveness to a wide variety of antigens, or antigen-specific, i.e., affecting a restricted type of immune response to a narrow group of antigens. The therapeutic efficacy is related to its antigen-specific immunoadjuvanticity." []
subset: 3_STAR
synonym: "Immunoactivator" RELATED [ChEBI]
synonym: "Immunoadjuvant" RELATED [ChEBI]
synonym: "Immunologic adjuvant" RELATED [ChEBI]
synonym: "Immunopotentiator" RELATED [ChEBI]
synonym: "Immunostimulant" RELATED [ChEBI]
xref: Wikipedia:Immunologic_adjuvant
is_a: CHEBI:50846 ! immunomodulator
is_a: CHEBI:60809 ! adjuvant

[Term]
id: CHEBI:50855
name: antiatherogenic agent
namespace: chebi_ontology
def: "A cardiovascular drug that prevents atherogenesis, the accumulation of lipid-containing plaques on the innermost layers of the arteries. Compare with antiatherosclerotic agent." []
subset: 3_STAR
synonym: "anti-atherogenic agent" RELATED [ChEBI]
synonym: "anti-atherogenic agents" RELATED [ChEBI]
synonym: "anti-atherogenic drug" RELATED [ChEBI]
synonym: "anti-atherogenic drugs" RELATED [ChEBI]
synonym: "antiatherogenic agent" EXACT [ChEBI]
synonym: "antiatherogenic agents" RELATED [ChEBI]
synonym: "antiatherogenic drug" RELATED [ChEBI]
synonym: "antiatherogenic drugs" RELATED [ChEBI]
xref: PMID:14592471 {source="Europe PMC"}
xref: PMID:16366593 {source="Europe PMC"}
xref: PMID:17990280 {source="Europe PMC"}
xref: PMID:20222342 {source="Europe PMC"}
xref: PMID:21074432 {source="Europe PMC"}
xref: PMID:21172387 {source="Europe PMC"}
xref: PMID:21649483 {source="Europe PMC"}
xref: PMID:3288054 {source="Europe PMC"}
xref: PMID:9796331 {source="Europe PMC"}
is_a: CHEBI:35554 ! cardiovascular drug

[Term]
id: CHEBI:50858
name: corticosteroid
namespace: chebi_ontology
def: "A natural or synthetic analogue of the hormones secreted by the adrenal gland." []
subset: 3_STAR
synonym: "corticoides" RELATED [ChEBI]
synonym: "corticosteroides" RELATED [ChEBI]
synonym: "corticosteroids" RELATED [ChEBI]
is_a: CHEBI:35341 ! steroid

[Term]
id: CHEBI:50860
name: organic molecular entity
namespace: chebi_ontology
alt_id: CHEBI:25700
alt_id: CHEBI:33244
def: "Any molecular entity that contains carbon." []
subset: 3_STAR
synonym: "organic compounds" RELATED [ChEBI]
synonym: "organic entity" RELATED [ChEBI]
synonym: "organic molecular entities" RELATED [ChEBI]
is_a: CHEBI:33582 ! carbon group molecular entity
relationship: has_part CHEBI:27594 ! carbon atom

[Term]
id: CHEBI:50906
name: role
namespace: chebi_ontology
def: "A role is particular behaviour which a material entity may exhibit." []
subset: 3_STAR
is_a: BFO:0000023 ! role

[Term]
id: CHEBI:50910
name: neurotoxin
namespace: chebi_ontology
alt_id: CHEBI:50911
def: "A poison that interferes with the functions of the nervous system." []
subset: 3_STAR
synonym: "agente neurotoxico" RELATED [ChEBI]
synonym: "nerve poison" RELATED [ChEBI]
synonym: "nerve poisons" RELATED [ChEBI]
synonym: "neurotoxic agent" RELATED [ChEBI]
synonym: "neurotoxic agents" RELATED [ChEBI]
synonym: "neurotoxicant" RELATED [ChEBI]
synonym: "neurotoxins" RELATED [ChEBI]
xref: Wikipedia:Neurotoxin
is_a: CHEBI:52209 ! aetiopathogenetic role
is_a: CHEBI:64909 ! poison

[Term]
id: CHEBI:50967
name: non-covalently-bound molecular entity
namespace: chebi_ontology
def: "Systems consisting of two or more molecular entities held together by non-covalent interactions." []
subset: 3_STAR
synonym: "non-covalently-bound molecular entities" RELATED [ChEBI]
is_a: CHEBI:36357 ! polyatomic entity

[Term]
id: CHEBI:50994
name: primary amino compound
namespace: chebi_ontology
def: "A compound formally derived from ammonia by replacing one hydrogen atom by an organyl group." []
subset: 3_STAR
synonym: "primary amino compounds" RELATED [ChEBI]
is_a: CHEBI:50047 ! organic amino compound
relationship: is_conjugate_base_of CHEBI:65296 ! primary ammonium ion

[Term]
id: CHEBI:51060
name: hormone agonist
namespace: chebi_ontology
def: "A chemical substance which binds to specific hormone receptors activating the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites." []
subset: 3_STAR
is_a: CHEBI:48705 ! agonist
is_a: CHEBI:51061 ! hormone receptor modulator

[Term]
id: CHEBI:51061
name: hormone receptor modulator
namespace: chebi_ontology
def: "A drug that modulates the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites." []
subset: 3_STAR
synonym: "hormone receptor modulators" RELATED [ChEBI]
is_a: CHEBI:90710 ! receptor modulator

[Term]
id: CHEBI:51086
name: chemical role
namespace: chebi_ontology
def: "A role played by the molecular entity or part thereof within a chemical context." []
subset: 3_STAR
is_a: BFO:0000023 ! role
is_a: CHEBI:50906 ! role

[Term]
id: CHEBI:51143
name: nitrogen molecular entity
namespace: chebi_ontology
alt_id: CHEBI:25556
alt_id: CHEBI:7594
subset: 3_STAR
synonym: "nitrogen compounds" RELATED [ChEBI]
synonym: "nitrogen molecular entities" RELATED [ChEBI]
synonym: "Nitrogenous compounds" RELATED [KEGG_COMPOUND]
xref: KEGG:C06061
is_a: CHEBI:33302 ! pnictogen molecular entity
relationship: has_part CHEBI:25555 ! nitrogen atom

[Term]
id: CHEBI:51151
name: dipolar compound
namespace: chebi_ontology
def: "An  organic molecule that is electrically neutral carrying a positive and a negative charge in one of its major canonical descriptions. In most dipolar compounds the charges are delocalized; however the term is also applied to species where this is not the case." []
subset: 3_STAR
synonym: "dipolar compounds" RELATED [ChEBI]
is_a: CHEBI:72695 ! organic molecule

[Term]
id: CHEBI:51422
name: organodiyl group
namespace: chebi_ontology
def: "Any organic substituent group, regardless of functional type, having two free valences at carbon atom(s)." []
subset: 3_STAR
synonym: "organodiyl groups" RELATED [ChEBI]
is_a: CHEBI:51446 ! organic divalent group

[Term]
id: CHEBI:51446
name: organic divalent group
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:51447
name: organic univalent group
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:51689
name: enone
namespace: chebi_ontology
def: "An alpha,beta-unsaturated ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) in which the C=O function is conjugated to a C=C double bond at the alpha,beta position." []
subset: 3_STAR
synonym: "enones" RELATED [ChEBI]
xref: Wikipedia:Enone
is_a: CHEBI:51721 ! alpha,beta-unsaturated ketone
is_a: CHEBI:78840 ! olefinic compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C3OR4" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "52.03150" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "51.99491" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]\\C([*])=C(\\[*])C([*])=O" xsd:string

[Term]
id: CHEBI:51721
name: alpha,beta-unsaturated ketone
namespace: chebi_ontology
def: "A ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) or R(1)C#C-C(=O)R(2) (R(2) =/= H) in which the ketonic C=O function is conjugated to an unsaturated C-C bond at the alpha,beta position." []
subset: 3_STAR
synonym: "alpha,beta-unsaturated ketones" RELATED [ChEBI]
is_a: CHEBI:17087 ! ketone

[Term]
id: CHEBI:51958
name: organic polycyclic compound
namespace: chebi_ontology
subset: 3_STAR
synonym: "organic polycyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33635 ! polycyclic compound
is_a: CHEBI:33832 ! organic cyclic compound

[Term]
id: CHEBI:52206
name: biochemical role
namespace: chebi_ontology
def: "A biological role played by the molecular entity or part thereof within a biochemical context." []
subset: 3_STAR
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:52208
name: biophysical role
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:52209
name: aetiopathogenetic role
namespace: chebi_ontology
def: "A role played by the molecular entity or part thereof which causes the development of a pathological process." []
subset: 3_STAR
synonym: "etiopathogenetic agent" RELATED [ChEBI]
synonym: "etiopathogenetic role" RELATED [ChEBI]
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:52210
name: pharmacological role
namespace: chebi_ontology
def: "A biological role which describes how a drug interacts within a biological system and how the interactions affect its medicinal properties." []
subset: 3_STAR
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:52211
name: physiological role
namespace: chebi_ontology
subset: 1_STAR
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:52217
name: pharmaceutical
namespace: chebi_ontology
alt_id: CHEBI:33293
alt_id: CHEBI:33294
def: "Any substance introduced into a living organism with therapeutic or diagnostic purpose." []
subset: 3_STAR
synonym: "farmaco" RELATED [ChEBI]
synonym: "medicament" RELATED [ChEBI]
synonym: "pharmaceuticals" RELATED [ChEBI]
is_a: CHEBI:33232 ! application

[Term]
id: CHEBI:52254
name: apatite
namespace: chebi_ontology
def: "A phosphate mineral with the general formula Ca5(PO4)3X where X = OH, F or Cl." []
subset: 3_STAR
synonym: "hydroxyapatite" RELATED [ChEBI]
xref: HMDB:HMDB0033610
is_a: CHEBI:46723 ! phosphate mineral

[Term]
id: CHEBI:52255
name: hydroxylapatite
namespace: chebi_ontology
def: "A phosphate mineral with the formula Ca5(PO4)3(OH)." []
subset: 3_STAR
is_a: CHEBI:52254 ! apatite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca5HO13P3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "502.312" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "501.67595" xsd:string

[Term]
id: CHEBI:52395
name: oxyketone
namespace: chebi_ontology
def: "A compound with the general formula R2C=O (R=/=H) where one or more of the R groups contains an oxy (-O-) group." []
subset: 3_STAR
synonym: "oxyketones" RELATED [ChEBI]
is_a: CHEBI:17087 ! ketone

[Term]
id: CHEBI:52396
name: alpha-oxyketone
namespace: chebi_ontology
def: "An oxyketone with the general formula R2C(=O) (R=/=H) where one or more of the R groups contains an oxy (-O-) group and the oxy and carbonyl groups are bonded to the same carbon atom." []
subset: 3_STAR
synonym: "alpha-oxyketones" RELATED [ChEBI]
is_a: CHEBI:52395 ! oxyketone

[Term]
id: CHEBI:52625
name: inorganic hydroxy compound
namespace: chebi_ontology
subset: 3_STAR
synonym: "inorganic hydroxides" RELATED [ChEBI]
is_a: CHEBI:24651 ! hydroxides
is_a: CHEBI:24835 ! inorganic molecular entity

[Term]
id: CHEBI:52845
name: cyclic organic group
namespace: chebi_ontology
def: "An organic group that consists of a closed ring. It may be a substituent or a skeleton." []
subset: 3_STAR
synonym: "cyclic organic groups" RELATED [ChEBI]
is_a: CHEBI:33247 ! organic group

[Term]
id: CHEBI:53000
name: epitope
namespace: chebi_ontology
def: "The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds." []
subset: 3_STAR
synonym: "antigenic determinant" RELATED [ChEBI]
synonym: "epitope function" RELATED [ChEBI]
synonym: "epitope role" RELATED [ChEBI]
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:53309
name: polyanionic macromolecule
namespace: chebi_ontology
def: "A polymer carrying multiple negative charges." []
subset: 3_STAR
synonym: "polyanion" RELATED [ChEBI]
synonym: "polyanions" RELATED [SUBMITTER]
is_a: CHEBI:53368 ! ionic macromolecule

[Term]
id: CHEBI:53368
name: ionic macromolecule
namespace: chebi_ontology
def: "A macromolecule containing ionic groups." []
subset: 3_STAR
synonym: "ionic polymer" RELATED [ChEBI]
synonym: "polyionic macromolecule" RELATED [ChEBI]
is_a: CHEBI:33839 ! macromolecule

[Term]
id: CHEBI:5391
name: glucagon
namespace: chebi_ontology
def: "A 29-amino acid peptide hormone consisting of His, Ser, Gln, Gly, Thr, Phe, Thr, Ser, Asp, Tyr, Ser, Lys, Tyr, Leu, Asp, Ser, Arg, Arg, Ala, Gln, Asp, Phe, Val, Gln, Trp, Leu, Met, Asn and Thr residues joined in sequence." []
subset: 3_STAR
synonym: "Glucagon" EXACT [KEGG_COMPOUND]
synonym: "glucagon" RELATED INN [ChemIDplus]
synonym: "Glucagone" RELATED [ChemIDplus]
synonym: "glucagonum" RELATED INN [ChemIDplus]
synonym: "His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr" RELATED [ChEBI]
synonym: "His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr" RELATED [ChemIDplus]
synonym: "HSQGTFTSDYSKYLDSRRAQDFVQWLMNT" RELATED [ChEBI]
synonym: "L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine" EXACT IUPAC_NAME [IUPAC]
xref: CAS:16941-32-5 {source="ChemIDplus"}
xref: CAS:9007-92-5 {source="KEGG COMPOUND"}
xref: CAS:9007-92-5 {source="ChemIDplus"}
xref: Drug_Central:2994 {source="DrugCentral"}
xref: DrugBank:DB00040
xref: KEGG:C01501
xref: KEGG:D00116
xref: PMID:21940356 {source="Europe PMC"}
xref: PMID:22014161 {source="Europe PMC"}
xref: PMID:22154917 {source="Europe PMC"}
xref: PMID:22166985 {source="Europe PMC"}
xref: PMID:22167521 {source="Europe PMC"}
xref: PMID:22214853 {source="Europe PMC"}
xref: PMID:22227186 {source="Europe PMC"}
xref: PMID:22286080 {source="Europe PMC"}
xref: PMID:22294753 {source="Europe PMC"}
xref: PMID:22318544 {source="Europe PMC"}
xref: PMID:22334714 {source="Europe PMC"}
xref: PMID:22399501 {source="Europe PMC"}
xref: PMID:22438981 {source="Europe PMC"}
xref: PMID:22454291 {source="Europe PMC"}
xref: Reaxys:13191924 {source="Reaxys"}
xref: Wikipedia:Glucagon
is_a: CHEBI:25905 ! peptide hormone
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C153H225N43O49S" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MASNOZXLGMXCHN-ZLPAWPGGSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "3482.74700" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3480.61570" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O" xsd:string

[Term]
id: CHEBI:5686
name: heterocyclic compound
namespace: chebi_ontology
def: "A cyclic compound having as ring members atoms of at least two different elements." []
subset: 3_STAR
synonym: "compuesto heterociclico" RELATED [IUPAC]
synonym: "compuestos heterociclicos" RELATED [IUPAC]
synonym: "heterocycle" RELATED [ChEBI]
synonym: "Heterocyclic compound" EXACT [KEGG_COMPOUND]
synonym: "heterocyclic compounds" RELATED [ChEBI]
is_a: CHEBI:33595 ! cyclic compound

[Term]
id: CHEBI:57305
name: glycine zwitterion
namespace: chebi_ontology
def: "An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of glycine." []
subset: 3_STAR
synonym: "2-azaniumylacetate" EXACT IUPAC_NAME [IUPAC]
synonym: "glycine" RELATED [UniProt]
xref: Gmelin:1807 {source="Gmelin"}
xref: MetaCyc:GLY
is_a: CHEBI:35238 ! amino acid zwitterion
relationship: is_tautomer_of CHEBI:15428 ! glycine
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H5NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "75.06660" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "75.03203" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CC([O-])=O" xsd:string

[Term]
id: CHEBI:57652
name: chondroitin D-glucuronate anion
namespace: chebi_ontology
def: "Anionic form of chondroitin D-glucuronate arising from deprotonation of the carboxylic acid groups of the repeating units; major species at pH 7.3." []
subset: 3_STAR
synonym: "chondroitin D-glucuronate" RELATED [UniProt]
synonym: "chondroitin D-glucuronate polyanion" RELATED [ChEBI]
is_a: CHEBI:61469 ! polyanionic polymer
relationship: is_conjugate_base_of CHEBI:16137 ! chondroitin D-glucuronate
property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O(C14H20NO11)n" xsd:string

[Term]
id: CHEBI:57887
name: tryptaminium
namespace: chebi_ontology
def: "An  ammonium ion that is the conjugate acid of tryptamine arising from protonation of the primary amino group; major species at pH 7.3." []
subset: 3_STAR
synonym: "2-(1H-indol-3-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC]
synonym: "tryptamine" RELATED [UniProt]
synonym: "tryptaminium cation" RELATED [ChEBI]
synonym: "tryptaminium(1+)" RELATED [ChEBI]
xref: Gmelin:533978 {source="Gmelin"}
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:16765 ! tryptamine
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H13N2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "APJYDQYYACXCRM-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "161.22310" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "161.10732" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]c2ccccc12" xsd:string

[Term]
id: CHEBI:57977
name: bilirubin(2-)
namespace: chebi_ontology
def: "A dicarboxylic acid dianion obtained by deprotonation of the two carboxy groups of bilirubin; major species at pH 7.3." []
subset: 3_STAR
synonym: "2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate" RELATED [ChEBI]
synonym: "bilirubin dianion" RELATED [ChEBI]
synonym: "bilirubin IXalpha" RELATED [UniProt]
xref: Beilstein:4083310 {source="Beilstein"}
is_a: CHEBI:28965 ! dicarboxylic acid dianion
is_a: CHEBI:59252 ! linear tetrapyrrole anion
relationship: is_conjugate_base_of CHEBI:16990 ! bilirubin IXalpha
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C33H34N4O6" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/p-2/b26-13-,27-14-" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BPYKTIZUTYGOLE-IFADSCNNSA-L" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "582.64630" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "582.24893" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC1=C(C=C)\\C(NC1=O)=C\\c1[nH]c(Cc2[nH]c(\\C=C3NC(=O)C(C=C)=C/3C)c(C)c2CCC([O-])=O)c(CCC([O-])=O)c1C" xsd:string

[Term]
id: CHEBI:58432
name: histaminium
namespace: chebi_ontology
def: "An ammonium ion that is the conjugate acid of histamine protonated on the side-chain nitrogen." []
subset: 3_STAR
synonym: "2-(1H-imidazol-4-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC]
synonym: "histamine" RELATED [UniProt]
synonym: "histaminium cation" RELATED [ChEBI]
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:18295 ! histamine
relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H10N3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NTYJJOPFIAHURM-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "112.15300" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "112.08692" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]cn1" xsd:string

[Term]
id: CHEBI:58951
name: short-chain fatty acid anion
namespace: chebi_ontology
def: "Any fatty acid anion obtained by removal of a proton from the carboxy group of a short-chain fatty acid (chain length of less than C6)." []
subset: 3_STAR
synonym: "a short-chain fatty acid" RELATED [UniProt]
synonym: "short-chain fatty acid anions" RELATED [ChEBI]
is_a: CHEBI:28868 ! fatty acid anion
relationship: is_conjugate_base_of CHEBI:26666 ! short-chain fatty acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "44.010" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string

[Term]
id: CHEBI:58953
name: saturated fatty acid anion
namespace: chebi_ontology
def: "Any fatty acid anion in which there is no C-C unsaturation." []
subset: 3_STAR
synonym: "saturated fatty acid anions" RELATED [ChEBI]
is_a: CHEBI:28868 ! fatty acid anion

[Term]
id: CHEBI:58954
name: straight-chain saturated fatty acid anion
namespace: chebi_ontology
def: "Any saturated fatty acid anion lacking a carbon side-chain." []
subset: 3_STAR
synonym: "straight-chain saturated fatty acid anions" RELATED [ChEBI]
is_a: CHEBI:58953 ! saturated fatty acid anion
relationship: is_conjugate_base_of CHEBI:39418 ! straight-chain saturated fatty acid

[Term]
id: CHEBI:58958
name: organosulfate oxoanion
namespace: chebi_ontology
def: "An organic anion of general formula RS(=O)2O(-) where R is an organyl group." []
subset: 3_STAR
synonym: "organosulfate oxoanions" RELATED [ChEBI]
is_a: CHEBI:25696 ! organic anion
is_a: CHEBI:33482 ! sulfur oxoanion
relationship: has_functional_parent CHEBI:16189 ! sulfate
relationship: is_conjugate_base_of CHEBI:25704 ! organic sulfate
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "O4SR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06300" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95173" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]S(=O)(=O)O[*]" xsd:string

[Term]
id: CHEBI:59202
name: straight-chain fatty acid
namespace: chebi_ontology
def: "Any fatty acid whose skeletal carbon atoms form an unbranched open chain." []
subset: 3_STAR
synonym: "straight-chain fatty acids" RELATED [ChEBI]
is_a: CHEBI:35366 ! fatty acid
relationship: is_conjugate_acid_of CHEBI:59203 ! straight-chain fatty acid anion

[Term]
id: CHEBI:59203
name: straight-chain fatty acid anion
namespace: chebi_ontology
def: "A fatty acid anion formed by deprotonation of the carboxylic acid functional group of a straight-chain fatty acid." []
subset: 3_STAR
synonym: "straight-chain FA anion" RELATED [ChEBI]
synonym: "straight-chain FA anions" RELATED [ChEBI]
synonym: "straight-chain fatty acid anions" RELATED [ChEBI]
is_a: CHEBI:28868 ! fatty acid anion
relationship: is_conjugate_base_of CHEBI:59202 ! straight-chain fatty acid

[Term]
id: CHEBI:59252
name: linear tetrapyrrole anion
namespace: chebi_ontology
def: "An organic anion arising from deprotonation of a acyclic tetrapyrrole compound." []
subset: 3_STAR
synonym: "acyclic tetrapyrrole anion" RELATED [ChEBI]
synonym: "acyclic tetrapyrrole anions" RELATED [ChEBI]
synonym: "linear tetrapyrrole anions" RELATED [ChEBI]
is_a: CHEBI:25696 ! organic anion

[Term]
id: CHEBI:59698
name: phosphoric acids
namespace: chebi_ontology
def: "Compounds containing one or more phosphoric acid units." []
subset: 3_STAR
is_a: CHEBI:33457 ! phosphorus oxoacid

[Term]
id: CHEBI:59740
name: nucleophilic reagent
namespace: chebi_ontology
def: "A reagent that forms a bond to its reaction partner (the electrophile) by donating both bonding electrons." []
subset: 3_STAR
synonym: "nucleophile" RELATED [ChEBI]
synonym: "nucleophiles" RELATED [ChEBI]
synonym: "nucleophilic reagents" RELATED [ChEBI]
is_a: CHEBI:33893 ! reagent
is_a: CHEBI:39144 ! Lewis base

[Term]
id: CHEBI:59814
name: L-alpha-amino acid anion
namespace: chebi_ontology
def: "Conjugate base of an L-alpha-amino acid arising from deprotonation of the C-1 carboxy group." []
subset: 3_STAR
synonym: "L-alpha-amino carboxylate" RELATED [ChEBI]
is_a: CHEBI:33558 ! alpha-amino-acid anion
relationship: is_conjugate_base_of CHEBI:15705 ! L-alpha-amino acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "73.051" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "73.01638" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[C@H](C(=O)[O-])(N)*" xsd:string

[Term]
id: CHEBI:59826
name: progestin
namespace: chebi_ontology
def: "A synthetic progestogen." []
subset: 3_STAR
synonym: "progestins" RELATED [ChEBI]
xref: Wikipedia:Progestin
is_a: CHEBI:50745 ! progestogen

[Term]
id: CHEBI:59869
name: L-alpha-amino acid zwitterion
namespace: chebi_ontology
def: "Zwitterionic form of an L-alpha-amino acid having an anionic carboxy group and a protonated amino group." []
subset: 3_STAR
synonym: "an L-alpha-amino acid" RELATED [UniProt]
synonym: "L-alpha-amino acid zwitterions" RELATED [ChEBI]
is_a: CHEBI:78608 ! alpha-amino acid zwitterion
relationship: is_tautomer_of CHEBI:15705 ! L-alpha-amino acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+][C@@H]([*])C([O-])=O" xsd:string

[Term]
id: CHEBI:59888
name: gamma-aminobutyric acid zwitterion
namespace: chebi_ontology
def: "Zwitterionic form of gamma-aminobutyric acid having an anionic carboxy group and a protonated amino group." []
subset: 3_STAR
synonym: "4-aminobutanoate" RELATED [UniProt]
synonym: "4-ammoniobutanoate" RELATED [ChEBI]
synonym: "4-azaniumylbutanoate" EXACT IUPAC_NAME [IUPAC]
xref: Gmelin:1041559 {source="Gmelin"}
is_a: CHEBI:35238 ! amino acid zwitterion
relationship: is_tautomer_of CHEBI:16865 ! gamma-aminobutyric acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H9NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "103.11980" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "103.06333" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCCC([O-])=O" xsd:string

[Term]
id: CHEBI:59905
name: dopaminium(1+)
namespace: chebi_ontology
def: "An ammonium ion that is the conjugate acid of dopamine; major species at pH 7.3." []
subset: 3_STAR
synonym: "2-(3,4-dihydroxyphenyl)ethan-1-aminium" RELATED [ChEBI]
synonym: "2-(3,4-dihydroxyphenyl)ethanaminium" EXACT IUPAC_NAME [IUPAC]
synonym: "dopamine" RELATED [UniProt]
synonym: "dopaminium cation" RELATED [ChEBI]
xref: Gmelin:328863 {source="Gmelin"}
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:18243 ! dopamine
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H12NO2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2/p+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VYFYYTLLBUKUHU-UHFFFAOYSA-O" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "154.18640" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "154.08626" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1ccc(O)c(O)c1" xsd:string

[Term]
id: CHEBI:59999
name: chemical substance
namespace: chebi_ontology
def: "A chemical substance is a portion of matter of constant composition, composed of molecular entities of the same type or of different types." []
subset: 3_STAR
synonym: "Chemische Substanz" RELATED [ChEBI]
is_a: CHEBI:24431 ! chemical entity

[Term]
id: CHEBI:60004
name: mixture
namespace: chebi_ontology
def: "A mixture is a chemical substance composed of multiple molecules, at least two of which are of a different kind." []
subset: 3_STAR
synonym: "Mischung" RELATED [ChEBI]
is_a: CHEBI:59999 ! chemical substance

[Term]
id: CHEBI:60027
name: polymer
namespace: chebi_ontology
def: "A polymer is a mixture, which is composed of macromolecules of different kinds and which may be differentiated by composition, length, degree of branching etc.." []
subset: 3_STAR
synonym: "Kunststoff" RELATED [ChEBI]
synonym: "Polymer" EXACT [ChEBI]
xref: Wikipedia:Polymer
is_a: CHEBI:60004 ! mixture
relationship: has_part CHEBI:33839 ! macromolecule

[Term]
id: CHEBI:60164
name: ionic polymer
namespace: chebi_ontology
def: "An ionic polymer is a polymer, composed of ionic macromolecules." []
subset: 3_STAR
synonym: "polyionic polymer" RELATED [ChEBI]
is_a: CHEBI:60027 ! polymer
relationship: has_part CHEBI:53368 ! ionic macromolecule

[Term]
id: CHEBI:60240
name: divalent metal cation
namespace: chebi_ontology
def: "A metal cation with a valence of two." []
subset: 3_STAR
synonym: "a divalent metal cation" RELATED [UniProt]
is_a: CHEBI:25213 ! metal cation
is_a: CHEBI:64641 ! divalent inorganic cation

[Term]
id: CHEBI:60242
name: monovalent inorganic cation
namespace: chebi_ontology
def: "An atom or small molecule with a positive charge that does not contain carbon in covalent linkage, with a valency of one." []
subset: 3_STAR
synonym: "a monovalent cation" RELATED [UniProt]
is_a: CHEBI:36915 ! inorganic cation

[Term]
id: CHEBI:60466
name: peptide zwitterion
namespace: chebi_ontology
def: "Zwitterionic form of any peptide where, in general, the amino terminus is positively charged and the carboxy terminus is negatively charged." []
subset: 3_STAR
synonym: "peptide zwitterions" RELATED [ChEBI]
is_a: CHEBI:27369 ! zwitterion
relationship: is_tautomer_of CHEBI:16670 ! peptide
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R(C2H2NOR)n" xsd:string

[Term]
id: CHEBI:60809
name: adjuvant
namespace: chebi_ontology
def: "Any pharmacological or immunological agent that modifies the effect of other agents such as drugs or vaccines while having few if any direct effects when given by itself." []
subset: 3_STAR
synonym: "adjuvants" RELATED [ChEBI]
is_a: CHEBI:52217 ! pharmaceutical

[Term]
id: CHEBI:60924
name: keratan sulfate
namespace: chebi_ontology
def: "A sulfated glycosaminoglycan, a linear polymer that consists of the repeating disaccharide  [3)-beta-Gal-(1->4)-beta-GlcNAc-(1->] and containing sulfo groups located at random positions." []
subset: 3_STAR
synonym: "keratan sulfates" RELATED [ChEBI]
synonym: "keratosulfate" RELATED [SUBMITTER]
is_a: CHEBI:35722 ! sulfated glycosaminoglycan
is_a: CHEBI:37395 ! mucopolysaccharide
relationship: has_functional_parent CHEBI:29057 ! keratan

[Term]
id: CHEBI:61073
name: oxygen radical
namespace: chebi_ontology
def: "An inorganic radical in which a free electron resides on one or more oxygen atoms of an oxygen species." []
subset: 3_STAR
synonym: "oxygen radicals" RELATED [ChEBI]
is_a: CHEBI:26523 ! reactive oxygen species
is_a: CHEBI:36871 ! inorganic radical

[Term]
id: CHEBI:61115
name: EC 3.5.1.98 (histone deacetylase) inhibitor
namespace: chebi_ontology
def: "An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the function of histone deacetylase (EC 3.5.1.98)." []
subset: 3_STAR
synonym: "EC 3.5.1.98 (histone deacetylase) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.1.98 inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.1.98 inhibitors" RELATED [ChEBI]
synonym: "HDAC inhibitor" RELATED [ChEBI]
synonym: "HDAC inhibitors" RELATED [ChEBI]
synonym: "HDACi" RELATED [ChEBI]
synonym: "HDACis" RELATED [ChEBI]
synonym: "HDI" RELATED [ChEBI]
synonym: "HDIs" RELATED [ChEBI]
synonym: "histone amidohydrolase inhibitor" RELATED [ChEBI]
synonym: "histone amidohydrolase inhibitors" RELATED [ChEBI]
synonym: "histone deacetylase (EC 3.5.1.98) inhibitor" RELATED [ChEBI]
synonym: "histone deacetylase (EC 3.5.1.98) inhibitors" RELATED [ChEBI]
synonym: "histone deacetylase inhibitor" RELATED [ChEBI]
synonym: "histone deacetylase inhibitors" RELATED [ChEBI]
xref: Wikipedia:Histone_deacetylase_inhibitor
is_a: CHEBI:76807 ! EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor

[Term]
id: CHEBI:61120
name: nucleobase-containing molecular entity
namespace: chebi_ontology
def: "Any compound that has a nucleobase as a part." []
subset: 3_STAR
synonym: "nucleobase-containing compound" RELATED [SUBMITTER]
synonym: "nucleobase-containing compounds" RELATED [ChEBI]
synonym: "nucleobase-containing molecular entities" RELATED [ChEBI]
is_a: CHEBI:33833 ! heteroarene
is_a: CHEBI:51143 ! nitrogen molecular entity
relationship: has_functional_parent CHEBI:18282 ! nucleobase

[Term]
id: CHEBI:61313
name: C21-steroid
namespace: chebi_ontology
def: "A steroid that has a structure based on a 21-carbon (pregnane) skeleton. Note that individual examples may have ring substituents at other positions and/or contain double bonds, aromatic A-rings, expanded/contracted rings etc., so the formula and mass may vary from that given for the generic structure." []
subset: 3_STAR
synonym: "a C21-steroid" RELATED [UniProt]
is_a: CHEBI:35341 ! steroid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H36" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H36/c1-4-15-9-11-18-17-10-8-16-7-5-6-13-20(16,2)19(17)12-14-21(15,18)3/h15-19H,4-14H2,1-3H3" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "JWMFYGXQPXQEEM-UHFFFAOYSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "288.511" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.28170" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1CCCC2C1(C3C(CC2)C4C(CC3)(C(CC4)CC)C)C" xsd:string

[Term]
id: CHEBI:61469
name: polyanionic polymer
namespace: chebi_ontology
def: "A polymer, composed of polyanion macromolecules." []
subset: 3_STAR
synonym: "polyanion" RELATED [ChEBI]
synonym: "polyanions" RELATED [ChEBI]
is_a: CHEBI:60164 ! ionic polymer
relationship: has_part CHEBI:53309 ! polyanionic macromolecule

[Term]
id: CHEBI:62031
name: polar amino acid zwitterion
namespace: chebi_ontology
def: "Zwitterionic form of a polar amino acid having an anionic carboxy group and a protonated amino group." []
subset: 2_STAR
synonym: "a polar amino acid" RELATED [UniProt]
xref: MetaCyc:Polar-amino-acids {source="SUBMITTER"}
is_a: CHEBI:35238 ! amino acid zwitterion
relationship: is_tautomer_of CHEBI:26167 ! polar amino acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(C([O-])=O)(*)[NH3+]" xsd:string

[Term]
id: CHEBI:62488
name: signalling molecule
namespace: chebi_ontology
def: "A molecular messenger in which the molecule is specifically involved in transmitting information between cells. Such molecules are released from the cell sending the signal, cross over the gap between cells by diffusion, and interact with specific receptors in another cell, triggering a response in that cell by activating a series of enzyme controlled reactions which lead to changes inside the cell." []
subset: 3_STAR
synonym: "signal molecule" RELATED [ChEBI]
synonym: "signal molecules" RELATED [ChEBI]
synonym: "signaling molecule" RELATED [ChEBI]
synonym: "signaling molecules" RELATED [ChEBI]
synonym: "signalling molecules" RELATED [ChEBI]
is_a: CHEBI:33280 ! molecular messenger

[Term]
id: CHEBI:62764
name: reactive nitrogen species
namespace: chebi_ontology
def: "A family of nitrogen molecular entities which are highly reactive and derived from nitric oxide (.NO) and superoxide (O2.(-)) produced via the enzymatic activity of inducible nitric oxide synthase 2 (NOS2) and NADPH oxidase respectively." []
subset: 3_STAR
synonym: "RNI" RELATED [SUBMITTER]
synonym: "RNS" RELATED [SUBMITTER]
xref: PMID:12076975 {source="SUBMITTER"}
xref: PMID:17667957 {source="SUBMITTER"}
xref: PMID:9741578 {source="SUBMITTER"}
xref: Wikipedia:Reactive_nitrogen_species
is_a: CHEBI:51143 ! nitrogen molecular entity

[Term]
id: CHEBI:62868
name: hepatoprotective agent
namespace: chebi_ontology
def: "Any compound that is able to prevent damage to the liver." []
subset: 3_STAR
synonym: "antihepatotoxic agent" RELATED [ChEBI]
synonym: "hepatoprotective agents" RELATED [ChEBI]
synonym: "hepatoprotector" RELATED [ChEBI]
is_a: CHEBI:50267 ! protective agent

[Term]
id: CHEBI:63248
name: oxidising agent
namespace: chebi_ontology
def: "A substance that removes electrons from another reactant in a redox reaction." []
subset: 3_STAR
synonym: "oxidant" RELATED [ChEBI]
synonym: "oxidants" RELATED [ChEBI]
synonym: "oxidiser" RELATED [ChEBI]
synonym: "oxidisers" RELATED [ChEBI]
synonym: "oxidising agents" RELATED [ChEBI]
synonym: "oxidizer" RELATED [ChEBI]
synonym: "oxidizers" RELATED [ChEBI]
synonym: "oxidizing agent" RELATED [ChEBI]
synonym: "oxidizing agents" RELATED [ChEBI]
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:63299
name: carbohydrate derivative
namespace: chebi_ontology
def: "Any organooxygen compound derived from a carbohydrate by replacement of one or more hydroxy group(s) by an amino group, a thiol group or similar heteroatomic groups. The term also includes derivatives of these compounds." []
subset: 3_STAR
synonym: "carbohydrate derivatives" RELATED [ChEBI]
synonym: "derivatised carbohydrate" RELATED [ChEBI]
synonym: "derivatised carbohydrates" RELATED [ChEBI]
synonym: "derivatized carbohydrate" RELATED [ChEBI]
synonym: "derivatized carbohydrates" RELATED [ChEBI]
is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives
relationship: has_functional_parent CHEBI:16646 ! carbohydrate

[Term]
id: CHEBI:63436
name: carbohydrate acid derivative
namespace: chebi_ontology
def: "A carbohydrate derivative that is formally obtained from a carbohydrate acid." []
subset: 3_STAR
synonym: "carbohydrate acid derivatives" RELATED [ChEBI]
is_a: CHEBI:63299 ! carbohydrate derivative
relationship: has_functional_parent CHEBI:33720 ! carbohydrate acid
relationship: is_conjugate_acid_of CHEBI:63551 ! carbohydrate acid derivative anion

[Term]
id: CHEBI:63534
name: monoamine
namespace: chebi_ontology
def: "An aralylamino compound which contains one amino group connected to an aromatic ring by a two-carbon chain. Monoamines are derived from aromatic amino acids like phenylalanine, tyrosine, tryptophan, and the thyroid hormones by the action of aromatic amino acid decarboxylase enzymes." []
subset: 3_STAR
synonym: "monoamines" RELATED [ChEBI]
synonym: "naturally occurring monoamine" RELATED [ChEBI]
synonym: "naturally occurring monoamines" RELATED [ChEBI]
xref: PMID:21822758 {source="Europe PMC"}
xref: PMID:21993877 {source="Europe PMC"}
xref: PMID:22005599 {source="Europe PMC"}
xref: PMID:22082101 {source="Europe PMC"}
xref: PMID:22153577 {source="Europe PMC"}
xref: PMID:22213370 {source="Europe PMC"}
xref: PMID:22218931 {source="Europe PMC"}
xref: PMID:22342987 {source="Europe PMC"}
xref: PMID:22371656 {source="Europe PMC"}
is_a: CHEBI:64365 ! aralkylamino compound

[Term]
id: CHEBI:63551
name: carbohydrate acid derivative anion
namespace: chebi_ontology
def: "A carboxylic acid anion resulting from the deprotonation of the carboxy group of a carbohydrate acid derivative." []
subset: 3_STAR
synonym: "carbohydrate acid anion derivative" RELATED [ChEBI]
synonym: "carbohydrate acid anion derivatives" RELATED [ChEBI]
synonym: "carbohydrate acid derivative anions" RELATED [ChEBI]
is_a: CHEBI:29067 ! carboxylic acid anion
relationship: has_functional_parent CHEBI:33721 ! carbohydrate acid anion
relationship: is_conjugate_base_of CHEBI:63436 ! carbohydrate acid derivative

[Term]
id: CHEBI:64047
name: food additive
namespace: chebi_ontology
def: "Any substance which is added to food to preserve or enhance its flavour and/or appearance." []
subset: 3_STAR
synonym: "food additives" RELATED [ChEBI]
xref: Wikipedia:Food_additive
is_a: CHEBI:33232 ! application
is_a: CHEBI:78295 ! food component

[Term]
id: CHEBI:64049
name: food acidity regulator
namespace: chebi_ontology
def: "A food additive that is used to change or otherwise control the acidity or alkalinity of foods. They may be acids, bases, neutralising agents or buffering agents." []
subset: 3_STAR
synonym: "acidity regulator" RELATED [ChEBI]
synonym: "acidity regulators" RELATED [ChEBI]
synonym: "food acidity regulators" RELATED [ChEBI]
synonym: "pH control agent" RELATED [ChEBI]
synonym: "pH control agents" RELATED [ChEBI]
xref: Wikipedia:Acidity_regulator
is_a: CHEBI:64047 ! food additive

[Term]
id: CHEBI:64365
name: aralkylamino compound
namespace: chebi_ontology
def: "An organic amino compound in which an aminoalkyl group is linked to an arene." []
subset: 3_STAR
synonym: "aralkylamino compounds" RELATED [ChEBI]
is_a: CHEBI:50047 ! organic amino compound

[Term]
id: CHEBI:64570
name: EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitor
namespace: chebi_ontology
def: "An EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor that interferes with the action of glycine hydroxymethyltransferase (EC 2.1.2.1)." []
subset: 3_STAR
synonym: "5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitor" RELATED [ChEBI]
synonym: "5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitors" RELATED [ChEBI]
synonym: "allothreonine aldolase inhibitor" RELATED [ChEBI]
synonym: "allothreonine aldolase inhibitors" RELATED [ChEBI]
synonym: "EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitors" RELATED [ChEBI]
synonym: "EC 2.1.2.1 inhibitor" RELATED [ChEBI]
synonym: "EC 2.1.2.1 inhibitors" RELATED [ChEBI]
synonym: "glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitor" RELATED [ChEBI]
synonym: "glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitors" RELATED [ChEBI]
synonym: "glycine hydroxymethyltransferase inhibitor" RELATED [ChEBI]
synonym: "glycine hydroxymethyltransferase inhibitors" RELATED [ChEBI]
synonym: "L-serine hydroxymethyltransferase inhibitor" RELATED [ChEBI]
synonym: "L-serine hydroxymethyltransferase inhibitors" RELATED [ChEBI]
synonym: "L-threonine aldolase inhibitor" RELATED [ChEBI]
synonym: "L-threonine aldolase inhibitors" RELATED [ChEBI]
synonym: "serine aldolase inhibitor" RELATED [ChEBI]
synonym: "serine aldolase inhibitors" RELATED [ChEBI]
synonym: "serine hydroxymethylase inhibitor" RELATED [ChEBI]
synonym: "serine hydroxymethylase inhibitors" RELATED [ChEBI]
synonym: "serine hydroxymethyltransferase inhibitor" RELATED [ChEBI]
synonym: "serine hydroxymethyltransferase inhibitors" RELATED [ChEBI]
synonym: "serine transhydroxymethylase inhibitor" RELATED [ChEBI]
synonym: "serine transhydroxymethylase inhibitors" RELATED [ChEBI]
synonym: "threonine aldolase inhibitor" RELATED [ChEBI]
synonym: "threonine aldolase inhibitors" RELATED [ChEBI]
xref: Wikipedia:Glycine_hydroxymethyltransferase
is_a: CHEBI:76874 ! EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor

[Term]
id: CHEBI:64571
name: NMDA receptor agonist
namespace: chebi_ontology
def: "An excitatory amino acid agonist which binds to NMDA receptors and triggers a response." []
subset: 3_STAR
synonym: "N-methyl-D-aspartate receptor agonist" RELATED [ChEBI]
synonym: "N-methyl-D-aspartate receptor agonists" RELATED [ChEBI]
synonym: "NMDA receptor agonists" RELATED [ChEBI]
synonym: "NMDAR agonist" RELATED [ChEBI]
synonym: "NMDAR agonists" RELATED [ChEBI]
is_a: CHEBI:50103 ! excitatory amino acid agonist

[Term]
id: CHEBI:64600
name: C21-steroid hormone
namespace: chebi_ontology
def: "A steroid compound with a structure based on a 21-carbon (pregnane) skeleton that acts as a hormone." []
subset: 3_STAR
synonym: "C21-steroid hormones" RELATED [ChEBI]
is_a: CHEBI:26764 ! steroid hormone
is_a: CHEBI:61313 ! C21-steroid

[Term]
id: CHEBI:64628
name: somatostatin
namespace: chebi_ontology
def: "A fourteen-membered heterodetic cyclic peptide comprising the sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys cyclised by a disulfide bridge between the two Cys residues at positions 3 and 14." []
subset: 3_STAR
synonym: "Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys]" RELATED [ChEBI]
synonym: "L-alanyl-N-[(4R,7S,10S,13S,16S,19S,22S,25S,28S,31S,34S,37R)-19,34-bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-13,25,28-tribenzyl-4-carboxy-10,16-bis[(1R)-1-hydroxyethyl]-7-(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6,9,12,15,18,21,24,27,30,33,36-undecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35-undecaazacyclooctatriacontan-37-yl]glycinamide" EXACT IUPAC_NAME [IUPAC]
synonym: "L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide" RELATED [ChemIDplus]
synonym: "somatostatin" RELATED INN [KEGG_DRUG]
synonym: "Somatostatin-1" RELATED [KEGG_COMPOUND]
synonym: "Somatostatin-14" RELATED [KEGG_COMPOUND]
synonym: "somatostatina" RELATED INN [ChemIDplus]
synonym: "somatostatine" RELATED INN [ChemIDplus]
synonym: "somatostatinum" RELATED INN [ChemIDplus]
synonym: "Synthetic growth hormone release-inhibiting hormone" RELATED [ChemIDplus]
xref: CAS:38916-34-6 {source="KEGG DRUG"}
xref: CAS:38916-34-6 {source="ChemIDplus"}
xref: Drug_Central:2997 {source="DrugCentral"}
xref: HMDB:HMDB0013072
xref: KEGG:C16022
xref: KEGG:D07431
xref: LINCS:LSM-5326
xref: PMID:21922516 {source="Europe PMC"}
xref: PMID:22129035 {source="Europe PMC"}
xref: PMID:22147011 {source="Europe PMC"}
xref: PMID:22251942 {source="Europe PMC"}
xref: PMID:22483686 {source="Europe PMC"}
xref: PMID:22509294 {source="Europe PMC"}
xref: Reaxys:10148626 {source="Reaxys"}
xref: Wikipedia:Somatostatin
is_a: CHEBI:24533 ! heterodetic cyclic peptide
is_a: CHEBI:25905 ! peptide hormone
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C76H104N18O19S2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C76H104N18O19S2/c1-41(79)64(100)82-37-61(99)83-58-39-114-115-40-59(76(112)113)92-72(108)57(38-95)91-75(111)63(43(3)97)94-71(107)54(33-46-23-11-6-12-24-46)90-74(110)62(42(2)96)93-66(102)51(28-16-18-30-78)84-69(105)55(34-47-36-81-49-26-14-13-25-48(47)49)88-68(104)53(32-45-21-9-5-10-22-45)86-67(103)52(31-44-19-7-4-8-20-44)87-70(106)56(35-60(80)98)89-65(101)50(85-73(58)109)27-15-17-29-77/h4-14,19-26,36,41-43,50-59,62-63,81,95-97H,15-18,27-35,37-40,77-79H2,1-3H3,(H2,80,98)(H,82,100)(H,83,99)(H,84,105)(H,85,109)(H,86,103)(H,87,106)(H,88,104)(H,89,101)(H,90,110)(H,91,111)(H,92,108)(H,93,102)(H,94,107)(H,112,113)/t41-,42+,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,59-,62-,63-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NHXLMOGPVYXJNR-ATOGVRKGSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "1637.87800" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1636.71666" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC1=O)[C@@H](C)O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N" xsd:string

[Term]
id: CHEBI:64641
name: divalent inorganic cation
namespace: chebi_ontology
def: "An inorganic cation with a valency of two." []
subset: 3_STAR
is_a: CHEBI:36915 ! inorganic cation

[Term]
id: CHEBI:64708
name: one-carbon compound
namespace: chebi_ontology
def: "An organic molecular entity containing a single carbon atom (C1)." []
subset: 3_STAR
synonym: "one-carbon compounds" RELATED [ChEBI]
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:64709
name: organic acid
namespace: chebi_ontology
def: "Any organic molecular entity that is acidic and contains carbon in covalent linkage." []
subset: 3_STAR
synonym: "organic acids" RELATED [ChEBI]
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:64909
name: poison
namespace: chebi_ontology
def: "Any substance that causes disturbance to organisms by chemical reaction or other activity on the molecular scale, when a sufficient quantity is absorbed by the organism." []
subset: 3_STAR
synonym: "poisonous agent" RELATED [ChEBI]
synonym: "poisonous agents" RELATED [ChEBI]
synonym: "poisonous substance" RELATED [ChEBI]
synonym: "poisonous substances" RELATED [ChEBI]
synonym: "poisons" RELATED [ChEBI]
synonym: "toxic agent" RELATED [ChEBI]
synonym: "toxic agents" RELATED [ChEBI]
synonym: "toxic substance" RELATED [ChEBI]
synonym: "toxic substances" RELATED [ChEBI]
xref: Wikipedia:Poison
is_a: CHEBI:24432 ! biological role

[Term]
id: CHEBI:6495
name: lipoprotein
namespace: chebi_ontology
def: "A clathrate complex consisting of a lipid enwrapped in a protein host without covalent binding in such a way that the complex has a hydrophilic outer surface consisting of all the protein and the polar ends of any phospholipids." []
subset: 3_STAR
synonym: "Lipoprotein" EXACT [KEGG_COMPOUND]
synonym: "lipoprotein particle" RELATED [ChEBI]
synonym: "lipoproteins" EXACT IUPAC_NAME [IUPAC]
xref: KEGG:C01834
is_a: CHEBI:33837 ! conjugated protein
is_a: CHEBI:39024 ! clathrate compound
relationship: has_part CHEBI:39015 ! apolipoprotein
relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite

[Term]
id: CHEBI:65212
name: polysaccharide derivative
namespace: chebi_ontology
def: "A carbohydrate derivative that is any derivative of a polysaccharide." []
subset: 3_STAR
synonym: "polysaccharide derivatives" RELATED [ChEBI]
is_a: CHEBI:167559 ! glycan
is_a: CHEBI:33694 ! biomacromolecule
is_a: CHEBI:63299 ! carbohydrate derivative
relationship: has_functional_parent CHEBI:18154 ! polysaccharide

[Term]
id: CHEBI:65255
name: food preservative
namespace: chebi_ontology
def: "Substances which are added to food in order to prevent decomposition caused by  microbial growth or by undesirable chemical changes." []
subset: 3_STAR
synonym: "food preservatives" RELATED [ChEBI]
is_a: CHEBI:64047 ! food additive

[Term]
id: CHEBI:65256
name: antimicrobial food preservative
namespace: chebi_ontology
def: "A food preservative which prevents decomposition of food by preventing the growth of fungi or bacteria. In European countries, E-numbers for permitted food preservatives are from E200 to E299, divided into sorbates (E200-209), benzoates (E210-219), sulfites (E220-229), phenols and formates (E230-239), nitrates (E240-259), acetates (E260-269), lactates (E270-279), propionates (E280-289) and others (E290-299)." []
subset: 3_STAR
synonym: "antimicrobial food preservatives" RELATED [ChEBI]
synonym: "antimicrobial preservative" RELATED [ChEBI]
synonym: "antimicrobial preservatives" RELATED [ChEBI]
is_a: CHEBI:33281 ! antimicrobial agent
is_a: CHEBI:65255 ! food preservative

[Term]
id: CHEBI:65296
name: primary ammonium ion
namespace: chebi_ontology
def: "An ammonium ion derivative resulting from the protonation of the nitrogen atom of a primary amino compound. Major species at pH 7.3." []
subset: 3_STAR
synonym: "a primary amine" RELATED [UniProt]
synonym: "substituted ammonium" RELATED [ChEBI]
is_a: CHEBI:25697 ! organic cation
is_a: CHEBI:35274 ! ammonium ion derivative
relationship: is_conjugate_acid_of CHEBI:50994 ! primary amino compound
property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "H3NR" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "17.031" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.02655" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+][*]" xsd:string

[Term]
id: CHEBI:67079
name: anti-inflammatory agent
namespace: chebi_ontology
def: "Any compound that has anti-inflammatory effects." []
subset: 3_STAR
synonym: "anti-inflammatory agents" RELATED [ChEBI]
synonym: "antiinflammatory agent" RELATED [ChEBI]
synonym: "antiinflammatory agents" RELATED [ChEBI]
is_a: CHEBI:33232 ! application

[Term]
id: CHEBI:68452
name: azole
namespace: chebi_ontology
def: "Any monocyclic heteroarene consisting of a five-membered ring containing nitrogen. Azoles can also contain one or more other non-carbon atoms, such as nitrogen, sulfur or oxygen." []
subset: 3_STAR
synonym: "azoles" RELATED [ChEBI]
xref: Wikipedia:Azole
is_a: CHEBI:38101 ! organonitrogen heterocyclic compound
is_a: CHEBI:38179 ! monocyclic heteroarene

[Term]
id: CHEBI:68495
name: apoptosis inducer
namespace: chebi_ontology
def: "Any substance that induces the process of apoptosis (programmed cell death) in multi-celled organisms." []
subset: 3_STAR
synonym: "apoptosis inducers" RELATED [ChEBI]
synonym: "Type I cell-death inducer" RELATED [ChEBI]
synonym: "Type I cell-death inducers" RELATED [ChEBI]
synonym: "Type I programmed cell-death inducer" RELATED [ChEBI]
synonym: "Type I programmed cell-death inducers" RELATED [ChEBI]
is_a: CHEBI:52206 ! biochemical role

[Term]
id: CHEBI:70709
name: progesterone receptor agonist
namespace: chebi_ontology
def: "A hormone agonist that binds to and activates progesterone receptors." []
subset: 3_STAR
synonym: "PR agonist" RELATED [ChEBI]
synonym: "PR agonists" RELATED [ChEBI]
synonym: "progesterone receptor agonists" RELATED [ChEBI]
is_a: CHEBI:51060 ! hormone agonist

[Term]
id: CHEBI:71300
name: EC 2.* (transferase) inhibitor
namespace: chebi_ontology
def: "An enzyme inhibitor that inhibits the action of a transferase (EC 2.*)" []
subset: 3_STAR
synonym: "EC 2 inhibitor" RELATED [ChEBI]
synonym: "EC 2 inhibitors" RELATED [ChEBI]
synonym: "EC 2.* (transferase) inhibitors" RELATED [ChEBI]
synonym: "EC 2.* inhibitor" RELATED [ChEBI]
synonym: "EC 2.* inhibitors" RELATED [ChEBI]
synonym: "transferase inhibitor" RELATED [ChEBI]
synonym: "transferase inhibitors" RELATED [ChEBI]
xref: Wikipedia:Transferase
is_a: CHEBI:23924 ! enzyme inhibitor

[Term]
id: CHEBI:71666
name: gamma-amino acid anion
namespace: chebi_ontology
def: "An amino-acid anion in which the amino group is situated gamma- to the carboxylate group." []
subset: 3_STAR
synonym: "gamma-amino acid anions" RELATED [ChEBI]
is_a: CHEBI:37022 ! amino-acid anion
relationship: is_conjugate_base_of CHEBI:33707 ! gamma-amino acid

[Term]
id: CHEBI:72695
name: organic molecule
namespace: chebi_ontology
def: "Any molecule that consists of at least one carbon atom as part of the electrically neutral entity." []
subset: 3_STAR
synonym: "organic compound" RELATED [ChEBI]
synonym: "organic compounds" RELATED [ChEBI]
synonym: "organic molecules" RELATED [ChEBI]
is_a: CHEBI:25367 ! molecule
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:72813
name: exopolysaccharide
namespace: chebi_ontology
def: "A biomacromolecule composed of carbohydrate residues which is secreted by a microorganism into the surrounding environment." []
subset: 3_STAR
synonym: "exopolysaccharides" RELATED [ChEBI]
synonym: "extracellular polymeric substance" RELATED [ChEBI]
synonym: "extracellular polymeric substances" RELATED [ChEBI]
xref: MetaCyc:Exopolysaccharides
xref: PMID:11160795 {source="Europe PMC"}
xref: PMID:11785425 {source="Europe PMC"}
xref: PMID:1444258 {source="Europe PMC"}
xref: PMID:15738217 {source="Europe PMC"}
xref: PMID:16075348 {source="Europe PMC"}
xref: PMID:17440912 {source="Europe PMC"}
xref: PMID:18097339 {source="Europe PMC"}
xref: PMID:19453747 {source="Europe PMC"}
xref: PMID:20172021 {source="Europe PMC"}
xref: PMID:20631870 {source="Europe PMC"}
xref: PMID:20718297 {source="Europe PMC"}
xref: PMID:2688547 {source="Europe PMC"}
xref: PMID:6354590 {source="Europe PMC"}
xref: Wikipedia:Exopolysaccharide
xref: Wikipedia:Extracellular_polymeric_substance
is_a: CHEBI:33694 ! biomacromolecule

[Term]
id: CHEBI:73398
name: indole skeleton
namespace: chebi_ontology
def: "A mancude heterobicyclic organic group consisting of a benzene ring fused to a pyrrole ring." []
subset: 3_STAR
is_a: CHEBI:73541 ! organic heterobicyclic ring
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C8N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "110.09230" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "110.00307" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1(=C(C(=C2C(=C1*)N(C(=C2*)*)*)*)*)*" xsd:string

[Term]
id: CHEBI:73541
name: organic heterobicyclic ring
namespace: chebi_ontology
def: "A bicyclic organic group that contains both carbon and hetero atoms." []
subset: 3_STAR
synonym: "organic heterobicyclic rings" RELATED [ChEBI]
is_a: CHEBI:52845 ! cyclic organic group

[Term]
id: CHEBI:74783
name: astringent
namespace: chebi_ontology
def: "A compound that causes the contraction of body tissues, typically used to reduce bleeding from minor abrasions." []
subset: 3_STAR
synonym: "adstringent" RELATED [ChEBI]
synonym: "adstringents" RELATED [ChEBI]
synonym: "astringents" RELATED [ChEBI]
xref: Wikipedia:Astringent
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:75431
name: ghrelin
namespace: chebi_ontology
def: "A 28-membered appetite-stimulating polypeptide consisting of Gly, Ser, Ser(octanoyl), Phe, Leu, Ser, Pro, Glu, His, Gln, Arg, Val, Gln, Gln, Arg, Lys, Glu, Ser, Lys, Lys, Pro, Pro, Ala, Lys, Leu, Gln, Pro and Arg residues joined in sequence. The O-n-octanoylation of the side-chain hydroxy group of serine-3 (Ser3) is essential for ghrelin's activity." []
subset: 3_STAR
synonym: "Gastric MLTRP" RELATED [ChemIDplus]
synonym: "Ghrelin (human)" RELATED [ChemIDplus]
synonym: "Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg" RELATED [ChEBI]
synonym: "glycyl-L-seryl-O-octanoyl-L-seryl-L-phenylalanyl-L-leucyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-arginyl-L-valyl-L-glutaminyl-L-glutaminyl-L-arginyl-L-lysyl-L-alpha-glutamyl-L-seryl-L-lysyl-L-lysyl-L-prolyl-L-prolyl-L-alanyl-L-lysyl-L-leucyl-L-glutaminyl-L-prolyl-L-arginine" EXACT IUPAC_NAME [IUPAC]
synonym: "GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR" RELATED [ChEBI]
synonym: "GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR" RELATED [ChEBI]
synonym: "H-Gly-Ser-Ser(n-octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH" RELATED [ChEBI]
synonym: "Human ghrelin" RELATED [ChemIDplus]
synonym: "lenomorelin" RELATED INN [WHO_MedNet]
synonym: "lenomorelina" RELATED INN [WHO_MedNet]
synonym: "lenomoreline" RELATED INN [WHO_MedNet]
synonym: "lenomorelinum" RELATED INN [WHO_MedNet]
synonym: "Motilin-related peptide" RELATED [ChemIDplus]
xref: CAS:258279-04-8 {source="ChemIDplus"}
xref: CAS:304853-26-7 {source="ChemIDplus"}
xref: KEGG:C16025
xref: PMID:15788704 {source="Europe PMC"}
xref: PMID:23159561 {source="Europe PMC"}
xref: PMID:23178701 {source="Europe PMC"}
xref: PMID:23278489 {source="Europe PMC"}
xref: PMID:23307791 {source="Europe PMC"}
xref: PMID:23316086 {source="Europe PMC"}
xref: PMID:23317782 {source="Europe PMC"}
xref: PMID:23359315 {source="Europe PMC"}
xref: PMID:23428971 {source="Europe PMC"}
xref: PMID:23481295 {source="Europe PMC"}
xref: PMID:23524619 {source="Europe PMC"}
xref: PMID:23624808 {source="Europe PMC"}
xref: PMID:23631903 {source="Europe PMC"}
xref: PMID:23652386 {source="Europe PMC"}
xref: PMID:23652399 {source="Europe PMC"}
xref: PMID:23652420 {source="Europe PMC"}
xref: PMID:23698230 {source="Europe PMC"}
xref: PMID:23704134 {source="Europe PMC"}
xref: PMID:23778458 {source="Europe PMC"}
xref: PMID:23804489 {source="Europe PMC"}
xref: PMID:23808302 {source="Europe PMC"}
xref: PMID:23843943 {source="Europe PMC"}
xref: PMID:23847595 {source="Europe PMC"}
xref: PMID:23965296 {source="Europe PMC"}
xref: PMID:23982275 {source="Europe PMC"}
xref: PMID:23989358 {source="Europe PMC"}
xref: PMID:28538835 {source="Europe PMC"}
xref: PMID:28542403 {source="Europe PMC"}
xref: PMID:28547758 {source="Europe PMC"}
xref: PMID:28590260 {source="Europe PMC"}
xref: PMID:28621678 {source="Europe PMC"}
xref: PMID:28704966 {source="Europe PMC"}
xref: Reaxys:24715767 {source="Reaxys"}
xref: Wikipedia:Ghrelin
is_a: CHEBI:15841 ! polypeptide
is_a: CHEBI:25905 ! peptide hormone
relationship: RO:0000087 CHEBI:35610 ! has role antineoplastic agent
relationship: RO:0000087 CHEBI:50779 ! has role appetite enhancer
relationship: RO:0000087 CHEBI:50855 ! has role antiatherogenic agent
relationship: RO:0000087 CHEBI:68495 ! has role apoptosis inducer
relationship: RO:0000087 CHEBI:77746 ! has role human metabolite
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C149H249N47O42" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C149H249N47O42/c1-9-10-11-12-16-45-118(209)238-78-106(191-135(225)103(75-197)171-115(204)73-154)137(227)187-101(71-84-32-14-13-15-33-84)133(223)186-100(70-81(4)5)132(222)190-105(77-199)144(234)194-66-29-42-108(194)139(229)180-95(51-57-117(207)208)128(218)188-102(72-85-74-165-79-169-85)134(224)179-92(47-53-112(156)201)126(216)175-90(39-26-63-167-148(161)162)130(220)192-119(82(6)7)141(231)181-93(48-54-113(157)202)127(217)177-91(46-52-111(155)200)125(215)174-89(38-25-62-166-147(159)160)122(212)173-87(35-18-22-59-151)121(211)178-94(50-56-116(205)206)129(219)189-104(76-198)136(226)176-88(36-19-23-60-152)123(213)182-96(37-20-24-61-153)142(232)196-68-31-44-110(196)145(235)195-67-30-41-107(195)138(228)170-83(8)120(210)172-86(34-17-21-58-150)124(214)185-99(69-80(2)3)131(221)183-97(49-55-114(158)203)143(233)193-65-28-43-109(193)140(230)184-98(146(236)237)40-27-64-168-149(163)164/h13-15,32-33,74,79-83,86-110,119,197-199H,9-12,16-31,34-73,75-78,150-154H2,1-8H3,(H2,155,200)(H2,156,201)(H2,157,202)(H2,158,203)(H,165,169)(H,170,228)(H,171,204)(H,172,210)(H,173,212)(H,174,215)(H,175,216)(H,176,226)(H,177,217)(H,178,211)(H,179,224)(H,180,229)(H,181,231)(H,182,213)(H,183,221)(H,184,230)(H,185,214)(H,186,223)(H,187,227)(H,188,218)(H,189,219)(H,190,222)(H,191,225)(H,192,220)(H,205,206)(H,207,208)(H,236,237)(H4,159,160,166)(H4,161,162,167)(H4,163,164,168)/t83-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,119-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "GNKDKYIHGQKHHM-RJKLHVOGSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "3370.867" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3368.87933" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N1[C@@H](CCC1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N2[C@@H](CCC2)C(N3[C@@H](CCC3)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N4[C@@H](CCC4)C(=O)N[C@H](C(=O)O)CCCNC(=N)N)=O)CCC(=O)N)CC(C)C)CCCCN)C)=O)=O)CCCCN)CCCCN)CO)CCC(=O)O)CCCCN)CCCNC(N)=N)CCC(=O)N)CCC(=O)N)C(C)C)CCCNC(N)=N)CCC(=O)N)CC=5N=CNC5)CCC(=O)O)=O)CO)CC(C)C)CC=6C=CC=CC6)COC(=O)CCCCCCC)CO)N" xsd:string

[Term]
id: CHEBI:75763
name: eukaryotic metabolite
namespace: chebi_ontology
def: "Any  metabolite produced during a metabolic reaction in eukaryotes, the taxon that include members of the fungi, plantae and animalia kingdoms." []
subset: 3_STAR
synonym: "eukaryotic metabolites" RELATED [ChEBI]
is_a: CHEBI:25212 ! metabolite

[Term]
id: CHEBI:75767
name: animal metabolite
namespace: chebi_ontology
alt_id: CHEBI:77721
alt_id: CHEBI:77743
def: "Any eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals." []
subset: 3_STAR
synonym: "animal metabolites" RELATED [ChEBI]
is_a: CHEBI:75763 ! eukaryotic metabolite

[Term]
id: CHEBI:75768
name: mammalian metabolite
namespace: chebi_ontology
alt_id: CHEBI:77464
alt_id: CHEBI:77744
def: "Any animal metabolite produced during a metabolic reaction in mammals." []
subset: 3_STAR
synonym: "mammalian metabolites" RELATED [ChEBI]
is_a: CHEBI:75767 ! animal metabolite

[Term]
id: CHEBI:75771
name: mouse metabolite
namespace: chebi_ontology
def: "Any mammalian metabolite produced during a metabolic reaction in a mouse (Mus musculus)." []
subset: 3_STAR
synonym: "mouse metabolites" RELATED [ChEBI]
synonym: "Mus musculus metabolite" RELATED [ChEBI]
synonym: "Mus musculus metabolites" RELATED [ChEBI]
is_a: CHEBI:75768 ! mammalian metabolite

[Term]
id: CHEBI:75772
name: Saccharomyces cerevisiae metabolite
namespace: chebi_ontology
alt_id: CHEBI:76949
alt_id: CHEBI:76951
def: "Any  fungal metabolite produced during a metabolic reaction in Baker's yeast (Saccharomyces cerevisiae)." []
subset: 3_STAR
synonym: "baker's yeast metabolite" RELATED [ChEBI]
synonym: "baker's yeast metabolites" RELATED [ChEBI]
synonym: "baker's yeast secondary metabolite" RELATED [ChEBI]
synonym: "baker's yeast secondary metabolites" RELATED [ChEBI]
synonym: "S. cerevisiae metabolite" RELATED [ChEBI]
synonym: "S. cerevisiae metabolites" RELATED [ChEBI]
synonym: "S. cerevisiae secondary metabolite" RELATED [ChEBI]
synonym: "S. cerevisiae secondary metabolites" RELATED [ChEBI]
synonym: "Saccharomyces cerevisiae metabolites" RELATED [ChEBI]
synonym: "Saccharomyces cerevisiae secondary metabolites" RELATED [ChEBI]
is_a: CHEBI:76946 ! fungal metabolite

[Term]
id: CHEBI:75787
name: prokaryotic metabolite
namespace: chebi_ontology
def: "Any metabolite produced during a metabolic reaction in prokaryotes, the taxon that include members of domains such as the bacteria and archaea." []
subset: 3_STAR
synonym: "prokaryotic metabolites" RELATED [ChEBI]
is_a: CHEBI:25212 ! metabolite

[Term]
id: CHEBI:76206
name: xenobiotic metabolite
namespace: chebi_ontology
def: "Any metabolite produced by metabolism of a xenobiotic compound." []
subset: 3_STAR
synonym: "xenobiotic metabolites" RELATED [ChEBI]
is_a: CHEBI:25212 ! metabolite

[Term]
id: CHEBI:76413
name: greenhouse gas
namespace: chebi_ontology
def: "A gas in an atmosphere that absorbs and emits radiation within the thermal infrared range, so contributing to the 'greenhouse effect'." []
subset: 3_STAR
synonym: "greenhouse gases" RELATED [ChEBI]
xref: Wikipedia:Greenhouse_gas
is_a: CHEBI:51086 ! chemical role

[Term]
id: CHEBI:76655
name: EC 2.1.* (C1-transferase) inhibitor
namespace: chebi_ontology
def: "A transferase inhibitor inhibiting the action of transferase of a one-carbon-containing group (EC 2.1.*.*)." []
subset: 3_STAR
synonym: "C1-transferase (EC 2.1.*) inhibitor" RELATED [ChEBI]
synonym: "C1-transferase (EC 2.1.*) inhibitors" RELATED [ChEBI]
synonym: "C1-transferase inhibitor" RELATED [ChEBI]
synonym: "C1-transferase inhibitors" RELATED [ChEBI]
synonym: "EC 2.1.* (C1-transferase) inhibitors" RELATED [ChEBI]
synonym: "EC 2.1.* inhibitor" RELATED [ChEBI]
synonym: "EC 2.1.* inhibitors" RELATED [ChEBI]
synonym: "one-carbon-containing group transferase inhibitor" RELATED [ChEBI]
synonym: "one-carbon-containing group transferase inhibitors" RELATED [ChEBI]
is_a: CHEBI:71300 ! EC 2.* (transferase) inhibitor

[Term]
id: CHEBI:76759
name: EC 3.* (hydrolase) inhibitor
namespace: chebi_ontology
def: "Any enzyme inhibitor that interferes with the action of a hydrolase (EC 3.*.*.*)." []
subset: 3_STAR
synonym: "EC 3.* (hydrolase) inhibitors" RELATED [ChEBI]
synonym: "EC 3.* inhibitor" RELATED [ChEBI]
synonym: "EC 3.* inhibitors" RELATED [ChEBI]
synonym: "EC 3.*.*.* inhibitor" RELATED [ChEBI]
synonym: "EC 3.*.*.* inhibitors" RELATED [ChEBI]
synonym: "hydrolase (EC 3.*) inhibitor" RELATED [ChEBI]
synonym: "hydrolase (EC 3.*) inhibitors" RELATED [ChEBI]
synonym: "hydrolase inhibitor" RELATED [ChEBI]
synonym: "hydrolase inhibitors" RELATED [ChEBI]
xref: Wikipedia:Hydrolase
is_a: CHEBI:23924 ! enzyme inhibitor

[Term]
id: CHEBI:76764
name: EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor
namespace: chebi_ontology
def: "Any hydrolase inhibitor that interferes with the action of a hydrolase acting on C-N bonds, other than peptide bonds (EC 3.5.*.*)." []
subset: 3_STAR
synonym: "EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.* inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.* inhibitors" RELATED [ChEBI]
is_a: CHEBI:76759 ! EC 3.* (hydrolase) inhibitor

[Term]
id: CHEBI:76807
name: EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor
namespace: chebi_ontology
def: "An EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor that interferes with the action of any non-peptide linear amide C-N hydrolase (EC 3.5.1.*)." []
subset: 3_STAR
synonym: "EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.1.* inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.1.* inhibitors" RELATED [ChEBI]
synonym: "non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor" RELATED [ChEBI]
synonym: "non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors" RELATED [ChEBI]
is_a: CHEBI:76764 ! EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor

[Term]
id: CHEBI:76874
name: EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor
namespace: chebi_ontology
def: "An EC 2.1.* (C1-transferase) inhibitor that interferes with the action of any hydroxymethyl-, formyl- and related transferase (EC 2.1.2.*)." []
subset: 3_STAR
synonym: "EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitors" RELATED [ChEBI]
synonym: "EC 2.1.2.* inhibitor" RELATED [ChEBI]
synonym: "EC 2.1.2.* inhibitors" RELATED [ChEBI]
synonym: "hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitor" RELATED [ChEBI]
synonym: "hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitors" RELATED [ChEBI]
is_a: CHEBI:76655 ! EC 2.1.* (C1-transferase) inhibitor

[Term]
id: CHEBI:76924
name: plant metabolite
namespace: chebi_ontology
alt_id: CHEBI:75766
alt_id: CHEBI:76925
def: "Any eukaryotic metabolite produced during a metabolic reaction in plants, the kingdom that include flowering plants, conifers and other gymnosperms." []
subset: 3_STAR
synonym: "plant metabolites" RELATED [ChEBI]
synonym: "plant secondary metabolites" RELATED [ChEBI]
is_a: CHEBI:75763 ! eukaryotic metabolite

[Term]
id: CHEBI:76946
name: fungal metabolite
namespace: chebi_ontology
alt_id: CHEBI:75765
alt_id: CHEBI:76947
def: "Any eukaryotic metabolite produced during a metabolic reaction in fungi, the kingdom that includes microorganisms such as the yeasts and moulds." []
subset: 3_STAR
synonym: "fungal metabolites" RELATED [ChEBI]
is_a: CHEBI:75763 ! eukaryotic metabolite

[Term]
id: CHEBI:76967
name: human xenobiotic metabolite
namespace: chebi_ontology
def: "Any human metabolite produced by metabolism of a xenobiotic compound in humans." []
subset: 3_STAR
synonym: "human xenobiotic metabolites" RELATED [ChEBI]
is_a: CHEBI:76206 ! xenobiotic metabolite
is_a: CHEBI:77746 ! human metabolite

[Term]
id: CHEBI:76969
name: bacterial metabolite
namespace: chebi_ontology
alt_id: CHEBI:75760
alt_id: CHEBI:76970
def: "Any prokaryotic metabolite produced during a metabolic reaction in bacteria." []
subset: 3_STAR
is_a: CHEBI:75787 ! prokaryotic metabolite

[Term]
id: CHEBI:76971
name: Escherichia coli metabolite
namespace: chebi_ontology
def: "Any bacterial metabolite produced during a metabolic reaction in Escherichia coli." []
subset: 3_STAR
synonym: "E.coli metabolite" RELATED [ChEBI]
synonym: "E.coli metabolites" RELATED [ChEBI]
synonym: "Escherichia coli metabolites" RELATED [ChEBI]
is_a: CHEBI:76969 ! bacterial metabolite

[Term]
id: CHEBI:77746
name: human metabolite
namespace: chebi_ontology
alt_id: CHEBI:75770
alt_id: CHEBI:77123
def: "Any mammalian metabolite  produced during a metabolic reaction in humans (Homo sapiens)." []
subset: 3_STAR
synonym: "H. sapiens metabolite" RELATED [ChEBI]
synonym: "H. sapiens metabolites" RELATED [ChEBI]
synonym: "Homo sapiens metabolite" RELATED [ChEBI]
synonym: "Homo sapiens metabolites" RELATED [ChEBI]
is_a: CHEBI:75768 ! mammalian metabolite

[Term]
id: CHEBI:77941
name: EC 3.5.1.4 (amidase) inhibitor
namespace: chebi_ontology
def: "An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the action of amidase (EC 3.5.1.4)." []
subset: 3_STAR
synonym: "acylamidase inhibitor" RELATED [ChEBI]
synonym: "acylamidase inhibitors" RELATED [ChEBI]
synonym: "acylamide amidohydrolase inhibitor" RELATED [ChEBI]
synonym: "acylamide amidohydrolase inhibitors" RELATED [ChEBI]
synonym: "amidase (EC 3.5.1.4) inhibitor" RELATED [ChEBI]
synonym: "amidase (EC 3.5.1.4) inhibitors" RELATED [ChEBI]
synonym: "amidase inhibitor" RELATED [ChEBI]
synonym: "amidase inhibitors" RELATED [ChEBI]
synonym: "amidohydrolase inhibitor" RELATED [ChEBI]
synonym: "amidohydrolase inhibitors" RELATED [ChEBI]
synonym: "deaminase inhibitor" RELATED [ChEBI]
synonym: "deaminase inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.1.4 (amidase) inhibitors" RELATED [ChEBI]
synonym: "EC 3.5.1.4 inhibitor" RELATED [ChEBI]
synonym: "EC 3.5.1.4 inhibitors" RELATED [ChEBI]
synonym: "fatty acylamidase inhibitor" RELATED [ChEBI]
synonym: "fatty acylamidase inhibitors" RELATED [ChEBI]
synonym: "N-acetylaminohydrolase inhibitor" RELATED [ChEBI]
synonym: "N-acetylaminohydrolase inhibitors" RELATED [ChEBI]
xref: Wikipedia:Amidase
is_a: CHEBI:76807 ! EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor

[Term]
id: CHEBI:77974
name: food packaging gas
namespace: chebi_ontology
def: "A food additive that is a (generally inert) gas which is used to envelop foodstuffs during packing and so protect them from unwanted chemical reactions such as food spoilage or oxidation during subsequent transport and storage. The term includes propellant gases, used to expel foods from a container." []
subset: 3_STAR
synonym: "food packaging gases" RELATED [ChEBI]
xref: Wikipedia:Packaging_gas
is_a: CHEBI:64047 ! food additive

[Term]
id: CHEBI:78115
name: fatty acid anion 4:0
namespace: chebi_ontology
def: "Any saturated fatty acid anion containing 4 carbons. Formed by deprotonation of the carboxylic acid moiety. Major species at pH 7.3." []
subset: 3_STAR
synonym: "fatty acid 4:0" RELATED [UniProt]
is_a: CHEBI:58951 ! short-chain fatty acid anion
is_a: CHEBI:58953 ! saturated fatty acid anion
relationship: is_conjugate_base_of CHEBI:140601 ! fatty acid 4:0
property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H7O2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "87.09718" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.04460" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string

[Term]
id: CHEBI:78295
name: food component
namespace: chebi_ontology
def: "A physiological role played by any substance that is distributed in foodstuffs. It includes materials derived from plants or animals, such as vitamins or minerals, as well as environmental contaminants." []
subset: 3_STAR
synonym: "dietary component" RELATED [ChEBI]
synonym: "dietary components" RELATED [ChEBI]
synonym: "food components" RELATED [ChEBI]
is_a: CHEBI:52211 ! physiological role

[Term]
id: CHEBI:78433
name: refrigerant
namespace: chebi_ontology
def: "A substance used in a thermodynamic heat pump cycle or refrigeration cycle that undergoes a phase change from a gas to a liquid and back. Refrigerants are used in air-conditioning systems and freezers or refrigerators and are assigned a \"R\" number (by ASHRAE - formerly the American Society of Heating, Refrigerating and Air Conditioning Engineers), which is determined systematically according to their molecular structure." []
subset: 3_STAR
synonym: "refrigerants" RELATED [ChEBI]
xref: Wikipedia:Refrigerant
is_a: CHEBI:33232 ! application

[Term]
id: CHEBI:78608
name: alpha-amino acid zwitterion
namespace: chebi_ontology
alt_id: CHEBI:83409
def: "An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of any alpha-amino acid; major species at pH 7.3." []
subset: 3_STAR
synonym: "an alpha-amino acid" RELATED [UniProt]
xref: MetaCyc:Alpha-Amino-Acids {source="SUBMITTER"}
is_a: CHEBI:35238 ! amino acid zwitterion
relationship: is_tautomer_of CHEBI:33704 ! alpha-amino acid
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]C([*])C([O-])=O" xsd:string

[Term]
id: CHEBI:78616
name: carbohydrates and carbohydrate derivatives
namespace: chebi_ontology
def: "Any organooxygen compound that is a polyhydroxy-aldehyde or -ketone, or a compound derived from one. Carbohydrates contain only carbon, hydrogen and oxygen and usually have an empirical formula Cm(H2O)n; carbohydrate derivatives may contain other elements by substitution or condensation." []
subset: 3_STAR
synonym: "carbohydrates and derivatives" RELATED [ChEBI]
synonym: "carbohydrates and their derivatives" RELATED [ChEBI]
is_a: CHEBI:36963 ! organooxygen compound

[Term]
id: CHEBI:78675
name: fundamental metabolite
namespace: chebi_ontology
def: "Any metabolite produced by all living cells." []
subset: 3_STAR
synonym: "essential metabolite" RELATED [ChEBI]
synonym: "essential metabolites" RELATED [ChEBI]
synonym: "fundamental metabolites" RELATED [ChEBI]
is_a: CHEBI:25212 ! metabolite

[Term]
id: CHEBI:7872
name: oxytocin
namespace: chebi_ontology
def: "A cyclic nonapeptide hormone with amino acid sequence CYIQNCPLG that also acts as a neurotransmitter in the brain; the principal uterine-contracting and milk-ejecting hormone of the posterior pituitary. Together with the neuropeptide vasopressin, it is believed to influence social cognition and behaviour." []
subset: 3_STAR
synonym: "(1-Hemicystine)oxytocin" RELATED [ChemIDplus]
synonym: "1-({(4R,7S,10S,13S,16S,19R)-19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-16-(4-hydroxybenzyl)-13-[(1S)-1-methylpropyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-4-yl}carbonyl)-L-prolyl-L-leucylglycinamide" EXACT IUPAC_NAME [IUPAC]
synonym: "3-Isoleucine-8-leucine vasopressin" RELATED [ChemIDplus]
synonym: "Endopituitrina" RELATED [ChemIDplus]
synonym: "L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-leucylglycinamide cyclic(1-6)-disulfide" RELATED [ChemIDplus]
synonym: "Ocytocin" RELATED [KEGG_COMPOUND]
synonym: "Orasthin" RELATED BRAND_NAME [ChemIDplus]
synonym: "OT" RELATED [KEGG_COMPOUND]
synonym: "oxitocina" RELATED INN [ChemIDplus]
synonym: "OXT" RELATED [KEGG_COMPOUND]
synonym: "Oxytocin" EXACT [KEGG_COMPOUND]
synonym: "oxytocin" RELATED INN [ChemIDplus]
synonym: "oxytocine" RELATED INN [ChemIDplus]
synonym: "oxytocinum" RELATED INN [ChemIDplus]
synonym: "Pitocin" RELATED BRAND_NAME [DrugBank]
synonym: "Piton S" RELATED BRAND_NAME [ChemIDplus]
synonym: "Syntocinon" RELATED BRAND_NAME [DrugBank]
synonym: "Syntocinon" RELATED BRAND_NAME [ChemIDplus]
xref: Beilstein:3586108 {source="Beilstein"}
xref: CAS:50-56-6 {source="ChemIDplus"}
xref: Drug_Central:2042 {source="DrugCentral"}
xref: DrugBank:DB00107
xref: HMDB:HMDB0002865
xref: KEGG:C00746
xref: KEGG:D00089
xref: Patent:US2938891
xref: Patent:US3076797
xref: PMID:10027619 {source="Europe PMC"}
xref: PMID:10834934 {source="Europe PMC"}
xref: PMID:10949083 {source="Europe PMC"}
xref: PMID:10949750 {source="Europe PMC"}
xref: PMID:10983343 {source="Europe PMC"}
xref: PMID:11134819 {source="Europe PMC"}
xref: PMID:13305558 {source="Europe PMC"}
xref: PMID:15815422 {source="Europe PMC"}
xref: PMID:18593851 {source="Europe PMC"}
xref: PMID:18988842 {source="Europe PMC"}
xref: PMID:19104313 {source="Europe PMC"}
xref: PMID:19369205 {source="Europe PMC"}
xref: PMID:19482229 {source="Europe PMC"}
xref: PMID:24706799 {source="Europe PMC"}
xref: PMID:25209411 {source="Europe PMC"}
xref: PMID:32509991 {source="Europe PMC"}
xref: PMID:32683141 {source="Europe PMC"}
xref: PMID:32979349 {source="Europe PMC"}
xref: PMID:33192340 {source="Europe PMC"}
xref: Wikipedia:Oxytocin
is_a: CHEBI:24533 ! heterodetic cyclic peptide
is_a: CHEBI:25905 ! peptide hormone
relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent
relationship: RO:0000087 CHEBI:36063 ! has role oxytocic
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C43H66N12O12S2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C43H66N12O12S2/c1-5-22(4)35-42(66)49-26(12-13-32(45)57)38(62)51-29(17-33(46)58)39(63)53-30(20-69-68-19-25(44)36(60)50-28(40(64)54-35)16-23-8-10-24(56)11-9-23)43(67)55-14-6-7-31(55)41(65)52-27(15-21(2)3)37(61)48-18-34(47)59/h8-11,21-22,25-31,35,56H,5-7,12-20,44H2,1-4H3,(H2,45,57)(H2,46,58)(H2,47,59)(H,48,61)(H,49,66)(H,50,60)(H,51,62)(H,52,65)(H,53,63)(H,54,64)/t22-,25-,26-,27-,28-,29-,30-,31-,35-/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XNOPRXBHLZRZKH-DSZYJQQASA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "1007.18982" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1006.43646" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]1(NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@@H](N)CSSC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)NCC(N)=O)[C@@H](C)CC" xsd:string

[Term]
id: CHEBI:78840
name: olefinic compound
namespace: chebi_ontology
def: "Any organic molecular entity that contains at least one C=C bond." []
subset: 3_STAR
synonym: "olefinic compounds" RELATED [ChEBI]
is_a: CHEBI:50860 ! organic molecular entity

[Term]
id: CHEBI:79387
name: trivalent inorganic anion
namespace: chebi_ontology
def: "Any inorganic anion with a valency of three." []
subset: 3_STAR
synonym: "trivalent inorganic anions" RELATED [ChEBI]
is_a: CHEBI:24834 ! inorganic anion

[Term]
id: CHEBI:79388
name: divalent inorganic anion
namespace: chebi_ontology
def: "Any inorganic anion with a valency of two." []
subset: 3_STAR
synonym: "divalent inorganic anions" RELATED [ChEBI]
is_a: CHEBI:24834 ! inorganic anion

[Term]
id: CHEBI:79389
name: monovalent inorganic anion
namespace: chebi_ontology
def: "Any inorganic anion with a valency of one." []
subset: 3_STAR
synonym: "monovalent inorganic anions" RELATED [ChEBI]
is_a: CHEBI:24834 ! inorganic anion

[Term]
id: CHEBI:82663
name: elemental iron
namespace: chebi_ontology
def: "An elemental molecular entity in which all of the atoms have atomic number 26." []
subset: 3_STAR
is_a: CHEBI:24873 ! iron molecular entity
is_a: CHEBI:33259 ! elemental molecular entity

[Term]
id: CHEBI:83039
name: crustacean metabolite
namespace: chebi_ontology
def: "An animal metabolite produced by arthropods such as crabs, lobsters, crayfish, shrimps and krill." []
subset: 3_STAR
synonym: "crustacean metabolites" RELATED [ChEBI]
is_a: CHEBI:75767 ! animal metabolite

[Term]
id: CHEBI:83056
name: Daphnia magna metabolite
namespace: chebi_ontology
def: "A Daphnia metabolite produced by the species Daphnia magna." []
subset: 3_STAR
synonym: "Daphnia magna metabolites" RELATED [ChEBI]
is_a: CHEBI:83057 ! Daphnia metabolite

[Term]
id: CHEBI:83057
name: Daphnia metabolite
namespace: chebi_ontology
def: "A crustacean metabolite produced by the genus of small planktonic arthropods, Daphnia" []
subset: 3_STAR
synonym: "Daphnia metabolites" RELATED [ChEBI]
xref: Wikipedia:Daphnia
is_a: CHEBI:83039 ! crustacean metabolite

[Term]
id: CHEBI:83813
name: proteinogenic amino acid
namespace: chebi_ontology
def: "Any of the 23 alpha-amino acids that are precursors to proteins, and are incorporated into proteins during translation. The group includes the 20 amino acids encoded by the nuclear genes of eukaryotes together with selenocysteine, pyrrolysine, and N-formylmethionine. Apart from glycine, which is non-chiral, all have L configuration." []
subset: 3_STAR
synonym: "canonical amino acid" RELATED [ChEBI]
synonym: "canonical amino acids" RELATED [ChEBI]
synonym: "proteinogenic amino acids" RELATED [ChEBI]
xref: Wikipedia:Proteinogenic_amino_acid
is_a: CHEBI:33575 ! carboxylic acid
is_a: CHEBI:35352 ! organonitrogen compound

[Term]
id: CHEBI:83820
name: non-proteinogenic amino acid
namespace: chebi_ontology
def: "Any amino-acid that is not naturally encoded in the genetic code of any organism." []
subset: 3_STAR
synonym: "non-canonical amino acid" RELATED [ChEBI]
synonym: "non-canonical amino acids" RELATED [ChEBI]
synonym: "non-canonical amino-acid" RELATED [ChEBI]
synonym: "non-canonical amino-acids" RELATED [ChEBI]
synonym: "non-coded amino acid" RELATED [ChEBI]
synonym: "non-coded amino acids" RELATED [ChEBI]
synonym: "non-coded amino-acid" RELATED [ChEBI]
synonym: "non-coded amino-acids" RELATED [ChEBI]
synonym: "non-proteinogenic amino acids" RELATED [ChEBI]
synonym: "non-proteinogenic amino-acid" RELATED [ChEBI]
synonym: "non-proteinogenic amino-acids" RELATED [ChEBI]
xref: Wikipedia:Non-proteinogenic_amino_acids
is_a: CHEBI:33709 ! amino acid

[Term]
id: CHEBI:83821
name: amino acid derivative
namespace: chebi_ontology
alt_id: CHEBI:25359
def: "Any derivative of an amino acid resulting from reaction at an amino group, carboxy group, side-chain functional group, or from the replacement of any hydrogen by a heteroatom. The definition normally excludes peptides containing amino acid residues." []
subset: 3_STAR
synonym: "amino acid derivatives" RELATED [ChEBI]
synonym: "modified amino acids" RELATED [ChEBI]
is_a: CHEBI:35352 ! organonitrogen compound

[Term]
id: CHEBI:8386
name: pregnane
namespace: chebi_ontology
subset: 3_STAR
synonym: "pregnane" EXACT IUPAC_NAME [IUPAC]
xref: LIPID_MAPS_instance:LMST02030000 {source="LIPID MAPS"}
xref: Wikipedia:Pregnane
is_a: CHEBI:35508 ! steroid fundamental parent
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H36" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H36/c1-4-15-9-11-18-17-10-8-16-7-5-6-13-20(16,2)19(17)12-14-21(15,18)3/h15-19H,4-14H2,1-3H3/t15-,16?,17-,18-,19-,20-,21+/m0/s1" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/inchikey "JWMFYGXQPXQEEM-WZBAXQLOSA-N" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "288.51054" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.28170" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]1(CC)CC[C@@]2([H])[C@]3([H])CCC4([H])CCCC[C@]4(C)[C@@]3([H])CC[C@]12C" xsd:string

[Term]
id: CHEBI:84087
name: human urinary metabolite
namespace: chebi_ontology
def: "Any metabolite (endogenous or exogenous) found in human urine samples." []
subset: 3_STAR
synonym: "human urinary metabolites" RELATED [ChEBI]
is_a: CHEBI:77746 ! human metabolite

[Term]
id: CHEBI:84729
name: hydroxyindoles
namespace: chebi_ontology
def: "Any member of the class of  indoles carrying at least one hydroxy group." []
subset: 3_STAR
is_a: CHEBI:24828 ! indoles
is_a: CHEBI:33822 ! organic hydroxy compound

[Term]
id: CHEBI:84735
name: algal metabolite
namespace: chebi_ontology
def: "Any eukaryotic metabolite produced during a metabolic reaction in algae including unicellular organisms like chlorella and diatoms to multicellular organisms like giant kelps and brown algae." []
subset: 3_STAR
synonym: "algal metabolites" RELATED [ChEBI]
is_a: CHEBI:75763 ! eukaryotic metabolite

[Term]
id: CHEBI:90710
name: receptor modulator
namespace: chebi_ontology
def: "A drug that acts as an antagonist, agonist, reverse agonist, or in some other fashion when interacting with cellular receptors." []
subset: 3_STAR
synonym: "receptor modulators" RELATED [ChEBI]
is_a: CHEBI:23888 ! drug

[Term]
id: CHEBI:9937
name: vasopressin
namespace: chebi_ontology
def: "A family of cyclic nonapeptide hormones found in most mammals. Synthesised in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Together with the similar neuropeptide oxytocin, they are believed to influence social cognition and behaviour." []
subset: 3_STAR
synonym: "ADH" RELATED [KEGG_COMPOUND]
synonym: "Antidiuretic hormone" RELATED [KEGG_COMPOUND]
synonym: "arginine vasopressin" RELATED [ChEBI]
synonym: "argipressin" RELATED [ChEBI]
synonym: "AVP" RELATED [ChEBI]
synonym: "beta-Hypophamine" RELATED [ChemIDplus]
synonym: "Inyectable de vasopresina" RELATED INN [ChemIDplus]
synonym: "Solute injectable de vasopressine" RELATED INN [ChemIDplus]
synonym: "Vasopressin" EXACT [KEGG_COMPOUND]
synonym: "Vasopressini injectio" RELATED INN [ChemIDplus]
synonym: "VP" RELATED [KEGG_COMPOUND]
xref: CAS:11000-17-2 {source="ChemIDplus"}
xref: KEGG:C00840
xref: KEGG:D00101
xref: PMID:18988842 {source="Europe PMC"}
xref: PMID:20445498 {source="Europe PMC"}
is_a: CHEBI:24533 ! heterodetic cyclic peptide
is_a: CHEBI:25905 ! peptide hormone
property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/formula "C46H65N15O12S2.C46H65N13O12S2" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/mass "2140.458" xsd:string
property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "2138.86956" xsd:string

[Term]
id: CL:0000000
name: cell
namespace: cell
def: "A material entity of anatomical origin (part of or deriving from an organism) that has as its parts a maximally connected cell compartment surrounded by a plasma membrane." [CARO:mah]
comment: The definition of cell is intended to represent all cells, and thus a cell is defined as a material entity and not an anatomical structure, which implies that it is part of an organism (or the entirety of one).
subset: ubprop:upper_level
xref: CALOHA:TS-2035
xref: FMA:68646
xref: GO:0005623
xref: KUPO:0000002
xref: VHOG:0001533
xref: WBbt:0004017
xref: XAO:0003012
disjoint_from: GO:0031012 ! extracellular matrix
disjoint_from: GO:0032991 ! protein-containing complex
disjoint_from: GO:0043226 ! organelle
relationship: has_part GO:0005634 {gci_filler="PATO:0001407", gci_relation="bearer_of"} ! nucleus
relationship: has_part GO:0005634 {gci_filler="PATO:0001908", gci_relation="bearer_of"} ! nucleus
relationship: only_in_taxon NCBITaxon:131567 ! cellular organisms

[Term]
id: CL:0000001
name: primary cultured cell
namespace: cell
def: "A cultured cell that is freshly isolated from a organismal source, or derives in culture from such a cell prior to the culture being passaged." [ReO:mhb]
comment: Covers cells actively being cultured or stored in a quiescent state for future use.
synonym: "primary cell culture cell" EXACT []
synonym: "primary cell line cell" RELATED []
synonym: "unpassaged cultured cell" EXACT []
xref: BTO:0002290
is_a: CL:0000010 ! cultured cell

[Term]
id: CL:0000002
name: obsolete immortal cell line cell
namespace: cell
def: "OBSOLETE: A cell line cell that is expected to be capable of an unlimited number of divisions, and is thus able to support indefinite growth/propagation in vitro as part of a immortal cell line." [ReO:mhb]
comment: Obsoleted in July 2013 and replaced by the CLO 'immortal cell line cell' class, as a result of CLO-OBI-CL alignment efforts.\n\nCovers cells actively being cultured or stored in a quiescent state for future use.
synonym: "continuous cell line cell" EXACT []
synonym: "permanent cell line cell" EXACT []
is_obsolete: true
replaced_by: CLO:0000019

[Term]
id: CL:0000003
name: native cell
namespace: cell
def: "A cell that is found in a natural setting, which includes multicellular organism cells 'in vivo' (i.e. part of an organism), and unicellular organisms 'in environment' (i.e. part of a natural environment)." [CARO:mah]
comment: To accommodate unicellular organisms better, 'cell in vivo' has been re-labeled 'native cell' to better represent its intended meaning - that is, that it is a cell in the context of a multicellular organism or in a natural environment. 'Native' is intended to contrast with 'in vitro', which refers to cells or other biological entities that have been intentionally placed in a controlled, non-natural setting for the purpose of study or manipulation. (MAH 1.12.12).
subset: ubprop:upper_level
synonym: "cell in vivo" NARROW []
xref: CARO:0000013
is_a: CL:0000000 ! cell

[Term]
id: CL:0000004
name: obsolete cell by organism
namespace: cell
def: "OBSOLETE: A classification of cells by the organisms within which they are contained." [FB:ma]
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its species. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000005
name: fibroblast neural crest derived
namespace: cell
def: "Any fibroblast that is deriived from the neural crest." [https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000057 ! fibroblast
intersection_of: CL:0000057 ! fibroblast
intersection_of: develops_from CL:0000333 ! migratory neural crest cell
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell

[Term]
id: CL:0000006
name: neuronal receptor cell
namespace: cell
synonym: "neuronal receptor cell (sensu Animalia)" EXACT []
is_a: CL:0000101 ! sensory neuron
is_a: CL:0000197 ! sensory receptor cell
intersection_of: CL:0000197 ! sensory receptor cell
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception

[Term]
id: CL:0000007
name: early embryonic cell (metazoa)
namespace: cell
def: "A cell found in the embryo before the formation of all the gem layers is complete." [GOC:tfm]
is_a: CL:0002321 ! embryonic cell (metazoa)

[Term]
id: CL:0000008
name: migratory cranial neural crest cell
namespace: cell
def: "Cell that is part of the migratory cranial neural crest population. Migratory cranial neural crest cells develop from premigratory cranial neural crest cells and have undergone epithelial to mesenchymal transition and delamination." [https://orcid.org/0000-0001-5208-3432, ZFA:0007091]
is_a: CL:0000333 ! migratory neural crest cell

[Term]
id: CL:0000009
name: obsolete fusiform initial
namespace: cell
alt_id: CL:0000274
def: "Obsolete. Use PO:0000079 from Plant Ontology instead. An elongated cell with approximately wedge-shaped ends, found in the vascular cambium, which gives rise to the elements of the axial system in the secondary vascular tissues." [ISBN:0471245208]
comment: replaced_by: PO:0000079
synonym: "xylem initial" RELATED []
synonym: "xylem mother cell" RELATED []
is_obsolete: true

[Term]
id: CL:0000010
name: cultured cell
namespace: cell
def: "A cell in vitro that is or has been maintained or propagated as part of a cell culture." [ReO:mhb]
comment: Note that this class was re-labeled to 'cultured cell' instead of 'cell line cell', as it intent was clarified to cover any cultured cells of multicellular and unicellular organisms. This includes cells actively being cultured, or cells that have been cultured but are stored in a quiescent state for future use. In having been cultured, cells must establish homeostasis and often replicate in a foreign environment. Accomodation of this stress initiates a selection of cells fit for such challenges, wherein necessary adaptive biochemical and.or genetic changes can occur. These changes can set them apart from the in vivo cells from which they derive, and such changes will typically accumulate and change over increasing time in culture.
is_a: CL:0000578 ! experimentally modified cell in vitro

[Term]
id: CL:0000011
name: migratory trunk neural crest cell
namespace: cell
def: "Cell that is part of the migratory trunk neural crest population. Migratory trunk neural crest cells develop from premigratory trunk neural crest cells and have undergone epithelial to mesenchymal transition and delamination." [https://orcid.org/0000-0001-5208-3432, ZFA:0007095]
is_a: CL:0000333 ! migratory neural crest cell

[Term]
id: CL:0000012
name: obsolete cell by class
namespace: cell
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000013
name: obsolete dentine secreting cell
namespace: cell
is_obsolete: true
consider: CL:0000140

[Term]
id: CL:0000014
name: germ line stem cell
namespace: cell
synonym: "germline stem cell" EXACT []
is_a: CL:0000034 {is_inferred="true"} ! stem cell
is_a: CL:0000039 {is_inferred="true"} ! germ line cell
intersection_of: CL:0000039 ! germ line cell
intersection_of: capable_of GO:0017145 ! stem cell division

[Term]
id: CL:0000015
name: male germ cell
namespace: cell
def: "Male germ cell is a germ cell that supports male gamete production." [https://orcid.org/0000-0001-5208-3432]
xref: FMA:72290
xref: MA:0002765
xref: ncithesaurus:Spermatogenic_Cell
xref: VHOG:0001531
is_a: CL:0000586 {is_inferred="true"} ! germ cell
intersection_of: CL:0000586 ! germ cell
intersection_of: capable_of GO:0007283 ! spermatogenesis
relationship: capable_of GO:0007283 ! spermatogenesis

[Term]
id: CL:0000016
name: male germ line stem cell
namespace: cell
is_a: CL:0000014 ! germ line stem cell
is_a: CL:0000015 ! male germ cell

[Term]
id: CL:0000017
name: spermatocyte
namespace: cell
def: "A male germ cell that develops from spermatogonia. The euploid primary spermatocytes undergo meiosis and give rise to the haploid secondary spermatocytes which in turn give rise to spermatids." [GOC:tfm, MESH:A05.360.490.890.880]
xref: BTO:0001275
xref: CALOHA:TS-0951
xref: EMAPA:31484
xref: FBbt:00004936
xref: FMA:84049
xref: WBbt:0006799
is_a: CARO:0000000
is_a: CL:0000015 {is_inferred="true"} ! male germ cell
intersection_of: CL:0000015 ! male germ cell
intersection_of: capable_of GO:0048137 ! spermatocyte division
relationship: capable_of GO:0048137 ! spermatocyte division
relationship: develops_from CL:0000020 ! spermatogonium

[Term]
id: CL:0000018
name: spermatid
namespace: cell
def: "A male germ cell that develops from the haploid secondary spermatocytes. Without further division, spermatids undergo structural changes and give rise to spermatozoa." [MESH:A05.360.490.890.860]
synonym: "nematoblast" EXACT []
xref: BTO:0001274
xref: CALOHA:TS-0950
xref: EMAPA:31486
xref: FBbt:00004942
xref: FMA:72294
xref: WBbt:0006800
is_a: CARO:0000000
is_a: CL:0000015 {is_inferred="true"} ! male germ cell
is_a: CL:0000413 ! haploid cell
intersection_of: CL:0000015 ! male germ cell
intersection_of: bearer_of PATO:0001375 ! haploid
intersection_of: capable_of GO:0001675 ! acrosome assembly
intersection_of: capable_of GO:0007288 ! sperm axoneme assembly
intersection_of: capable_of GO:0007289 ! spermatid nucleus differentiation
relationship: capable_of GO:0001675 ! acrosome assembly
relationship: capable_of GO:0007288 ! sperm axoneme assembly
relationship: capable_of GO:0007289 ! spermatid nucleus differentiation
relationship: develops_from CL:0000657 ! secondary spermatocyte

[Term]
id: CL:0000019
name: sperm
namespace: cell
def: "A mature male germ cell that develops from a spermatid." [GOC:tfm, MESH:A05.360.490.890]
synonym: "sperm cell" EXACT []
synonym: "spermatozoid" EXACT []
synonym: "spermatozoon" EXACT []
xref: BTO:0001277
xref: BTO:0002046
xref: CALOHA:TS-0949
xref: FBbt:00004954
xref: FMA:67338
xref: WBbt:0006798
is_a: CARO:0000000
is_a: CL:0000408 {is_inferred="true"} ! male gamete
relationship: develops_from CL:0000018 ! spermatid

[Term]
id: CL:0000020
name: spermatogonium
namespace: cell
def: "An euploid male germ cell of an early stage of spermatogenesis." [MESH:A05.360.490.890.900]
synonym: "spermatogonial cell" EXACT []
xref: BTO:0000958
xref: CALOHA:TS-2193
xref: EMAPA:31482
xref: FBbt:00004935
xref: FMA:72291
is_a: CL:0000015 ! male germ cell
intersection_of: CL:0000015 ! male germ cell
intersection_of: bearer_of PATO:0001394 ! diploid
intersection_of: bearer_of PATO:0001501 ! immature
relationship: bearer_of PATO:0001394 ! diploid
relationship: bearer_of PATO:0001501 ! immature

[Term]
id: CL:0000021
name: female germ cell
namespace: cell
def: "Female germ cell is a germ cell that supports female gamete production." [GOC:tfm, PMID:11023867, PMID:20454446]
xref: MA:0000388
xref: ncithesaurus:Egg
xref: VHOG:0001530
is_a: CL:0000586 {is_inferred="true"} ! germ cell
intersection_of: CL:0000586 ! germ cell
intersection_of: capable_of GO:0048477 ! oogenesis
relationship: capable_of GO:0048477 ! oogenesis

[Term]
id: CL:0000022
name: female germ line stem cell
namespace: cell
is_a: CL:0000014 {is_inferred="true"} ! germ line stem cell
is_a: CL:0000021 {is_inferred="true"} ! female germ cell
intersection_of: CL:0000021 ! female germ cell
intersection_of: capable_of GO:0017145 ! stem cell division

[Term]
id: CL:0000023
name: oocyte
namespace: cell
def: "A female germ cell that has entered meiosis." [GOC:tfm, ISBN:0721662544]
synonym: "oogonium" RELATED []
xref: BTO:0000964
xref: CALOHA:TS-0711
xref: FBbt:00004886
xref: FMA:18644
xref: WBbt:0006797
is_a: CL:0000021 {is_inferred="true"} ! female germ cell
is_a: CL:0000548 ! animal cell
relationship: participates_in GO:0007143 ! female meiotic nuclear division

[Term]
id: CL:0000024
name: oogonial cell
namespace: cell
def: "An undifferentiated germ cell that proliferates rapidly and gives rise to oocytes." [GOC:tfm, ISBN:0721662544]
xref: FMA:83673
is_a: CARO:0000000
is_a: CL:0000021 {is_inferred="true"} ! female germ cell
intersection_of: CL:0000021 ! female germ cell
intersection_of: capable_of GO:0000278 ! mitotic cell cycle
relationship: capable_of GO:0000278 ! mitotic cell cycle
relationship: develops_from CL:0000670 ! primordial germ cell

[Term]
id: CL:0000025
name: egg cell
namespace: cell
def: "A female gamete where meiosis has progressed to metaphase II and is able to participate in fertilization." [GOC:tfm, ISBN:0721662544]
synonym: "mature oocyte" EXACT []
synonym: "ovum" EXACT []
xref: BTO:0000369
xref: BTO:0003801
xref: CALOHA:TS-2191
xref: FBbt:00057012
xref: FMA:67343
xref: MA:0000388
is_a: CARO:0000000
is_a: CL:0000675 {is_inferred="true"} ! female gamete
relationship: develops_from CL:0000023 ! oocyte
relationship: participates_in GO:0007143 ! female meiotic nuclear division

[Term]
id: CL:0000026
name: invertebrate nurse cell
namespace: cell
def: "A germline cell that contributes to the development of the oocyte by transferring cytoplasm directly to oocyte." [GOC:tfm, PMID:15848391]
synonym: "nurse cell" RELATED []
xref: BTO:0000953
xref: FBbt:00004878
is_a: CARO:0000000
is_a: CL:0000039 ! germ line cell
is_a: CL:0000412 ! polyploid cell
relationship: develops_from CL:0000722 ! cystoblast

[Term]
id: CL:0000027
name: smooth muscle cell neural crest derived
namespace: cell
def: "A smooth muscle cell derived from the neural crest." [https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell
intersection_of: CL:0000192 ! smooth muscle cell
intersection_of: develops_from CL:0000333 ! migratory neural crest cell
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell

[Term]
id: CL:0000028
name: CNS neuron (sensu Nematoda and Protostomia)
namespace: cell
is_a: CARO:0000000
is_a: CL:0000540 ! neuron
relationship: develops_from CL:0000338 ! neuroblast (sensu Nematoda and Protostomia)
relationship: part_of UBERON:0001017 ! central nervous system

[Term]
id: CL:0000029
name: neural crest derived neuron
namespace: cell
synonym: "neuron neural crest derived" EXACT []
is_a: CARO:0000000
is_a: CL:0000540 {is_inferred="true"} ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: develops_from CL:0000333 ! migratory neural crest cell
relationship: develops_from CL:0002676 ! neural crest derived neuroblast

[Term]
id: CL:0000030
name: glioblast
namespace: cell
xref: FBbt:00005145
is_a: CARO:0000000
is_a: CL:0000055 ! non-terminally differentiated cell
relationship: develops_from CL:0000133 ! neurectodermal cell

[Term]
id: CL:0000031
name: neuroblast (sensu Vertebrata)
namespace: cell
alt_id: CL:0000337
def: "A cell that will develop into a neuron often after a migration phase." [GOC:NV, http://en.wikipedia.org/wiki/Neuroblast]
synonym: "neuroblast" EXACT []
xref: BTO:0000930
xref: FMA:70563
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0000548 ! animal cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>

[Term]
id: CL:0000032
name: neuroplacodal cell
namespace: cell
def: "A cell of a platelike structure, especially a thickened plate of ectoderm in the early embryo, from which a sense organ develops." [GOC:tfm, ISBN:0618947256]
synonym: "neural placode cell" EXACT []
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0002321 ! embryonic cell (metazoa)
relationship: develops_from CL:0000114 ! surface ectodermal cell

[Term]
id: CL:0000033
name: apocrine cell
namespace: cell
def: "An apocrine cell is a secretory cell characterized loss of part of the cytoplasm during the process of secretion - secretions are budded off through the plasma membrane producing membrane bound vesicles containing the secreted substance." [GOC:tfm, ISBN:0721662544]
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000034
name: stem cell
namespace: cell
def: "A relatively undifferentiated cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells." [GOC:tfm, MESH:A11.872]
comment: This term applies to metazoan. For plant stem cells, consider using PO:0004011 ‘initial cell’ or its parent PO:0004010 ‘meristematic cell’.
synonym: "animal stem cell" EXACT []
xref: CALOHA:TS-2086
xref: FMA:63368
is_a: CL:0011115 ! precursor cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0017145 ! stem cell division
relationship: capable_of GO:0017145 ! stem cell division
relationship: in_taxon NCBITaxon:33208 ! Metazoa

[Term]
id: CL:0000035
name: single fate stem cell
namespace: cell
def: "A stem cell that self-renews as well as give rise to a single mature cell type." [GOC:tfm]
synonym: "unipotent stem cell" EXACT []
synonym: "unipotential stem cell" EXACT []
xref: FMA:70569
is_a: CL:0000723 ! somatic stem cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001400 ! unipotent
intersection_of: capable_of GO:0017145 ! stem cell division
relationship: bearer_of PATO:0001400 ! unipotent

[Term]
id: CL:0000036
name: epithelial fate stem cell
namespace: cell
synonym: "epithelial stem cell" EXACT []
is_a: CL:0000035 ! single fate stem cell

[Term]
id: CL:0000037
name: hematopoietic stem cell
namespace: cell
def: "A stem cell from which all cells of the lymphoid and myeloid lineages develop, including blood cells and cells of the immune system. Hematopoietic stem cells lack cell markers of effector cells (lin-negative). Lin-negative is defined by lacking one or more of the following cell surface markers: CD2, CD3 epsilon, CD4, CD5 ,CD8 alpha chain, CD11b, CD14, CD19, CD20, CD56, ly6G, ter119." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Hematopoietic_stem_cell, PMID:19022770]
comment: Markers differ between species, and two sets of markers have been described for mice. HSCs are reportedly CD34-positive, CD45-positive, CD48-negative, CD150-positive, CD133-positive, and CD244-negative.
synonym: "blood forming stem cell" EXACT []
synonym: "colony forming unit hematopoietic" RELATED []
synonym: "hemopoietic stem cell" EXACT []
synonym: "HSC" EXACT []
xref: BTO:0000725
xref: CALOHA:TS-0448
xref: FMA:70337
xref: FMA:86475
xref: VHOG:0001485
is_a: CL:0000723 ! somatic stem cell
is_a: CL:0008001 ! hematopoietic precursor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000988 ! hematopoietic cell
intersection_of: capable_of GO:0002244 ! hematopoietic progenitor cell differentiation
intersection_of: capable_of GO:0048103 ! somatic stem cell division
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: capable_of GO:0002244 ! hematopoietic progenitor cell differentiation
relationship: develops_from CL:0000566 ! angioblastic mesenchymal cell
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)

[Term]
id: CL:0000038
name: erythroid progenitor cell
namespace: cell
def: "A progenitor cell committed to the erythroid lineage." [GOC:add, ISBN:0721601464]
synonym: "BFU-E" RELATED []
synonym: "blast forming unit erythroid" RELATED []
synonym: "burst forming unit erythroid" RELATED []
synonym: "CFU-E" RELATED []
synonym: "colony forming unit erythroid" RELATED []
synonym: "erythroid stem cell" RELATED []
xref: BTO:0004911
is_a: CL:0000764 ! erythroid lineage cell
is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell
relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell

[Term]
id: CL:0000039
name: germ line cell
namespace: cell
def: "A cell that is within the developmental lineage of gametes and is able to pass along its genetic material to offspring." [GOC:tfm, ISBN:0721662544]
comment: Originally this term had some plant germ line cell children.
subset: ubprop:upper_level
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
disjoint_from: CL:0002371 ! somatic cell
relationship: capable_of GO:0022414 ! reproductive process

[Term]
id: CL:0000040
name: monoblast
namespace: cell
def: "A myeloid progenitor cell committed to the monocyte lineage. This cell is CD11b-positive, has basophilic cytoplasm, euchromatin, and the presence of a nucleolus." [GOC:add, http://en.wikipedia.org/wiki/Monoblast, http://www.copewithcytokines.de, PMID:1104740]
comment: Morphology: mononuclear cell, diameter 12-20 _M, non-granular, N/C ratio 3/1 - 4/1; markers: CD11b (shared with many other myeloid cells); location: Adult: bone marrow; fetal: liver, Yolk Sac; role or process: hematopoiesis, monocyte development; lineage: hematopoietic, myeloid.
synonym: "CFU-M" RELATED []
synonym: "colony forming unit macrophage" RELATED []
synonym: "colony forming unit monocyte" RELATED []
synonym: "monocyte stem cell" RELATED []
xref: CALOHA:TS-1195
xref: FMA:83553
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002194 {is_inferred="true"} ! monopoietic cell
intersection_of: CL:0002194 ! monopoietic cell
intersection_of: capable_of GO:0030224 ! monocyte differentiation
intersection_of: has_part CL:0017503 ! basophilic cytoplasm
intersection_of: has_part GO:0000791 ! euchromatin
intersection_of: has_part GO:0005730 ! nucleolus
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: develops_from CL:0002009 ! macrophage dendritic cell progenitor
relationship: has_part CL:0017503 ! basophilic cytoplasm
relationship: has_part GO:0000791 ! euchromatin
relationship: has_part GO:0005730 ! nucleolus
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M

[Term]
id: CL:0000041
name: mature eosinophil
namespace: cell
def: "A fully differentiated eosinophil, a granular leukocyte with a nucleus that usually has two lobes connected by one or more slender threads, and cytoplasm containing coarse, round granules that are uniform in size and which can be stained by the dye eosin. Cells are also differentiated from other granulocytes by a small nuclear-to-cytoplasm ratio (1:3). This cell type is CD49d-positive." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464]
comment: Eosinophils are CD125-positive (IL-5R), GM-CSFR-positive, IL-3R-positive, VLA4-positive. They can also express MHC Class I & II, CD4, CD9, CD11a, CD11b, CD11c, CD13, CD15, CD16, CD17, CD18, CD24, CD25,CD28, CD29, CD32, CD33, CD35, CD37, CD39, CD43, CD44, CD45, CD45RB, CD45RO, CD46, CD47, CD48, CD49d, CD49f, CD50, CD52, CD53, CD54, CD55, CD58, CD59, CD62L, CD63, CD65, CD66, CD69, CD71, CD76, CD80, CD81, CD82, CD86, CD87, CD88, CD89, CD92, CD95, CD97, CD98, CD99, CD100, CD101, CD116, CD117, CD119, CD120, CD123, CD124, CD125, CD131, CD137, CD139, CD148, CD149, CD151, CD153, CD156, CD162, CD161, CD162, CD165, CD174, CD182, CD183, CD191, CD192, CD193, CD196, CD213, IL9R, ad integrin, beta-7 integrin, FceRI, IL13Ra1, TGFbR, PAFR, LTB4R, C3aR, CystLT1R, CystLT2R, fMLPR, CRTH2 (PGD2 receptor), histamine 4R, IDO, KYN, PAR-2, Siglec-8, Siglec-10, LIR1, LIR2, LIR3, LIR7, TLR7, TLR8, and VLA-4. Eosinophils can also secrete CXCL1, eotaxin-1, GM-CSF, IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-13, IL-16, IL-18, IFN-gamma, LTC4, MIP-1alpha, NGF, PAF, RANTES, substance P, TGF-alpha, TGF-beta, TNF-alpha, and VIP.
synonym: "mature eosinocyte" EXACT []
synonym: "mature eosinophil leucocyte" EXACT []
synonym: "mature eosinophil leukocyte" EXACT []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
is_a: CL:0000145 ! professional antigen presenting cell
is_a: CL:0000771 {is_inferred="true"} ! eosinophil
relationship: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II
relationship: capable_of GO:0002540 ! leukotriene production involved in inflammatory response
relationship: capable_of GO:0045730 ! respiratory burst
relationship: develops_from CL:0000774 ! band form eosinophil
relationship: has_part PR:000007152 ! eosinophil peroxidase
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2
relationship: has_part PR:000014046 ! non-secretory ribonuclease
relationship: has_part PR:000014047 ! eosinophil cationic protein
relationship: has_part PR:000022006 ! eosinophil granule major basic protein
relationship: RO:0002104 PR:000009129 ! has plasma membrane part integrin alpha-4
property_value: editor_note "The status of eosinophils as true professional antigen presenting cells is unclear, despite their ability to present exogenous peptides and peptides processed from exogenous proteins (in certain studies) via MHC Class II and activate T cells. Per the equivalence axioms, 'eosinophil' is reasoned to be a subclass of 'professional antigen presenting cell', though the role of eosinophils as such in the body may be limited." xsd:string

[Term]
id: CL:0000042
name: neutrophilic myeloblast
namespace: cell
def: "A myeloblast committed to the neutrophil lineage. This cell type is GATA-1 positive, C/EBPa-positive, AML-1-positive, c-myb-positive and has low expression of PU.1 transcription factor." [GOC:add, ISBN:0721601464, PMID:12560239, PMID:15514007]
comment: These cells are CD11b-negative, CD15-negative, CD16-negative, CD35-negative, CD49d-positive, CD68-positive, lactotransferrin-negative, and fMLP receptor-negative. They are found in the Band 3 fraction.
synonym: "neutrophilic granuloblast" RELATED []
is_a: CL:0000834 ! neutrophil progenitor cell
is_a: CL:0000835 {is_inferred="true"} ! myeloblast
intersection_of: CL:0000835 ! myeloblast
intersection_of: capable_of GO:0030223 ! neutrophil differentiation
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000007857 ! erythroid transcription factor
intersection_of: has_part PR:000010799 ! myb proto-oncogene protein
intersection_of: has_part PR:000014362 ! runt-related transcription factor 1
relationship: develops_from CL:0000834 ! neutrophil progenitor cell
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: has_part PR:000010799 ! myb proto-oncogene protein
relationship: has_part PR:000014362 ! runt-related transcription factor 1

[Term]
id: CL:0000043
name: mature basophil
namespace: cell
alt_id: CL:0000739
def: "A fully differentiated basophil, a granular leukocyte with an irregularly shaped, pale-staining nucleus that is partially constricted into two lobes, and with cytoplasm that contains coarse granules of variable size. Basophils contain vasoactive amines such as histamine and serotonin, which are released on appropriate stimulation." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:18466030, PMID:19231594, PMID:20837449]
comment: Mature basophils are also capable of producing IL-3, IL-5, IL-6, IL-8, IL-13, IL-25, CCL22, tslp, vegf, and LTC4.
synonym: "mature basophil leucocyte" EXACT []
synonym: "mature basophil leukocyte" EXACT []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
xref: BTO:0001026
xref: CALOHA:TS-0688
is_a: CL:0000767 {is_inferred="true"} ! basophil
is_a: CL:0002274 ! histamine secreting cell
relationship: capable_of GO:0002349 ! histamine production involved in inflammatory response
relationship: capable_of GO:0002351 ! serotonin production involved in inflammatory response
relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response
relationship: capable_of GO:0032616 ! interleukin-13 production
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: capable_of GO:0048295 ! positive regulation of isotype switching to IgE isotypes
relationship: develops_from CL:0000770 ! band form basophil

[Term]
id: CL:0000045
name: obsolete thymus processed stem cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Consider using term 'pro-T cell ; CL:0000827' or the term 'thymocyte ; CL:0000893' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000046
name: obsolete bursa processed stem cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Consider using term 'pro-B cell ; CL:0000826' or the term 'immature B cell ; CL:0000816 or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000047
name: neuronal stem cell
namespace: cell
def: "Neural stem cell is characterized as an undifferentiated cell that originates from the neuroectoderm and has the capacity both to perpetually self-renew without differentiating and to generate multiple types of lineage-restricted progenitors." [GOC:tfm, http://en.wikipedia.org/wiki/Neural_stem_cell, MESH:D058953, PMID:15247488]
synonym: "neural stem cell" EXACT []
synonym: "NSC" EXACT []
xref: BTO:0002881
xref: CALOHA:TS-2360
xref: FMA:86684
is_a: CARO:0000000
is_a: CL:0000048 {is_inferred="true"} ! multi fate stem cell
intersection_of: CL:0000048 ! multi fate stem cell
intersection_of: part_of UBERON:0001017 ! central nervous system
relationship: develops_from CL:0000133 ! neurectodermal cell
relationship: part_of UBERON:0001017 ! central nervous system

[Term]
id: CL:0000048
name: multi fate stem cell
namespace: cell
def: "A stem cell that can give rise to multiple lineages of cells." [GOC:add]
synonym: "multi-fate stem cell" EXACT []
synonym: "multifate stem cell" EXACT []
synonym: "multipotent cell" EXACT []
synonym: "multipotent stem cell" EXACT []
xref: FMA:84789
is_a: CL:0000034 ! stem cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0002371 ! somatic cell
intersection_of: bearer_of PATO:0001402 ! multipotent
intersection_of: capable_of GO:0017145 ! stem cell division
relationship: bearer_of PATO:0001402 ! multipotent

[Term]
id: CL:0000049
name: common myeloid progenitor
namespace: cell
def: "A progenitor cell committed to myeloid lineage, including the megakaryocyte and erythroid lineages." [GOC:add, ISBN:0878932437, MESH:D023461]
comment: This cell type is intended to be compatible with any vertebrate common myeloid progenitor.  For mammalian CMP known to be CD34-positive, please use the term 'common myeloid progenitor, CD34-positive' (CL_0001059).
synonym: "CFU-GEMM" RELATED [ISBN:0878932437]
synonym: "CFU-S" RELATED [ISBN:0878932437]
synonym: "CMP" EXACT [ISBN:0878932437]
synonym: "colony forming unit granulocyte, erythrocyte, macrophage, and megakaryocyte" RELATED [ISBN:0878932437]
synonym: "common myeloid precursor" EXACT []
synonym: "multipotential myeloid stem cell" RELATED [ISBN:0878932437]
synonym: "myeloid stem cell" RELATED [ISBN:0878932437]
synonym: "pluripotent stem cell (bone marrow)" RELATED [ISBN:0878932437]
xref: BTO:0004730
is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell
disjoint_from: CL:0000050 ! megakaryocyte-erythroid progenitor cell
disjoint_from: CL:0000051 ! common lymphoid progenitor
disjoint_from: CL:0000557 ! granulocyte monocyte progenitor cell

[Term]
id: CL:0000050
name: megakaryocyte-erythroid progenitor cell
namespace: cell
def: "A progenitor cell committed to the megakaryocyte and erythroid lineages." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Megakaryocyte-erythroid_progenitor_cell, MESH:D055015, PMID:16647566]
comment: MEPs are reportedly CD19-negative, CD34-negative, CD45RA-negative, CD110-positive, CD117-positive, and SCA1-negative and reportedly express the transcription factors GATA-1 and NF-E2.
synonym: "CFU-EM" EXACT []
synonym: "CFU-MegE" EXACT []
synonym: "colony forming unit erythroid megakaryocyte" EXACT []
synonym: "Meg/E progenitor" EXACT []
synonym: "megakaryocyte/erythrocyte progenitor" EXACT []
synonym: "megakaryocyte/erythroid progenitor cell" EXACT []
synonym: "MEP" EXACT []
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell
intersection_of: capable_of GO:0030218 ! erythrocyte differentiation
intersection_of: capable_of GO:0030219 ! megakaryocyte differentiation
disjoint_from: CL:0000557 ! granulocyte monocyte progenitor cell
disjoint_from: CL:0002009 ! macrophage dendritic cell progenitor
relationship: capable_of GO:0030218 ! erythrocyte differentiation
relationship: capable_of GO:0030219 ! megakaryocyte differentiation

[Term]
id: CL:0000051
name: common lymphoid progenitor
namespace: cell
alt_id: CL:0000044
def: "A oligopotent progenitor cell committed to the lymphoid lineage." [GOC:add, GOC:dsd, GOC:tfm, PMID:10407577, PMID:16551251]
comment: CLP are CD7-positive, CD10-positive, CD19-negative, CD34-positive, CD45RA-positive, CD79a-negative, CD127-positive, AA4.1-positive, RAG-negative, Sca-1-low, sIgM-negative, sIgD-negative, TdT-negative, Vpre-B-negative, and pre-BCR-negative. Expression of transcription factors include E2A-positive, EBF-positive, Ikaros-negative, PU.1-negative, and Pax5-negative.
synonym: "CLP" EXACT []
synonym: "committed lymphopoietic stem cell" RELATED []
synonym: "common lymphocyte precursor" EXACT []
synonym: "common lymphocyte progenitor" EXACT []
synonym: "common lymphoid precursor" EXACT []
synonym: "early lymphocyte progenitor" RELATED []
synonym: "ELP" RELATED []
synonym: "lymphoid stem cell" RELATED []
synonym: "lymphopoietic stem cell" RELATED []
is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell
intersection_of: capable_of GO:0030098 ! lymphocyte differentiation
relationship: capable_of GO:0030098 ! lymphocyte differentiation

[Term]
id: CL:0000052
name: totipotent stem cell
namespace: cell
def: "A stem cell from which all cells of the body can form." [GOC:add, GOC:tfm]
synonym: "totipotential stem cell" EXACT []
xref: FMA:84790
is_a: CL:0000723 ! somatic stem cell

[Term]
id: CL:0000054
name: bone matrix secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000055
name: non-terminally differentiated cell
namespace: cell
def: "A precursor cell with a limited number of potential fates." [SANBI:mhl]
comment: define using PATO mulit-potent or oligopotent?
synonym: "blast cell" EXACT []
xref: BTO:0000125
xref: FMA:84782
is_a: CL:0011115 ! precursor cell

[Term]
id: CL:0000056
name: myoblast
namespace: cell
def: "A cell that is commited to differentiating into a muscle cell.  Embryonic myoblasts develop from the mesoderm. They undergo proliferation, migrate to their various sites, and then differentiate into the appropriate form of myocytes.  Myoblasts also occur as transient populations of cells in muscles undergoing repair." [GOC:tfm, MESH:A11.635, PMID:21849021]
xref: BTO:0000222
xref: CALOHA:TS-0650
xref: FBbt:00005083
xref: FMA:70335
xref: VHOG:0001529
is_a: CL:0000680 ! muscle precursor cell

[Term]
id: CL:0000057
name: fibroblast
namespace: cell
def: "A connective tissue cell which secretes an extracellular matrix rich in collagen and other macromolecules. Flattened and irregular in outline with branching processes; appear fusiform or spindle-shaped." [http://en.wikipedia.org/wiki/Fibroblast, ISBN:0517223651, MESH:A11.329.228, MESH:D005347]
comment: These cells may be vimentin-positive, fibronectin-positive, fsp1-positive, MMP-1-positive, collagen I-positive, collagen III-positive, and alpha-SMA-negative.
xref: BTO:0000452
xref: CALOHA:TS-0362
xref: FMA:63877
xref: VHOG:0001482
is_a: CARO:0000000
is_a: CL:0002320 ! connective tissue cell
relationship: develops_from CL:0000134 ! mesenchymal stem cell

[Term]
id: CL:0000058
name: chondroblast
namespace: cell
def: "Skeletogenic cell that is typically non-terminally differentiated, secretes an avascular, GAG rich matrix; is not buried in cartilage tissue matrix, retains the ability to divide, located adjacent to cartilage tissue (including within the perichondrium), and develops from prechondroblast (and thus prechondrogenic) cell." [GO_REF:0000034, GOC:tfm, ISBN:0618947256]
synonym: "chrondoplast" EXACT []
xref: BTO:0003607
xref: FMA:66783
is_a: CARO:0000000
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0002320 ! connective tissue cell
relationship: develops_from CL:0007009 ! prechondroblast
relationship: produces UBERON:0002418 ! cartilage tissue

[Term]
id: CL:0000059
name: ameloblast
namespace: cell
alt_id: CL:0000053
alt_id: CL:0000139
def: "Skeletogenic cell that produces enamel, overlies the odontogenic papilla, and arises from the differentiation of a preameloblast cell." [GO_REF:0000034, GOC:tfm, MESH:A11.436.107]
comment: non-encoded relationship from VSAO produces VSAO:0000066
synonym: "amelocyte" EXACT []
synonym: "enamel secreting cell" EXACT []
xref: BTO:0001663
xref: FMA:70576
is_a: CL:0000146 ! simple columnar epithelial cell
is_a: CL:0000151 ! secretory cell
is_a: CL:0002077 ! ecto-epithelial cell
relationship: adjacent_to UBERON:0001763 ! odontogenic papilla
relationship: capable_of GO:0097186 ! amelogenesis
relationship: develops_from CL:0007000 ! preameloblast
relationship: part_of UBERON:0005176 ! tooth enamel organ
relationship: produces UBERON:0001752 ! enamel

[Term]
id: CL:0000060
name: odontoblast
namespace: cell
def: "Skeletogenic cell that secretes dentine matrix, is derived from the odontogenic papilla, and develops from a preodontoblast cell." [GO_REF:0000034, ISBN:0618947256]
comment: legacy def: One of the cells forming the outer surface of dental pulp that produces tooth dentin.
xref: BTO:0001769
xref: CALOHA:TS-0696
xref: FMA:62999
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0000710 ! neurecto-epithelial cell
is_a: CL:0002159 ! general ecto-epithelial cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0007003 ! preodontoblast
relationship: part_of UBERON:0005176 ! tooth enamel organ
relationship: produces UBERON:0001751 ! dentine

[Term]
id: CL:0000061
name: cementoblast
namespace: cell
alt_id: CL:0000859
def: "Skeletogenic cell that produces cementum (a bony substance that covers the root of a tooth), is part of the odontogenic papilla, and develops from a precementoblast cell." [GO_REF:0000034, ISBN:0781733901]
comment: Legacy def: A cell of ectomesenchymal origin that aids in the formation the cementum layer on the roots of teeth.
synonym: "cementum secreting cell" EXACT []
xref: CALOHA:TS-1164
xref: FMA:63002
is_a: CL:0000062 ! osteoblast
is_a: CL:0000151 ! secretory cell
relationship: develops_from CL:0007002 ! precementoblast
relationship: part_of UBERON:0005176 ! tooth enamel organ
relationship: produces UBERON:0001753 ! cementum

[Term]
id: CL:0000062
name: osteoblast
namespace: cell
def: "Skeletogenic cell that secretes osteoid, is capable of producing mineralized (hydroxyapatite) matrix, is located adjacent to or within osteoid tissue, and arises from the transformation of a preosteoblast cell." [GO_REF:0000034, MESH:A11.329.629]
comment: non-encoded relationships from VSAO - capable_of_producing VSAO:0000020
xref: BTO:0001593
xref: CALOHA:TS-0720
xref: FMA:66780
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0002320 ! connective tissue cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0007010 ! preosteoblast
relationship: produces UBERON:0008883 ! osteoid

[Term]
id: CL:0000063
name: obsolete cell by histology
namespace: cell
def: "OBSOLETE: A classification of cells by their microscopic appearance." [FB:ma, GOC:tfm]
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its microscopic appearance. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000064
name: ciliated cell
namespace: cell
def: "A cell that has a filiform extrusion of the cell surface." [GOC:tfm]
xref: VHOG:0001532
xref: XAO:0000031
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: has_part GO:0005929 ! cilium
relationship: has_part GO:0005929 ! cilium

[Term]
id: CL:0000065
name: ependymal cell
namespace: cell
def: "A neurectoderm derived cell that lines the neural lumen." [GOC:tfm, JB:jb, PMID:9550134]
synonym: "ependymocyte" EXACT []
xref: BTO:0001724
xref: FMA:70550
is_a: CL:0000067 ! ciliated epithelial cell
is_a: CL:0000710 ! neurecto-epithelial cell

[Term]
id: CL:0000066
name: epithelial cell
namespace: cell
def: "A cell that is usually found in a two-dimensional sheet with a free surface. The cell has a cytoskeleton that allows for tight cell to cell contact and for cell polarity where apical part is directed towards the lumen and the basal part to the basal lamina." [FB:ma, GOC:tfm, MESH:A11.436]
synonym: "epitheliocyte" EXACT []
xref: BTO:0000414
xref: CALOHA:TS-2026
xref: CARO:0000077
xref: FBbt:00000124
xref: FMA:66768
xref: WBbt:0003672
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000548 ! animal cell
disjoint_from: CL:0000738 ! leukocyte
relationship: part_of UBERON:0000483 ! epithelium

[Term]
id: CL:0000067
name: ciliated epithelial cell
namespace: cell
def: "An epithelial cell that has a cilia." [GOC:tfm]
xref: FMA:70605
is_a: CL:0000064 ! ciliated cell
is_a: CL:0000066 ! epithelial cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: has_part GO:0005929 ! cilium

[Term]
id: CL:0000068
name: duct epithelial cell
namespace: cell
def: "An epithelial cell that is part of a duct." [https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: part_of UBERON:0000058 ! duct
relationship: part_of UBERON:0000058 ! duct

[Term]
id: CL:0000069
name: branched duct epithelial cell
namespace: cell
is_a: CL:0000068 ! duct epithelial cell

[Term]
id: CL:0000070
name: obsolete epithelial cell of gland
namespace: cell
is_obsolete: true

[Term]
id: CL:0000071
name: blood vessel endothelial cell
namespace: cell
def: "An endothelial cell that lines the vasculature." [GOC:tfm]
synonym: "cuboidal endothelial cell of vascular tree" EXACT []
is_a: CL:0000076 {is_inferred="true"} ! squamous epithelial cell
is_a: CL:0002139 ! endothelial cell of vascular tree
intersection_of: CL:0000076 ! squamous epithelial cell
intersection_of: part_of UBERON:0004638 ! blood vessel endothelium
relationship: develops_from CL:0002546 ! embryonic blood vessel endothelial progenitor cell
relationship: part_of UBERON:0004638 ! blood vessel endothelium

[Term]
id: CL:0000072
name: non-branched duct epithelial cell
namespace: cell
is_a: CL:0000068 ! duct epithelial cell
is_a: CL:0002078 ! meso-epithelial cell

[Term]
id: CL:0000073
name: barrier epithelial cell
namespace: cell
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000074
name: obsolete epithem cell
namespace: cell
def: "Obsolete. Use PO:0000066 from Plant Ontology instead. A cell that constitutes the mesophyll of a hydathode and is located between the xylem endings and the epidermis. Proposed to be involved in the retrieval of solutes from the xylem sap." [ISBN:0471245208, PMID:12662305]
comment: replaced_by: PO:0000066
is_obsolete: true

[Term]
id: CL:0000075
name: columnar/cuboidal epithelial cell
namespace: cell
def: "A columnar/cuboidal epithelial cell is a cell usually found in a two dimensional sheet with a free surface. Columnar/cuboidal epithelial cells take on the shape of a column or cube." [GO:0002065, https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000076
name: squamous epithelial cell
namespace: cell
xref: CALOHA:TS-1249
is_a: CL:0000066 ! epithelial cell

[Term]
id: CL:0000077
name: mesothelial cell
namespace: cell
def: "A flattened epithelial cell of mesenchymal origin that lines the serous cavity." [GOC:tfm, ISBN:0721662544]
synonym: "mesotheliocyte" EXACT []
xref: FMA:66773
is_a: CL:0000076 ! squamous epithelial cell
is_a: CL:0000213 ! lining cell
is_a: CL:0002078 ! meso-epithelial cell

[Term]
id: CL:0000078
name: peridermal cell
namespace: cell
is_a: CL:0000076 ! squamous epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000079
name: stratified epithelial cell
namespace: cell
is_a: CARO:0000000
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell
relationship: develops_from CL:0000357 ! stratified epithelial stem cell

[Term]
id: CL:0000080
name: circulating cell
namespace: cell
def: "A cell which moves among different tissues of the body, via blood, lymph, or other medium." [GOC:add]
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: part_of UBERON:0000179 ! haemolymphatic fluid
relationship: part_of UBERON:0000179 ! haemolymphatic fluid

[Term]
id: CL:0000081
name: blood cell
namespace: cell
def: "A cell found predominately in the blood." [GOC:add, GOC:tfm]
xref: FMA:62844
is_a: BFO:0000040 ! material entity
is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell
intersection_of: CL:0000988 ! hematopoietic cell
intersection_of: capable_of GO:0008015 ! blood circulation
relationship: capable_of GO:0008015 ! blood circulation

[Term]
id: CL:0000082
name: epithelial cell of lung
namespace: cell
def: "An epithelial cell of the lung." [https://orcid.org/0000-0001-5208-3432]
synonym: "lung epithelial cell" EXACT []
xref: BTO:0004299
is_a: CL:0000066 ! epithelial cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: part_of UBERON:0002048 ! lung
relationship: part_of UBERON:0000115 ! lung epithelium

[Term]
id: CL:0000083
name: epithelial cell of pancreas
namespace: cell
def: "An epithelial cell of the pancreas." [GOC:tfm]
synonym: "pancreas epithelial cell" EXACT []
synonym: "pancreatic epithelial cell" EXACT []
xref: BTO:0000028
is_a: CARO:0000000
is_a: CL:0000066 {is_inferred="true"} ! epithelial cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: part_of UBERON:0001264 ! pancreas
relationship: develops_from CL:0000223 ! endodermal cell
relationship: part_of UBERON:0001264 ! pancreas

[Term]
id: CL:0000084
name: T cell
namespace: cell
alt_id: CL:0000804
alt_id: CL:0000812
def: "A type of lymphocyte whose defining characteristic is the expression of a T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "immature T cell" RELATED []
synonym: "mature T cell" RELATED []
synonym: "T lymphocyte" EXACT []
synonym: "T-cell" EXACT []
synonym: "T-lymphocyte" EXACT []
xref: BTO:0000782
xref: CALOHA:TS-1001
xref: FMA:62870
xref: VHOG:0001479
is_a: CL:0000542 {is_inferred="true"} ! lymphocyte
intersection_of: CL:0000542 ! lymphocyte
intersection_of: capable_of GO:0002456 ! T cell mediated immunity
disjoint_from: CL:0000945 ! lymphocyte of B lineage
relationship: capable_of GO:0002456 ! T cell mediated immunity
relationship: develops_from CL:0000827 ! pro-T cell

[Term]
id: CL:0000085
name: germ line stem cell (sensu Vertebrata)
namespace: cell
is_a: CL:0000014 ! germ line stem cell
is_a: CL:0000548 ! animal cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>

[Term]
id: CL:0000086
name: germ line stem cell (sensu Nematoda and Protostomia)
namespace: cell
xref: FBbt:00004861
is_a: CL:0000014 ! germ line stem cell

[Term]
id: CL:0000087
name: male germ line stem cell (sensu Nematoda and Protostomia)
namespace: cell
xref: FBbt:00004929
is_a: CL:0000016 ! male germ line stem cell
is_a: CL:0000086 ! germ line stem cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000088
name: female germ line stem cell (sensu Nematoda and Protostomia)
namespace: cell
xref: FBbt:00004873
is_a: CL:0000022 ! female germ line stem cell
is_a: CL:0000086 ! germ line stem cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000089
name: male germ line stem cell (sensu Vertebrata)
namespace: cell
synonym: "spermatogonial stem cell" EXACT [PMID:19948499]
is_a: CL:0000016 ! male germ line stem cell
is_a: CL:0000085 ! germ line stem cell (sensu Vertebrata)

[Term]
id: CL:0000090
name: female germ line stem cell (sensu Vertebrata)
namespace: cell
is_a: CL:0000022 ! female germ line stem cell
is_a: CL:0000085 ! germ line stem cell (sensu Vertebrata)

[Term]
id: CL:0000091
name: Kupffer cell
namespace: cell
def: "A tissue-resident macrophage of the reticuloendothelial system found on the luminal surface of the hepatic sinusoids involved in erythrocyte clearance. Markers include F4/80+, CD11b-low, CD68-positive, sialoadhesin-positive, CD163/SRCR-positive. Irregular, with long processes including lamellipodia extending into the sinusoid lumen, have flattened nucleus with cytoplasm containing characteristic invaginations of the plasma membrane (vermiform bodies); lie within the sinusoid lumen attached to the endothelial surface; derived from the bone marrow, form a major part of the body's mononuclear phagocyte system." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0517223651, MESH:A11.329.372.588, PMID:15771589, PMID:17105582]
comment: Markers: Mouse: F4/80+, CD11b-low, CD68+, sialoadhesin+, CD163/SRCR+; role or process: immune, antigen-presentation, clearance of senescent erythrocytes, iron metabolism. Kupffer cells are also reportedly C3aR-positive, CD14-low, CD54-positive, CD88-positive, and CD284-positive. They are also capable of producing IL-1, IL-6, TNF-alpha, nitric oxide, PGD2, PGE2, PGF2alpha, and TXA2.
synonym: "hepatic macrophage" EXACT []
synonym: "littoral cell of hepatic sinusoid" EXACT []
synonym: "liver macrophage" EXACT []
synonym: "macrophagocytus stellatus" EXACT []
synonym: "stellate cell of von Kupffer" EXACT []
synonym: "von Kupffer cell" EXACT []
xref: BTO:0000685
xref: FMA:14656
is_a: CARO:0000006
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: capable_of GO:0034102 ! erythrocyte clearance
intersection_of: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
intersection_of: located_in UBERON:0001281 ! hepatic sinusoid
intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
intersection_of: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: capable_of GO:0034102 ! erythrocyte clearance
relationship: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
relationship: located_in UBERON:0001281 ! hepatic sinusoid
relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
relationship: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin

[Term]
id: CL:0000092
name: osteoclast
namespace: cell
def: "A specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue, which typically differentiates from monocytes. This cell has the following markers: tartrate-resistant acid phosphatase type 5-positive, PU.1-positive, c-fos-positive, nuclear factor NF-kappa-B p100 subunit-positive, tumor necrosis factor receptor superfamily member 11A-positive and macrophage colony-stimulating factor 1 receptor-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149, PMID:10428500, PMID:15055519, PMID:17380158]
comment: Morphology: Highly vesicular; markers: Surface: RANK, cFMS (MCSF receptor); Secreted: cathepsin K and TRAP (tartate resistant acid phosphatase); transcription factors: PU.1, cFOS, MITF, NFkB (p52); role or process: tissue remodelling: bone resorption; lineage: hematopoietic, myeloid.
synonym: "chondroclast" RELATED []
xref: BTO:0000968
xref: CALOHA:TS-0721
xref: FMA:66781
is_a: CARO:0000006
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
is_a: CL:0001035 {is_inferred="true"} ! bone cell
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: capable_of GO:0045453 ! bone resorption
intersection_of: has_part PR:000001850 ! cathepsin K
intersection_of: has_part PR:000001937 ! tartrate-resistant acid phosphatase type 5
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000007597 ! proto-oncogene c-Fos
intersection_of: has_part PR:000011178 ! nuclear factor NF-kappa-B p100 subunit
intersection_of: part_of UBERON:0001474 ! bone element
intersection_of: RO:0002104 PR:000001954 ! has plasma membrane part tumor necrosis factor receptor superfamily member 11A
intersection_of: RO:0002104 PR:000002062 ! has plasma membrane part macrophage colony-stimulating factor 1 receptor
relationship: capable_of GO:0045453 ! bone resorption
relationship: develops_from CL:0000576 ! monocyte
relationship: has_part PR:000001850 ! cathepsin K
relationship: has_part PR:000001937 ! tartrate-resistant acid phosphatase type 5
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000007597 ! proto-oncogene c-Fos
relationship: has_part PR:000011178 ! nuclear factor NF-kappa-B p100 subunit
relationship: RO:0002104 PR:000001954 ! has plasma membrane part tumor necrosis factor receptor superfamily member 11A
relationship: RO:0002104 PR:000002062 ! has plasma membrane part macrophage colony-stimulating factor 1 receptor

[Term]
id: CL:0000093
name: obsolete osteochondroclast
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Consider using 'osteoclast ; CL:0000092' instead.
is_obsolete: true

[Term]
id: CL:0000094
name: granulocyte
namespace: cell
def: "A leukocyte with abundant granules in the cytoplasm." [GOC:amm, GOC:tfm, http://en.wikipedia.org/wiki/Granulocyte, MESH:A11.118.637.415, MESH:D006098]
synonym: "granular leucocyte" EXACT []
synonym: "granular leukocyte" EXACT []
synonym: "polymorphonuclear leukocyte" EXACT []
xref: BTO:0000539
xref: BTO:0001026
xref: CALOHA:TS-0422
xref: FMA:62854
is_a: CARO:0000006
is_a: CL:0000081 ! blood cell
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: capable_of GO:0008015 ! blood circulation
intersection_of: has_part GO:0030141 ! secretory granule
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001332 ! has plasma membrane part carcinoembryonic antigen-related cell adhesion molecule 8
intersection_of: RO:0002104 PR:000001969 ! has plasma membrane part urokinase plasminogen activator surface receptor
relationship: has_part GO:0030141 ! secretory granule
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: RO:0002104 PR:000001332 ! has plasma membrane part carcinoembryonic antigen-related cell adhesion molecule 8
relationship: RO:0002104 PR:000001969 ! has plasma membrane part urokinase plasminogen activator surface receptor

[Term]
id: CL:0000095
name: neuron associated cell
namespace: cell
is_a: CARO:0000000
is_a: CL:0002319 ! neural cell
relationship: develops_from CL:0000133 ! neurectodermal cell

[Term]
id: CL:0000096
name: mature neutrophil
namespace: cell
def: "A fully differentiated neutrophil, a granular leukocyte having a nucleus with three to five lobes connected by slender threads, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes. They are produced in bone marrow at a rate of 5e10-10e10/day and have a half-life of 6-8 hours. Neutrophils are CD15-positive, CD16-positive, CD32-positive, CD43-positive, CD181-positive, and CD182-positive." [GOC:add, GOC:tfm, http://www.cap.org, MESH:A11.118.637.415.583, MESH:D009504, PMID:11138776, PMID:12560239, PMID:15514007, PMID:7880385]
comment: Neutrophils are also capable of secreting GRO-alpha, IL-1beta, IL-1ra, IL-3, IL-12, IP-10, MIG, MIP-1alpha, MIP-1beta, TGF-beta, TNF-alpha, VEGF, and anti-microbial peptides. They can positively influence the chemotaxis of basophils, T-cells, monocytes, macrophages, dendritic cells, and other neutrophils. Neutrophils are also CD35-positive, CD64-positive, CD89-positive, CD184-positive, and fMLP receptor-positive Ly-6G-positive (mouse), TLR2-low, TLR4-low, and lineage-negative (CD2, CD3, CD5, CD9, CD19, CD36, CD49d, CD56, CD61, CD235a (glycophorin-A)).
synonym: "mature neutrocyte" EXACT []
synonym: "mature neutrophil leucocyte" EXACT []
synonym: "mature neutrophil leukocyte" EXACT []
synonym: "mature neutrophilic leucocyte" EXACT []
synonym: "mature neutrophilic leukocyte" EXACT []
synonym: "PMN" EXACT []
synonym: "poly" BROAD []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
synonym: "polymorphonuclear neutrophil" EXACT []
synonym: "polynuclear neutrophilic leucocyte" EXACT []
synonym: "polynuclear neutrophilic leukocyte" EXACT []
xref: BTO:0003473
is_a: CL:0000234 ! phagocyte
is_a: CL:0000775 {is_inferred="true"} ! neutrophil
relationship: capable_of GO:0002536 ! respiratory burst involved in inflammatory response
relationship: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis
relationship: capable_of GO:0032637 ! interleukin-8 production
relationship: has_part CL:0017500 ! neutrophillic cytoplasm
relationship: has_part GO:0070820 ! tertiary granule
relationship: lacks_part PR:000009978 ! lactotransferrin
relationship: lacks_part PR:000010543 ! myeloperoxidase
relationship: lacks_part PR:000010799 ! myb proto-oncogene protein
relationship: RO:0002104 PR:000001256 ! has plasma membrane part C-X-C chemokine receptor type 1
relationship: RO:0002104 PR:000001257 ! has plasma membrane part C-X-C chemokine receptor type 2
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001944 ! has plasma membrane part transcription factor PU.1
relationship: RO:0002104 PR:000007597 ! has plasma membrane part proto-oncogene c-Fos

[Term]
id: CL:0000097
name: mast cell
namespace: cell
def: "A cell that is found in almost all tissues containing numerous basophilic granules and capable of releasing large amounts of histamine and heparin upon activation. Progenitors leave bone marrow and mature in connective and mucosal tissue. Mature mast cells are found in all tissues, except the bloodstream. Their phenotype is CD117-high, CD123-negative, CD193-positive, CD200R3-positive, and FceRI-high. Stem-cell factor (KIT-ligand; SCF) is the main controlling signal of their survival and development." [GOC:add, GOC:dsd, GOC:tfm, ISBN:068340007X, MESH:A11.329.427, MESH:D008407, PMCID:PMC1312421, PMCID:PMC2855166, PMID:15153310, PMID:16455980, PMID:19671378, PMID:212366338, PMID:9354811]
comment: Mast cells are generally integrin beta-7-negative and positive for TLR2, TLR3, TLR4, TLR5, TLR7, TLR9, C3aR, C5aR, CR3, CR4, VEGF, FGF2, and renin. They can express MHC Class I and II on their surface. Activated murine mast cells (IgE+Antigen) were capable of expressing the following co-stimulatory molecules: CD95 (Fas), CD120b, CD137 (4-1BB), CD153 (CD30L), CD154 (CD40L), GITR, ICOSL, OX40L, PD-L1, and PD-L2. Note that there was some mouse strain variation. Mast cells have also been demonstrated to produce bFGF, CCL2, CCL4, CCL5, CCL11, CCL20, CXCL2, CXCL8, CXCL10, GM-CSF, IFN-gamma, IL-1, IL-2, IL-3, IL-8, IL-10, IL-11, IL-12, IL-13, IL-16, IL-25, IL-18, MIP-1, prostaglandin D2, SCF, TGF-beta, TNF-alpha, TSLP, VEGF, and XCL1. They express the transcription factors Transcription factors AP-1, GATA1, MITF, Notch2, PIAS3, PU.1, and STAT5.
synonym: "histaminocyte" EXACT []
synonym: "labrocyte" EXACT [ISBN:0721601464]
synonym: "mastocyte" EXACT [ISBN:0721601464]
synonym: "tissue basophil" RELATED [ISBN:068340007X]
xref: BTO:0000830
xref: CALOHA:TS-0603
xref: FMA:66784
is_a: CARO:0000006
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
is_a: CL:0002274 ! histamine secreting cell
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: capable_of GO:0002349 ! histamine production involved in inflammatory response
intersection_of: capable_of GO:0002539 ! prostaglandin production involved in inflammatory response
intersection_of: capable_of GO:0002660 ! positive regulation of peripheral tolerance induction
intersection_of: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis
intersection_of: capable_of GO:0002830 ! positive regulation of type 2 immune response
intersection_of: capable_of GO:0030210 ! heparin biosynthetic process
intersection_of: has_high_plasma_membrane_amount PR:000002065 ! mast/stem cell growth factor receptor
intersection_of: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
intersection_of: has_part GO:0030141 ! secretory granule
intersection_of: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain
intersection_of: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3
intersection_of: RO:0002104 PR:000006169 ! has plasma membrane part cell surface glycoprotein CD200 receptor 3
relationship: capable_of GO:0002349 ! histamine production involved in inflammatory response
relationship: capable_of GO:0002539 ! prostaglandin production involved in inflammatory response
relationship: capable_of GO:0002660 ! positive regulation of peripheral tolerance induction
relationship: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis
relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response
relationship: capable_of GO:0030210 ! heparin biosynthetic process
relationship: develops_from CL:0000831 ! mast cell progenitor
relationship: has_high_plasma_membrane_amount PR:000002065 ! mast/stem cell growth factor receptor
relationship: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
relationship: has_part GO:0030141 ! secretory granule
relationship: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain
relationship: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3
relationship: RO:0002104 PR:000006169 ! has plasma membrane part cell surface glycoprotein CD200 receptor 3

[Term]
id: CL:0000098
name: sensory epithelial cell
namespace: cell
def: "A specialized epithelial cell involved in sensory perception. Restricted to special sense organs of the olfactory, gustatory, and vestibulocochlear receptor systems; contain sensory cells surrounded by supportive, non-receptive cells." [GOC:tfm, ISBN:0517223651, ISBN:0721662544]
comment: The term "neuroepithelial cell" is used to describe both this cell type and neurecto-epithelial cell (CL:0000710).
synonym: "neuroepithelial cell" BROAD []
xref: BTO:0004301
is_a: CL:0000066 ! epithelial cell
is_a: CL:0000197 ! sensory receptor cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception

[Term]
id: CL:0000099
name: interneuron
namespace: cell
def: "Most generally any neuron which is not motor or sensory. Interneurons may also refer to neurons whose axons remain within a particular brain region as contrasted with projection neurons which have axons projecting to other brain regions." [GOC:tfm, MESH:A08.663.358]
xref: BTO:0003811
xref: FBbt:00005125
xref: FMA:67313
xref: WBbt:0005113
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000100
name: motor neuron
namespace: cell
def: "An efferent neuron that passes from the central nervous system or a ganglion toward or to a muscle and conducts an impulse that causes or inhibits movement." [MESH:A08.663.655.500, PMID:16875686]
synonym: "motoneuron" EXACT []
xref: BTO:0000312
xref: FMA:83617
xref: WBbt:0005409
is_a: CL:0000527 ! efferent neuron

[Term]
id: CL:0000101
name: sensory neuron
namespace: cell
def: "Any neuron having a sensory function; an afferent neuron conveying sensory impulses." [ISBN:0721662544]
xref: BTO:0001037
xref: FBbt:00005124
xref: FMA:84649
xref: WBbt:0005759
is_a: CL:0000526 ! afferent neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception
relationship: capable_of GO:0050906 ! detection of stimulus involved in sensory perception

[Term]
id: CL:0000102
name: polymodal neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000103
name: bipolar neuron
namespace: cell
def: "A type of interneuron that has two neurites, usually an axon and a dendrite, extending from opposite poles of an ovoid cell body." [GOC:tfm, ISBN:0444009442]
subset: BDS_subset
xref: FMA:67282
is_a: CL:0000099 ! interneuron
intersection_of: CL:0000099 ! interneuron
intersection_of: bearer_of PATO:0070006 ! cortical bipolar morphology
relationship: bearer_of PATO:0070006 ! cortical bipolar morphology

[Term]
id: CL:0000104
name: multipolar neuron
namespace: cell
def: "A neuron with three or more neurites, usually an axon and multiple dendrites." [FMA:67287, GOC:tfm]
subset: BDS_subset
xref: FMA:67287
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: bearer_of PATO:0070026 ! multipolar neuron morphology
relationship: bearer_of PATO:0070026 ! multipolar neuron morphology

[Term]
id: CL:0000105
name: pseudounipolar neuron
namespace: cell
def: "Neuron with two neurites that are fused grossly when they protrude from the soma and bifurcate a short distance from the soma." [FMA:67305, GOC:tfm]
xref: FMA:67305
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000106
name: unipolar neuron
namespace: cell
def: "Neuron with one neurite that extends from the cell body." [FMA:67278, GOC:nv]
subset: BDS_subset
xref: FMA:67278
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000107
name: autonomic neuron
namespace: cell
def: "A neuron whose cell body is within an autonomic ganglion." [GOC:tfm]
xref: FMA:80121
is_a: CARO:0000000
is_a: CL:2000032 ! peripheral nervous system neuron
intersection_of: CL:0000540 ! neuron
intersection_of: RO:0002100 UBERON:0002410 ! has soma location autonomic nervous system
relationship: RO:0002100 UBERON:0002410 ! has soma location autonomic nervous system

[Term]
id: CL:0000108
name: cholinergic neuron
namespace: cell
def: "A neuron that uses acetylcholine as a vesicular neurotransmitter." [GOC:tfm]
xref: BTO:0004902
xref: FMA:84796
xref: WBbt:0006840
is_a: CL:0000151 ! secretory cell
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0014055 ! acetylcholine secretion, neurotransmission
relationship: capable_of GO:0014055 ! acetylcholine secretion, neurotransmission

[Term]
id: CL:0000109
name: adrenergic neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000110
name: peptidergic neuron
namespace: cell
is_a: CL:0000540 ! neuron
relationship: capable_of GO:0002790 ! peptide secretion

[Term]
id: CL:0000111
name: peripheral neuron
namespace: cell
def: "A neuron that is part of nerve found outside the central nervous system." [ISBN:0721662544]
xref: FMA:84664
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000112
name: columnar neuron
namespace: cell
synonym: "columnar neuron" RELATED []
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000113
name: mononuclear phagocyte
namespace: cell
def: "A vertebrate phagocyte with a single nucleus." [GOC:add, GOC:tfm, ISBN:0781735149]
xref: BTO:0001433
is_a: CL:0000226 ! single nucleate cell
is_a: CL:0000518 {is_inferred="true"} ! phagocyte (sensu Vertebrata)
intersection_of: CL:0000518 ! phagocyte (sensu Vertebrata)
intersection_of: bearer_of PATO:0001407 ! mononucleate

[Term]
id: CL:0000114
name: surface ectodermal cell
namespace: cell
synonym: "cell of surface ectoderm" EXACT []
synonym: "surface ectoderm cell" EXACT []
xref: FMA:72552
is_a: CL:0000221 ! ectodermal cell

[Term]
id: CL:0000115
name: endothelial cell
namespace: cell
def: "An endothelial cell comprises the outermost layer or lining of anatomical structures and can be squamous or cuboidal. In mammals, endothelial cell has vimentin filaments and is derived from the mesoderm." [GOC:tfm, http://en.wikipedia.org/wiki/Endothelial_cell, https://sourceforge.net/tracker/?func=detail&atid=440764&aid=3364936&group_id=36855, MESH:D042783, PMID:21275341]
comment: From FMA: 9.07.2001: Endothelial cell has always been classified as a kind of epithelial cell, specifically a squamous cell but that is not true. First, endothelial cell can either be squamous or cuboidal (e.g. high-endothelial cell) and secondly, it has different embryological derivation (mesodermal) than a true epithelial cell (ectodermal and endodermal). The basis for present classification is the fact that it comprises the outermost layer or lining of anatomical structures (location-based) but a better structural basis for the differentia is the cytoskeleton of the cell. Endothelial cell has vimentin filaments while an epithelial cell has keratin filaments. [Onard].
synonym: "endotheliocyte" EXACT []
xref: BTO:0001176
xref: CALOHA:TS-0278
xref: FMA:66772
is_a: CL:0000213 ! lining cell
is_a: CL:0002078 ! meso-epithelial cell

[Term]
id: CL:0000116
name: pioneer neuron
namespace: cell
def: "Pioneer neurons establish a pathway in the developing central nervous system and then undergo programmed cell death once the adult axons, which follow them, have made connections with the target site. Thus, they are a transient cell type involved in axon guidance." [GOC:cvs, GOC:tfm]
xref: FBbt:00005128
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000117
name: CNS neuron (sensu Vertebrata)
namespace: cell
is_a: CARO:0000000
is_a: CL:0000540 ! neuron
relationship: develops_from CL:0000031 ! neuroblast (sensu Vertebrata)
relationship: part_of UBERON:0001017 ! central nervous system

[Term]
id: CL:0000118
name: basket cell
namespace: cell
def: "Basket cells are inhibitory GABAergic interneurons of the brain. In general, dendrites of basket cells are free branching and contain smooth spines. Axons are highly branched. The branched axonal arborizations give rise to basket-like structures that surround the soma of the target cell. Basket cells form axo-somatic synapses, meaning their synapses target somas of other cells." [WikipediaVersioned:Basket_cell&oldid=951703880]
subset: BDS_subset
is_a: CL:0000104 ! multipolar neuron
is_a: CL:0011005 ! GABAergic interneuron
intersection_of: CL:0000099 ! interneuron
intersection_of: bearer_of PATO:0070002 ! basket cell morphology
intersection_of: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission
relationship: bearer_of PATO:0070002 ! basket cell morphology
property_value: created_by https://orcid.org/0000-0002-2825-0621 xsd:string

[Term]
id: CL:0000119
name: cerebellar Golgi cell
namespace: cell
def: "Large intrinsic neuron located in the granule layer of the cerebellar cortex that extends its dendrites into the molecular layer where they receive contact from parallel fibers. The axon of the Golgi cell ramifies densely in the granule layer and enters into a complex arrangement with mossy fiber terminals and granule cell dendrites to form the cerebellar glomerulus. Llinas, Walton and Lang. In The Synaptic Organization of the Brain. 5th ed. 2004." [NIFSTD:sao1415726815]
synonym: "cerebellar Golgi neuron" EXACT []
synonym: "cerebellum Golgi cell" EXACT []
synonym: "Golgi cell" EXACT []
synonym: "Golgi neuron" EXACT []
is_a: CARO:0000000
is_a: CL:0011005 ! GABAergic interneuron
relationship: part_of UBERON:0002129 ! cerebellar cortex

[Term]
id: CL:0000120
name: granule cell
namespace: cell
xref: BTO:0003393
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)

[Term]
id: CL:0000121
name: Purkinje cell
namespace: cell
def: "The output neuron of the cerebellar cortex." [MESH:A08.186.211.132.810.428.200.212.600]
synonym: "cerebellar Purkinje cell" EXACT []
synonym: "cerebellum Purkinje cell" EXACT []
synonym: "Purkinje neuron" EXACT []
synonym: "Purkinje's cell" EXACT []
xref: BTO:0001011
xref: CALOHA:TS-0845
xref: FMA:67969
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)
is_a: CL:0000527 ! efferent neuron
is_a: CL:1001611 ! cerebellar neuron
relationship: RO:0002100 UBERON:0002129 ! has soma location cerebellar cortex

[Term]
id: CL:0000122
name: stellate neuron
namespace: cell
def: "A neuron that has dendritic processes radiating from the cell body forming a star-like shape." [ISBN:9780123973481]
subset: BDS_subset
xref: BTO:0002316
is_a: CL:0000104 ! multipolar neuron
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)
intersection_of: CL:0000117 ! CNS neuron (sensu Vertebrata)
intersection_of: bearer_of PATO:0070010 ! stellate morphology
relationship: bearer_of PATO:0070010 ! stellate morphology

[Term]
id: CL:0000123
name: neuron associated cell (sensu Vertebrata)
namespace: cell
is_a: CL:0000095 ! neuron associated cell
relationship: develops_from CL:0000333 ! migratory neural crest cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>

[Term]
id: CL:0000124
name: obsolete glial cell (sensu Nematoda and Protostomia)
namespace: cell
comment: This is a grouping class that is no longer needed or wanted.
xref: FBbt:00005144
property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/715 xsd:string
is_obsolete: true

[Term]
id: CL:0000125
name: glial cell
namespace: cell
def: "A non-neuronal cell of the nervous system. They not only provide physical support, but also respond to injury, regulate the ionic and chemical composition of the extracellular milieu. Guide neuronal migration during development, and exchange metabolites with neurons." [MESH:A08.637]
synonym: "neuroglia" RELATED []
synonym: "neuroglial cell" EXACT []
xref: BTO:0002606
xref: CALOHA:TS-0415
xref: FMA:54536
is_a: CL:0000095 ! neuron associated cell
relationship: develops_from CL:0000030 {comment="It is unclear that all glial cells develop from a cell type called a glioblast. Radial glial cells develop from neuroepithelial cells and other types of glial cells develop from other precursors. Unless glioblast is meant to describe any cell that can give rise to a glial cell, this relationship needs further investigation."} ! glioblast

[Term]
id: CL:0000126
name: macroglial cell
namespace: cell
def: "A neuroglial cell of ectodermal origin, i.e., the astrocytes and oligodendrocytes considered together." [GOC:tfm, ISBN:0721662544]
synonym: "macrogliocyte" EXACT []
xref: BTO:0000771
xref: CALOHA:TS-2027
xref: FMA:54538
is_a: CL:0000125 ! glial cell
relationship: develops_from CL:0000339 ! glioblast (sensu Vertebrata)

[Term]
id: CL:0000127
name: astrocyte
namespace: cell
def: "A class of large neuroglial (macroglial) cells in the central nervous system - the largest and most numerous neuroglial cells in the brain and spinal cord. Astrocytes (from 'star' cells) are irregularly shaped with many long processes, including those with 'end feet' which form the glial (limiting) membrane and directly and indirectly contribute to the blood-brain barrier. They regulate the extracellular ionic and chemical environment, and 'reactive astrocytes' (along with microglia) respond to injury." [GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Astrocyte, MESH:A08.637.200, MESH:D001253, PMID:11746784, PMID:12162730, PMID:12898703, PMID:20942978]
comment: Astrocytes are reportedly CD68-negative, CD121a-positive, CD184-positive, CD192-positive, CRF-positive, EGFR-positive, GFAP-positive, GLUT1-positive, MBP-negative, and NGFR-positive.
synonym: "astrocytic glia" EXACT []
xref: BTO:0000099
xref: CALOHA:TS-0060
xref: FMA:54537
is_a: CL:0000126 ! macroglial cell

[Term]
id: CL:0000128
name: oligodendrocyte
namespace: cell
def: "A class of large neuroglial (macroglial) cells in the central nervous system. Form the insulating myelin sheath of axons in the central nervous system." [http://en.wikipedia.org/wiki/Oligodendrocyte, MESH:A08.637.600, MESH:D009836]
comment: Oligodendrocytes are reportedly MDP-positive and CD4-negative.
synonym: "oligodendroglia" RELATED []
synonym: "OLs" EXACT [PMID:8734446]
xref: BTO:0000962
xref: CALOHA:TS-0709
xref: FMA:54540
is_a: CL:0000126 {is_inferred="true"} ! macroglial cell
relationship: develops_from CL:0002453 ! oligodendrocyte precursor cell
relationship: part_of UBERON:0001017 ! central nervous system

[Term]
id: CL:0000129
name: microglial cell
namespace: cell
def: "A central nervous system macrophage found in the parenchyma of the central nervous system. Marker include CD11b-positive, F4/80-positive, and CD68-positive." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Microglia, ISBN:0721601464, MESH:D017628, PMID:11517395, PMID:12430718, PMID:14561199, PMID:14612429, PMID:16177057, PMID:19461673, PMID:2089275]
comment: Markers: Mouse: CD11b+, F4/80+, CD68+. They represent ~12% of the cells in the CNS, but they are not uniformly distributed within the CNS. A normal adult mouse brain has approximately 3.5x10e6 microglia. Microglia are also reportedly CD3-negative, CD4-positive, CD8-negative, CD11b-positive, CD11c-high, CD14-negative, CD19-negative, CD45-low, CD56-negative, CD163-negative, CD200R-positive, CD281-positive, CD282-positive, CD283-positive, CD284-positive, CD285-positive, CD286-positive, CD287-positive, CD288-positive, CD289-positive, Gr1-negative, nestin-positive, and PU.1-positive.
synonym: "brain macrophage" BROAD []
synonym: "brain-resident macrophage" EXACT []
synonym: "hortega cells" EXACT [http://www.copewithcytokines.de/]
synonym: "MF.microglia.CNS" RELATED []
synonym: "microglia" EXACT []
synonym: "microgliocyte" EXACT [http://www.copewithcytokines.de/]
xref: BTO:0000078
xref: BTO:0000962
xref: FMA:54539
xref: FMA:54540
is_a: CARO:0000006
is_a: CL:0000125 ! glial cell
is_a: CL:0000878 ! central nervous system macrophage
intersection_of: CL:0000125 ! glial cell
intersection_of: capable_of GO:0045087 ! innate immune response
intersection_of: part_of UBERON:0001017 ! central nervous system
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: capable_of GO:0045087 ! innate immune response
relationship: develops_from CL:0002453 ! oligodendrocyte precursor cell
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin

[Term]
id: CL:0000130
name: neuron associated cell (sensu Nematoda and Protostomia)
namespace: cell
is_a: CL:0000095 ! neuron associated cell

[Term]
id: CL:0000131
name: gut endothelial cell
namespace: cell
is_a: CL:0000115 ! endothelial cell
relationship: develops_from CL:0000223 ! endodermal cell

[Term]
id: CL:0000132
name: corneal endothelial cell
namespace: cell
def: "Cell of the single layer of large flattened cells covering the surface of the cornea." [GOC:tfm, MESH:A09.371.060.067.31]
xref: CALOHA:TS-0172
xref: FMA:70614
is_a: CL:0000076 ! squamous epithelial cell
is_a: CL:0000710 ! neurecto-epithelial cell
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell

[Term]
id: CL:0000133
name: neurectodermal cell
namespace: cell
def: "Ectoderm destined to be nervous tissue." [GOC:tfm, ISBN:068340007X]
synonym: "neurectoderm cell" EXACT []
is_a: CL:0000221 ! ectodermal cell

[Term]
id: CL:0000134
name: mesenchymal stem cell
namespace: cell
alt_id: CL:0002452
def: "A connective tissue cell that normally gives rise to other cells that are organized as three-dimensional masses. In humans, this cell type is CD73-positive, CD90-positive, CD105-positive, CD45-negative, CD34-negative, and MHCII-negative. They may further differentiate into osteoblasts, adipocytes, myocytes, neurons, or chondroblasts in vitro. Originally described as residing in the bone marrow, this cell type is now known to reside in many, if not all, adult organs." [FB:ma, GOC:dsd, http://en.wikipedia.org/wiki/Mesenchymal_stem_cell, http://www.copewithcytokines.de/cope.cgi?key=mesenchymal%20stem%20cells, PMCID:PMC2613570, PMID:10102814j, PMID:16923606, PMID:17986482, PMID:19960544]
comment: Many but not all mesenchymal cells derive from the mesoderm. MSCs are reportedly CD3-negative, CD4-negative, CD5-negative, CD8-negative, CD11a-negative, CD11b-negative, CD14-negative, CD19-negative, CD29-positive, CD31-negative, CD34-negative, CD38-negative, CD40-negative, CD44-positive, CD45-negative, CD49-positive, CD54-positive, CD66b-negative, CD79a-negative, CD80-negative, CD102-positive, CD106-positive, CD117-positive, CD121a-positive, CD121b-positive, CD123-positive, CD124-positive, CD133-negative, CD146-positive, CD166-positive, CD271-positive, B220-negative, Gr1-negative, MHCI-positive, MHCII-negative, SSEA4-negative, sca1-positive, Ter119-negative, and glycophorin A-negative. Cultured MSCs are capable of producing stem cell factor, IL7, IL8, IL11, TGF-beta, cofilin, galectin-1, laminin-receptor 1, cyclophilin A, and MMP-2.
synonym: "BMSC" NARROW []
synonym: "bone marrow stromal cells" NARROW []
synonym: "CFU-F" RELATED []
synonym: "colony-forming unit-fibroblast" NARROW []
synonym: "marrow stromal cells" NARROW [PMID:11378515]
synonym: "mesenchymal precursor cell" RELATED []
synonym: "mesenchymal progenitor cells" RELATED PLURAL [MESH:D044982]
synonym: "mesenchymal stem cell" RELATED []
synonym: "mesenchymal stromal cell" RELATED []
synonym: "mesenchymal stromal cells" RELATED PLURAL []
synonym: "MSC" RELATED [PMID:11378515]
synonym: "stem cells, mesenchymal" RELATED PLURAL [MESH:D044982]
xref: BTO:0002625
xref: BTO:0003298
xref: FMA:70546
is_a: CL:0000048 ! multi fate stem cell
is_a: CL:0002320 {is_inferred="true"} ! connective tissue cell
property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/474 xsd:string

[Term]
id: CL:0000135
name: fibrocyte
namespace: cell
def: "An inactive fibroblast; cytoplasm is sparse, endoplasmic reticulum is scanty with flattened nucleus. Term used by some histologists; when fibroblasts become relatively inactive in fiber formation. However, this cell has the potential for fibrogenesis in quiescent connective tissue of the adult, as well as during development, other histologists prefer to use the term fibroblast in all circumstances. These cells represent ~0.5% of peripheral blood leukocytes." [GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Fibrocyte, ISBN:0412046911, ISBN:0517223651, PMID:11641248, PMID:15010326, PMID:17607298, PMID:18222966, PMID:8790603, PMID:9551999]
comment: Cultured human fibrocytes are MHCI-positive, MHCII-positive, CD1a-negative, CD3-negative, CD4-negative, CD8-negative, CD10-negative, CD11b-positive, CD13-positive, CD14-negative, CD16-negative, CD18-positive, CD19-negative, CD25-negative, CD29-positive, CD32-positive, CD33-negative, CD34-positive, CD38-negative, CD40-positive, CD44-negative, CD45RO-positive, CD49a-positive, CD49b-positive, CD49c-negative, CD49d-negative, CD49e-positive, CD49f-negative, CD56-negative, CD58-positive, CD61-positive, CD64-positive, CD70-negative, CD71-positive, CD80-positive, CD83-negative, CD86-positive, CD103-negative, CD105-positive, CD181-positive, CD182-negative, CD183-positive, CD184-positive, CD185-negative, CD186-negative, CD191-positive, CD192-negative, CD193-positive, CD194-positive, CD195-positive, CD196-negative, CD197-positive, CD199-positive, desmin-negative, F4/80-positive, Gr1-positive, LSP-1-positive, MHCI-positive, MHCII-positive, alpha-SMA-negative, TCRab-negative, TCRgd-negative, and vimentin-positive. Fibrocytes are also capable of secreting angiogenin, bFGF, CCL2, CCL3, CCL4, CCL8, CXCL1, type I collagen, type III collagen, CTGF, fibronectin, GM-CSF, IL-1a, IL-6, IL-8, IL-10, M-CSF, MMP-9, PDGF-A, TGF-alpha, TGF-beta1, TNF-alpha, and VEGF-A.
xref: FMA:63879
is_a: BFO:0000040 ! material entity
is_a: CL:0000499 {is_inferred="true"} ! stromal cell
intersection_of: CL:0000499 ! stromal cell
intersection_of: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II
intersection_of: capable_of GO:0045766 ! positive regulation of angiogenesis
relationship: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II
relationship: capable_of GO:0045766 ! positive regulation of angiogenesis
relationship: develops_from CL:0000057 ! fibroblast

[Term]
id: CL:0000136
name: fat cell
namespace: cell
alt_id: CL:0000450
def: "A fat-storing cell found mostly in the abdominal cavity and subcutaneous tissue of mammals. Fat is usually stored in the form of triglycerides." [MESH:A11.329.114]
synonym: "adipocyte" EXACT []
synonym: "adipose cell" EXACT []
xref: BTO:0000443
xref: CALOHA:TS-0012
xref: FMA:63880
is_a: CARO:0000000
is_a: CL:0000325 ! stuff accumulating cell
is_a: CL:0002320 ! connective tissue cell
relationship: develops_from CL:0000134 ! mesenchymal stem cell

[Term]
id: CL:0000137
name: osteocyte
namespace: cell
def: "A mature osteoblast that has become embedded in the bone matrix. They occupy a small cavity, called lacuna, in the matrix and are connected to adjacent osteocytes via protoplasmic projections called canaliculi." [GOC:tfm, MESH:A11.329.629.500]
comment: VSAO relationship simplified OBO_REL:integral_part_of VSAO:0000118
synonym: "bone cell" BROAD []
xref: BTO:0002038
xref: CALOHA:TS-1167
xref: FMA:66779
xref: VSAO:0000124
is_a: CARO:0000000
is_a: CL:0001035 ! bone cell
relationship: develops_from CL:0001040 ! non-terminally differentiated osteoblast
relationship: part_of UBERON:0002481 ! bone tissue

[Term]
id: CL:0000138
name: chondrocyte
namespace: cell
def: "Skeletogenic cell that is terminally differentiated, secretes an avascular, GAG-rich matrix, is embedded in cartilage tissue matrix, retains the ability to divide, and develops from a chondroblast cell." [GO_REF:0000034, MESH:A11.329.171]
synonym: "cartilage cell" EXACT []
xref: BTO:0000249
xref: CALOHA:TS-0138
xref: FMA:66782
is_a: CL:0000153 ! glycosaminoglycan secreting cell
is_a: CL:0000667 ! collagen secreting cell
relationship: develops_from CL:0000058 ! chondroblast
relationship: located_in UBERON:0002418 ! cartilage tissue

[Term]
id: CL:0000140
name: odontocyte
namespace: cell
def: "Skeletogenic cell that secretes dentine matrix, is derived from odontogenic papilla. Embedded in dentine tissue, and is the transformation of a non-terminally differentiated odontoblast cell." [GO_REF:0000034]
is_a: BFO:0000040 ! material entity
is_a: CARO:0000000
is_a: CL:0002320 ! connective tissue cell
relationship: develops_from CL:0000060 ! odontoblast
relationship: develops_from CL:0000134 ! mesenchymal stem cell
relationship: produces UBERON:0001751 ! dentine

[Term]
id: CL:0000141
name: cementocyte
namespace: cell
def: "An osteocytelike cell with numerous processes, trapped in a lacuna in the cement of the tooth." [ISBN:0781733901]
comment: CHECK: wikipedia says that cementocytes no longer produce cementum, but the phenoscape def is: Skeletogenic cell that produces cementum, is part of the odontogenic papilla, and is a transformation of a cementoblast cell (no change to existing def).
xref: FMA:63003
is_a: CL:0000137 ! osteocyte
relationship: develops_from CL:0000061 ! cementoblast
relationship: part_of UBERON:0005176 ! tooth enamel organ

[Term]
id: CL:0000142
name: hyalocyte
namespace: cell
def: "A cell occurring in the peripheral part of the vitreous body of the eye that may be responsible for production of hyaluronic acid and collagen." [GOC:tfm, PMID:19073178]
synonym: "vitreous cell" RELATED []
xref: BTO:0004271
xref: FMA:70620
is_a: CL:0000499 ! stromal cell

[Term]
id: CL:0000143
name: guidepost cell
namespace: cell
is_a: CL:0000130 ! neuron associated cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000144
name: obsolete cell by function
namespace: cell
def: "OBSOLETE: A classification of cells by their primary end goal or behavior." [FB:ma]
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its function or behavior. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000145
name: professional antigen presenting cell
namespace: cell
def: "A cell capable of processing and presenting lipid and protein antigens to T cells in order to initiate an immune response." [GOC:add, ISBN:0781735149]
comment: Note change of name; nearly all somatic cells can present antigens to T cells via MHC Class I complexes leading to effector responses, but professional antigen presenting cells constitutively express MHC Class II as well as costimulatory molecules, and thus can initiate immune responses via T cells.
synonym: "APC" BROAD []
is_a: CL:0000738 ! leukocyte
intersection_of: CL:0000738 ! leukocyte
intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
relationship: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II

[Term]
id: CL:0000146
name: simple columnar epithelial cell
namespace: cell
is_a: CL:0000075 ! columnar/cuboidal epithelial cell

[Term]
id: CL:0000147
name: pigment cell
namespace: cell
def: "A pigment cell is a cell that contains pigment granules." [GOC:tfm]
synonym: "chromatocyte" EXACT []
synonym: "chromatophore" EXACT []
xref: VHOG:0001678
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000148
name: melanocyte
namespace: cell
alt_id: CL:0000572
def: "A pigment cell derived from the neural crest. Contains melanin-filled pigment granules, which gives a brown to black appearance." [SANBI:mhl]
synonym: "melanophore" NARROW []
xref: BTO:0000847
xref: CALOHA:TS-0613
xref: FMA:70545
xref: VHOG:0001679
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 {is_inferred="true"} ! pigment cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000147 ! pigment cell
intersection_of: develops_from CL:0000541 ! melanoblast
intersection_of: has_part GO:0042470 ! melanosome
relationship: develops_from CL:0000541 ! melanoblast
relationship: has_part GO:0042470 ! melanosome

[Term]
id: CL:0000149
name: visual pigment cell
namespace: cell
synonym: "pigment cell" BROAD []
is_a: CL:0000147 ! pigment cell

[Term]
id: CL:0000150
name: glandular epithelial cell
namespace: cell
def: "A specialized epithelial cell that is capable of synthesizing and secreting certain biomolecules." [GOC:tfm]
xref: CALOHA:TS-2085
xref: FMA:86494
is_a: CL:0000066 ! epithelial cell
is_a: CL:0000151 ! secretory cell
is_a: CL:0002371 ! somatic cell
relationship: part_of UBERON:0006799 ! glandular epithelium

[Term]
id: CL:0000151
name: secretory cell
namespace: cell
def: "A cell that specializes in controlled release of one or more substances." [GOC:tfm, ISBN:0721662544]
xref: BTO:0003659
xref: FMA:86916
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0032940 ! secretion by cell
relationship: capable_of GO:0032940 ! secretion by cell

[Term]
id: CL:0000152
name: exocrine cell
namespace: cell
def: "A cell of an exocrine gland; i.e. a gland that discharges its secretion via a duct." [ISBN:0198547684]
xref: FMA:16014
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: part_of UBERON:0002365 ! exocrine gland
relationship: part_of UBERON:0002365 ! exocrine gland

[Term]
id: CL:0000153
name: glycosaminoglycan secreting cell
namespace: cell
def: "A cell that secretes glycosaminoglycans." [GOC:tfm]
synonym: "GAG secreting cell" EXACT []
synonym: "hyaluronic acid secreting cell" NARROW []
is_a: CL:0000327 ! extracellular matrix secreting cell
is_a: CL:0000447 ! carbohydrate secreting cell

[Term]
id: CL:0000154
name: protein secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0009306 ! protein secretion
relationship: capable_of GO:0009306 ! protein secretion

[Term]
id: CL:0000155
name: peptic cell
namespace: cell
def: "A cell that is usually basal in position, cuboidal with round nucleus, short microvilli, secretes pepsinogen." [GOC:tfm]
synonym: "chief cell of stomach" EXACT []
synonym: "gastric chief cell" EXACT []
synonym: "pepsinogen secreting cell" EXACT []
synonym: "zymogenic cell" EXACT []
xref: FMA:62902
is_a: CL:0000154 ! protein secreting cell
is_a: CL:0002659 ! glandular cell of stomach

[Term]
id: CL:0000156
name: obsolete antibody secreting cell
namespace: cell
def: "OBSOLETE: A cell of the lymphoid series that can react with antigen to produce specific cell products called antibodies. Various cell subpopulations, often B cells, can be defined, based on the different classes of immunoglobulins that they synthesize." []
comment: Consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000157
name: surfactant secreting cell
namespace: cell
def: "A cell that specializes in secretion of surfactant in the alveoli of the lung." [GOC:tfm, ISBN:0721662544]
is_a: CL:0000151 {is_inferred="true"} ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0043129 ! surfactant homeostasis
relationship: capable_of GO:0043129 ! surfactant homeostasis

[Term]
id: CL:0000158
name: club cell
namespace: cell
def: "Epithelial progenitor cell of the lung. Club cells are dome-shaped with short microvilli but no cilia. They function to protect the bronchiolar epithelium. Club cells also multiply and differentiate into ciliated cells to regenerate the bronchiolar epithelium." [DOI:10.1183/09031936.00146609, DOI:https\://doi.org/10.1378/chest.12-2762, GOC:tfm, PMID:28128362, PMID:7905712]
synonym: "bronchiolar non-ciliated cell" EXACT []
synonym: "Clara cell" EXACT []
synonym: "club cell of bronchiole" EXACT []
xref: BTO:0004811
xref: FMA:14119
is_a: CARO:0000006
is_a: CL:0000157 ! surfactant secreting cell
is_a: CL:0002328 {is_inferred="true"} ! bronchial epithelial cell
intersection_of: CL:0002328 ! bronchial epithelial cell
intersection_of: bearer_of PATO:0001789 ! domed
intersection_of: capable_of GO:0032940 ! secretion by cell
intersection_of: capable_of GO:0043129 ! surfactant homeostasis
intersection_of: RO:0002104 GO:0005902 ! has plasma membrane part microvillus
relationship: bearer_of PATO:0001789 ! domed
relationship: RO:0002104 GO:0005902 ! has plasma membrane part microvillus

[Term]
id: CL:0000159
name: seromucus secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000160
name: goblet cell
namespace: cell
def: "A cell of the epithelial lining that produce and secrete mucins." [MESH:A03.492.411.369.320]
synonym: "chalice cell" EXACT []
xref: BTO:0001540
xref: FMA:13148
xref: http://en.wikipedia.org/wiki/Goblet_cell
is_a: CL:0000150 ! glandular epithelial cell
is_a: CL:0000319 ! mucus secreting cell

[Term]
id: CL:0000161
name: acid secreting cell
namespace: cell
is_a: CL:0000151 {is_inferred="true"} ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0046717 ! acid secretion
relationship: capable_of GO:0046717 ! acid secretion

[Term]
id: CL:0000162
name: parietal cell
namespace: cell
def: "A large, oval stomach epithelial cell with a central nucleus; source of gastric acid. Secretes HCl." [GOC:tfm, ISBN:0517223651]
synonym: "oxyntic cell" EXACT []
xref: BTO:0001780
xref: FMA:62901
is_a: CL:0000161 ! acid secreting cell
is_a: CL:0002659 ! glandular cell of stomach

[Term]
id: CL:0000163
name: endocrine cell
namespace: cell
def: "A cell of an endocrine gland, ductless glands that secrete substances which are released directly into the circulation and which influence metabolism and other body functions." [MESH:A06.407]
synonym: "endocrinocyte" EXACT []
xref: FMA:83809
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0060986 ! endocrine hormone secretion
relationship: capable_of GO:0060986 ! endocrine hormone secretion
relationship: part_of UBERON:0002368 ! endocrine gland

[Term]
id: CL:0000164
name: enteroendocrine cell
namespace: cell
def: "An endocrine cell that is located in the epithelium of the gastrointestinal tract or in the pancreas." [GOC:tfm, SANBI:mhl]
xref: BTO:0003865
xref: FMA:62930
is_a: CL:0000150 ! glandular epithelial cell
is_a: CL:0000163 ! endocrine cell

[Term]
id: CL:0000165
name: neuroendocrine cell
namespace: cell
def: "An endocrine cell that has the specialized function to produce and secrete hormones in response to neuronal signals." [MESH:A06.688]
synonym: "neurosecretory cell" EXACT []
xref: BTO:0002691
xref: FMA:83810
is_a: CL:0000163 ! endocrine cell
is_a: CL:0000393 ! electrically responsive cell
is_a: CL:0000710 ! neurecto-epithelial cell

[Term]
id: CL:0000166
name: chromaffin cell
namespace: cell
def: "A cell that stores epinephrine secretory vesicles. During times of stress, the nervous system signals the vesicles to secrete their hormonal content. Their name derives from their ability to stain a brownish color with chromic salts. Characteristically, they are located in the adrenal medulla and paraganglia of the sympathetic nervous system." [MESH:A06.224.161]
synonym: "phaeochromocyte" EXACT []
xref: BTO:0000259
xref: FMA:69263
is_a: CL:0000568 ! amine precursor uptake and decarboxylation cell
relationship: develops_from CL:0000333 ! migratory neural crest cell

[Term]
id: CL:0000167
name: peptide hormone secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0030072 ! peptide hormone secretion
relationship: capable_of GO:0030072 ! peptide hormone secretion

[Term]
id: CL:0000168
name: insulin secreting cell
namespace: cell
xref: BTO:0000783
is_a: CL:0000154 ! protein secreting cell
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0030073 ! insulin secretion
relationship: capable_of GO:0030073 ! insulin secretion

[Term]
id: CL:0000169
name: type B pancreatic cell
namespace: cell
def: "A cell that secretes insulin and is located towards the center of the islets of Langerhans." [GOC:tfm, http://en.wikipedia.org/wiki/Pancreatic_b_cell, ISBN:0517223651]
comment: Pancreatic beta cells are also reportedly CD284-positive. Upon activation, they upregulate their CD14 expression.
synonym: "B-cell of pancreatic islet" EXACT [FMA:70586]
synonym: "beta cell" BROAD [ZFA:0009102]
synonym: "beta cell islet" RELATED [MA:0002419]
synonym: "beta cell of pancreatic islet" EXACT [FMA:70586]
synonym: "insulin-secreting cell" EXACT [FMA:70586]
synonym: "pancreatic B cell" EXACT []
synonym: "pancreatic B-cell" EXACT [FMA:70586]
synonym: "pancreatic beta cell" EXACT [FMA:70586]
synonym: "pancreatic islet core" EXACT [MA:0002419]
synonym: "type B enteroendocrine cell" EXACT [FMA:70586]
xref: BTO:0000783
xref: EV:0200009
xref: FMA:70586
xref: MA:0002419
xref: ncithesaurus:Beta_Cell
is_a: CL:0000083 ! epithelial cell of pancreas
is_a: CL:0000164 {is_inferred="true"} ! enteroendocrine cell
is_a: CL:0000168 {is_inferred="true"} ! insulin secreting cell
is_a: CL:0008024 ! pancreatic endocrine cell
intersection_of: CL:0000164 ! enteroendocrine cell
intersection_of: capable_of GO:0030073 ! insulin secretion
intersection_of: part_of UBERON:0000006 ! islet of Langerhans
relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas
relationship: part_of UBERON:0000006 ! islet of Langerhans

[Term]
id: CL:0000170
name: glucagon secreting cell
namespace: cell
def: "A cell that secretes glucagon." [GOC:tfm]
synonym: "glucagon-secreting cell" EXACT []
xref: FMA:84045
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0070091 ! glucagon secretion
relationship: capable_of GO:0070091 ! glucagon secretion

[Term]
id: CL:0000171
name: pancreatic A cell
namespace: cell
def: "A type of enteocrine cell found in the periphery of the islets of Langerhans that secretes glucagon." [GOC:tfm, ISBN:0721662544]
synonym: "alpha cell of islet of Langerhans" EXACT []
synonym: "pancreatic alpha cell" EXACT []
xref: BTO:0000990
xref: FMA:70585
is_a: CL:0000083 ! epithelial cell of pancreas
is_a: CL:0002067 ! type A enteroendocrine cell
is_a: CL:0008024 ! pancreatic endocrine cell
intersection_of: CL:0002067 ! type A enteroendocrine cell
intersection_of: part_of UBERON:0001264 ! pancreas
relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas
relationship: part_of UBERON:0000006 ! islet of Langerhans

[Term]
id: CL:0000172
name: somatostatin secreting cell
namespace: cell
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0070253 ! somatostatin secretion
relationship: capable_of GO:0070253 ! somatostatin secretion

[Term]
id: CL:0000173
name: pancreatic D cell
namespace: cell
def: "A D cell located in the pancreas. Peripherally placed within the islets like type A cells; contains somatostatin." [FMA:0517223651, GOC:tfm]
synonym: "D-cell of pancreatic islet" EXACT []
synonym: "delta cell of islet" EXACT []
synonym: "delta cell of pancreatic islet" EXACT []
synonym: "pancreatic D-cell" EXACT []
synonym: "pancreatic delta cell" EXACT []
synonym: "somatostatin-secreting pancreatic cell" EXACT []
xref: BTO:0000803
xref: FMA:70587
is_a: CL:0000083 ! epithelial cell of pancreas
is_a: CL:0000502 ! type D enteroendocrine cell
is_a: CL:0008024 ! pancreatic endocrine cell
intersection_of: CL:0000502 ! type D enteroendocrine cell
intersection_of: part_of UBERON:0001264 ! pancreas
relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas
relationship: part_of UBERON:0000006 ! islet of Langerhans

[Term]
id: CL:0000174
name: steroid hormone secreting cell
namespace: cell
is_a: CL:0000163 ! endocrine cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035929 ! steroid hormone secretion
relationship: capable_of GO:0035929 ! steroid hormone secretion

[Term]
id: CL:0000175
name: luteal cell
namespace: cell
def: "A progesterone secreting cell in the corpus luteum. The large luteal cells develop from the granulosa cells. The small luteal cells develop from the theca cells." [MESH:A05.360.319.114.630.278.400]
synonym: "lutein cell" EXACT []
xref: BTO:0003939
xref: FMA:18688
is_a: CL:0000179 ! progesterone secreting cell
is_a: CL:0002132 ! stromal cell of ovary
relationship: part_of UBERON:0002512 ! corpus luteum

[Term]
id: CL:0000176
name: ecdysteroid secreting cell
namespace: cell
is_a: CL:0000174 ! steroid hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0045457 ! ecdysteroid secretion
relationship: capable_of GO:0045457 ! ecdysteroid secretion

[Term]
id: CL:0000177
name: testosterone secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035936 ! testosterone secretion
relationship: capable_of GO:0035936 ! testosterone secretion

[Term]
id: CL:0000178
name: Leydig cell
namespace: cell
def: "A Leydig cell is a testosterone-secreting cell in the interstitial area, between the seminiferous tubules, in the testis." [GOC:tfm, PMID:12050120]
comment: Note that the Amphibian Anatomy Ontology (AA) has a class 'leydig cells' but this is unrelated
synonym: "interstitial cell" BROAD []
synonym: "interstitial cell of Leydig" EXACT []
xref: BTO:0000755
xref: CALOHA:TS-1150
xref: EMAPA:29655
xref: FMA:72297
is_a: CL:0000177 ! testosterone secreting cell
relationship: part_of UBERON:0005212 ! Leydig cell region of testis

[Term]
id: CL:0000179
name: progesterone secreting cell
namespace: cell
is_a: CL:0000174 ! steroid hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0042701 ! progesterone secretion
relationship: capable_of GO:0042701 ! progesterone secretion

[Term]
id: CL:0000180
name: estradiol secreting cell
namespace: cell
def: "A steroid hormone secreting cell that secretes estradiol." [https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000151 ! secretory cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035938 ! estradiol secretion
relationship: capable_of GO:0035938 ! estradiol secretion

[Term]
id: CL:0000181
name: obsolete metabolising cell
namespace: cell
def: "A cell whose primary function is intermediary metabolism." [FB:ma]
comment: Removing this grouping class, because the groupings are incomplete and too hard to maintain.
property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/720 xsd:string
is_obsolete: true

[Term]
id: CL:0000182
name: hepatocyte
namespace: cell
def: "The main structural component of the liver. They are specialized epithelial cells that are organized into interconnected plates called lobules. Majority of cell population of liver, polygonal in shape, arranged in plates or trabeculae between sinusoids; may have single nucleus or binucleated." [GOC:tfm, http://en.wikipedia.org/wiki/Hepatocyte, ISBN:0412046911, MESH:A11.436.348, PMID:19717280]
comment: Hepatocytes are reportedly MHC Class I-positive and MHC Class II-positive.
xref: BTO:0000575
xref: CALOHA:TS-0454
xref: FMA:14515
is_a: BFO:0000040 ! material entity
is_a: CARO:0000000
is_a: CL:0000066 ! epithelial cell
is_a: CL:0000417 ! endopolyploid cell
is_a: CL:0002371 ! somatic cell
relationship: capable_of GO:0006699 ! bile acid biosynthetic process
relationship: capable_of GO:0098754 ! detoxification
relationship: develops_from CL:0005026 ! hepatoblast
relationship: part_of UBERON:0002107 ! liver

[Term]
id: CL:0000183
name: contractile cell
namespace: cell
def: "A cell whose primary function is to shorten." [FB:ma]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000185
name: myoepithelial cell
namespace: cell
def: "Contractile cells resembling smooth muscle cells that are present in glands, notably the mammary gland, and aid in secretion. This cell has long weaving dendritic processes containing myofilament." [GOC:tfm, ISBN:0721662544]
synonym: "basket epithelial cell" EXACT []
synonym: "myoepitheliocyte" EXACT []
xref: BTO:0002309
xref: CALOHA:TS-2379
xref: FMA:67799
is_a: CL:0000075 ! columnar/cuboidal epithelial cell
is_a: CL:0000183 ! contractile cell
is_a: CL:0002078 ! meso-epithelial cell

[Term]
id: CL:0000186
name: myofibroblast cell
namespace: cell
def: "An animal cell that has characteristics of both a fibroblast cell and a smooth muscle cell." [GOC:dsd, GOC:tfm, MESH:D058628, PMID:19800625, PMID:20630469]
comment: Myofibroblasts are alpha-SMA-positive, CD34-negative, CD45-negative. They are reportedly capable of secreting IL-1beta, IL-6, and TNF-alpha.
synonym: "MFB" EXACT [PMID:8731193]
is_a: CL:0000183 ! contractile cell
is_a: CL:0000548 ! animal cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000187
name: muscle cell
namespace: cell
def: "A mature contractile cell, commonly known as a myocyte. This cell has as part of its cytoplasm myofibrils organized in various patterns." [MESH:A11.620]
synonym: "muscle fiber" EXACT []
synonym: "myocyte" EXACT []
xref: BTO:0000888
xref: BTO:0000902
xref: CALOHA:TS-2032
xref: FBbt:00005074
xref: FMA:67328
xref: WBbt:0003675
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000183 ! contractile cell
is_a: CL:0000393 ! electrically responsive cell
is_a: CL:0000548 ! animal cell
is_a: CL:0002371 ! somatic cell
relationship: develops_from CL:0000056 ! myoblast

[Term]
id: CL:0000188
name: cell of skeletal muscle
namespace: cell
def: "A somatic cell located in skeletal muscle." [GOC:tfm]
synonym: "skeletal muscle cell" EXACT []
xref: BTO:0004392
xref: CALOHA:TS-2158
xref: FMA:9727
is_a: BFO:0000004 ! independent continuant
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0002371 ! somatic cell
intersection_of: part_of UBERON:0001134 ! skeletal muscle tissue
relationship: part_of UBERON:0001134 ! skeletal muscle tissue

[Term]
id: CL:0000189
name: slow muscle cell
namespace: cell
def: "A muscle cell that develops tension more slowly than a fast-twitch fiber." [GOC:tfm, ISBN:0323052908]
synonym: "slow muscle fiber" RELATED [ISBN:0815316208]
xref: FMA:84448
is_a: CL:0008046 ! extrafusal muscle fiber
relationship: develops_from CL:0000857 ! slow muscle myoblast

[Term]
id: CL:0000190
name: fast muscle cell
namespace: cell
def: "A muscle cell that can develop high tension rapidly. It is usually innervated by a single alpha neuron." [GOC:tfm, ISBN:0323052908]
synonym: "glycolytic muscle fiber" EXACT []
is_a: CL:0008046 ! extrafusal muscle fiber
relationship: develops_from CL:0000858 ! fast muscle myoblast

[Term]
id: CL:0000192
name: smooth muscle cell
namespace: cell
alt_id: CL:0000191
def: "A non-striated, elongated, spindle-shaped cell found lining the digestive tract, uterus, and blood vessels. They develop from specialized myoblasts (smooth muscle myoblast)." [http://en.wikipedia.org/wiki/Smooth_muscle_cell, MESH:A11.620.520, MESH:D032389, PMID:9315361]
synonym: "myocytes, smooth muscle" EXACT [MESH:D032389]
synonym: "non-striated muscle cell" BROAD []
synonym: "SMCs" EXACT [PMID:9315361]
synonym: "smooth muscle fiber" EXACT []
xref: BTO:0004576
xref: CALOHA:TS-2159
xref: FMA:14072
is_a: CL:0008000 ! non-striated muscle cell
is_a: CL:0008007 ! visceral muscle cell
relationship: develops_from CL:0000514 ! smooth muscle myoblast

[Term]
id: CL:0000193
name: cardiac muscle cell (sensu Arthopoda)
namespace: cell
alt_id: CL:0000466
def: "A striated muscle cell of an arthropod heart that participates in heart contraction." [MESH:A11.620.500]
is_a: CL:0000746 ! cardiac muscle cell
intersection_of: CL:0000746 ! cardiac muscle cell
intersection_of: develops_from CL:0000465 ! cardioblast (sensu Arthropoda)
relationship: develops_from CL:0000465 ! cardioblast (sensu Arthropoda)

[Term]
id: CL:0000194
name: obsolete nodal cardiac cell
namespace: cell
comment: Consider CL:0002072.
is_obsolete: true

[Term]
id: CL:0000195
name: obsolete Purkinje fiber
namespace: cell
is_obsolete: true

[Term]
id: CL:0000196
name: flight muscle cell
namespace: cell
is_a: CL:0008003 ! somatic muscle myotube

[Term]
id: CL:0000197
name: sensory receptor cell
namespace: cell
def: "A cell that is capable of detection of a stimulus involved in sensory perception." []
synonym: "receptor cell" EXACT []
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
intersection_of: CL:0000000 ! cell
intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception
intersection_of: part_of UBERON:0001032 ! sensory system
relationship: capable_of GO:0050906 ! detection of stimulus involved in sensory perception
relationship: part_of UBERON:0001032 ! sensory system

[Term]
id: CL:0000198
name: pain receptor cell
namespace: cell
def: "The peripheral receptor for pain. Includes receptors which are sensitive to painful mechanical stimuli, extreme heat or cold, and chemical stimuli. All mammalian nociceptors are free nerve endings." [MESH:A08.800.550.700.650]
comment: Editor note: request detection of stimulus involved in sensory perception of pain; add develops_from relationship
synonym: "nociceptor" EXACT []
synonym: "nocireceptor" EXACT []
is_a: CL:0000006 ! neuronal receptor cell

[Term]
id: CL:0000199
name: mechanoreceptor cell
namespace: cell
def: "A cell specialized to transduce mechanical stimuli and relay that information centrally in the nervous system." [MESH:A08.800.550.700.500]
synonym: "mechanoreceptor" RELATED [MP:0000972]
is_a: CL:0000101 ! sensory neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050974 ! detection of mechanical stimulus involved in sensory perception
relationship: capable_of GO:0050974 ! detection of mechanical stimulus involved in sensory perception

[Term]
id: CL:0000200
name: touch receptor cell
namespace: cell
is_a: CL:0000199 ! mechanoreceptor cell
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050976 ! detection of mechanical stimulus involved in sensory perception of touch
relationship: capable_of GO:0050976 ! detection of mechanical stimulus involved in sensory perception of touch

[Term]
id: CL:0000202
name: auditory hair cell
namespace: cell
alt_id: CL:0000201
def: "A mechanoreceptor cell of the auditory or vestibular system that is sensitive to auditory stimuli. The accessory sensory structures are arranged so that appropriate stimuli cause movement of the hair-like projections (stereocilia and kinocilia) which relay the information centrally in the nervous system." [MESH:A08.663.650.250, WikipediaVersioned:Hair_cell&oldid=1045345915]
comment: In mammals these cells are located in the organ of Corti.
synonym: "auditory receptor cell" RELATED []
xref: FMA:62364
is_a: CL:0000855 ! sensory hair cell
relationship: capable_of GO:0050910 ! detection of mechanical stimulus involved in sensory perception of sound

[Term]
id: CL:0000203
name: gravity sensitive cell
namespace: cell
is_a: CL:0000006 ! neuronal receptor cell
is_a: CL:0000199 ! mechanoreceptor cell
intersection_of: CL:0000006 ! neuronal receptor cell
intersection_of: capable_of GO:0070999 ! detection of mechanical stimulus involved in sensory perception of gravity
relationship: capable_of GO:0070999 ! detection of mechanical stimulus involved in sensory perception of gravity

[Term]
id: CL:0000204
name: acceleration receptive cell
namespace: cell
is_a: CL:0000006 ! neuronal receptor cell

[Term]
id: CL:0000205
name: thermoreceptor cell
namespace: cell
def: "A cellular receptor which mediates the sense of temperature. Thermoreceptor cells in vertebrates are mostly located under the skin. In mammals there are separate types of thermoreceptors for cold and for warmth and pain receptor cells which detect cold or heat extreme enough to cause pain." [GOC:tfm, MESH:A08.800.550.700.840, MP:0000971]
is_a: CL:0000006 ! neuronal receptor cell
intersection_of: CL:0000006 ! neuronal receptor cell
intersection_of: capable_of GO:0050960 ! detection of temperature stimulus involved in thermoception
relationship: capable_of GO:0050960 ! detection of temperature stimulus involved in thermoception

[Term]
id: CL:0000206
name: chemoreceptor cell
namespace: cell
def: "A cell specialized to detect chemical substances and relay that information centrally in the nervous system. Chemoreceptors may monitor external stimuli, as in taste and olfaction, or internal stimuli, such as the concentrations of oxygen and carbon dioxide in the blood." [MESH:A08.800.550.700.120]
is_a: CL:0000101 ! sensory neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050907 ! detection of chemical stimulus involved in sensory perception
relationship: capable_of GO:0050907 ! detection of chemical stimulus involved in sensory perception

[Term]
id: CL:0000207
name: olfactory receptor cell
namespace: cell
synonym: "odorant receptor cell" EXACT []
synonym: "olfactory receptor neuron" EXACT []
synonym: "olfactory sensory neuron" EXACT []
synonym: "Schultze's cell" EXACT []
xref: BTO:0004185
xref: FMA:67860
xref: Wikipedia:Olfactory_receptor_neuron
is_a: CL:0000006 ! neuronal receptor cell
is_a: CL:0000206 ! chemoreceptor cell
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050911 ! detection of chemical stimulus involved in sensory perception of smell
relationship: capable_of GO:0050911 ! detection of chemical stimulus involved in sensory perception of smell
relationship: part_of UBERON:0005725 ! olfactory system

[Term]
id: CL:0000208
name: pH receptor cell
namespace: cell
is_a: CL:0000206 ! chemoreceptor cell

[Term]
id: CL:0000209
name: taste receptor cell
namespace: cell
def: "A cell type found in the spherical or ovoid clusters of receptor cells found mainly in the epithelium of the tongue and constituting the end organs of the sense of taste." [GOC:tfm, ISBN:0618947256]
synonym: "taste bud cell" EXACT []
xref: FMA:67910
is_a: CL:0000006 ! neuronal receptor cell
is_a: CL:0000098 ! sensory epithelial cell
is_a: CL:0000206 ! chemoreceptor cell
is_a: CL:0000362 ! epidermal cell
is_a: CL:0002076 ! endo-epithelial cell
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050912 ! detection of chemical stimulus involved in sensory perception of taste
relationship: capable_of GO:0050912 ! detection of chemical stimulus involved in sensory perception of taste
relationship: part_of UBERON:0002025 ! stratum basale of epidermis

[Term]
id: CL:0000210
name: photoreceptor cell
namespace: cell
def: "A cell specialized to detect and transduce light." [MESH:A08.663.650.650]
xref: BTO:0001060
xref: CALOHA:TS-0868
xref: FBbt:00004211
xref: FMA:86740
is_a: CL:0000006 {is_inferred="true"} ! neuronal receptor cell
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0050962 ! detection of light stimulus involved in sensory perception
relationship: capable_of GO:0050962 ! detection of light stimulus involved in sensory perception

[Term]
id: CL:0000211
name: electrically active cell
namespace: cell
def: "A cell whose function is determined by the generation or the reception of an electric signal." [FB:ma]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000212
name: absorptive cell
namespace: cell
def: "A cell that takes up and metabolizes substances." [CL:CVS]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000213
name: lining cell
namespace: cell
def: "A cell within an epithelial cell sheet whose main function is to act as an internal or external covering for a tissue or an organism." [JB:jb]
synonym: "boundary cell" EXACT []
is_a: CL:0000215 ! barrier cell

[Term]
id: CL:0000214
name: synovial cell
namespace: cell
def: "A cell located in the synovial joint." []
synonym: "synoviocyte" EXACT []
xref: CALOHA:TS-0995
is_a: CL:0000213 ! lining cell
is_a: CL:0002078 {is_inferred="true"} ! meso-epithelial cell
relationship: part_of UBERON:0002217 ! synovial joint

[Term]
id: CL:0000215
name: barrier cell
namespace: cell
def: "A cell whose primary function is to prevent the transport of stuff across compartments." [JB:jb]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000216
name: Sertoli cell
namespace: cell
def: "A supporting cell projecting inward from the basement membrane of seminiferous tubules. They surround and nourish the developing male germ cells and secrete androgen binding protein. Their tight junctions with the spermatogonia and spermatocytes provide a blood-testis barrier." [MESH:A05.360.444.849.789]
xref: BTO:0001238
xref: CALOHA:TS-0922
xref: FMA:72298
xref: VHOG:0001348
is_a: CL:0000511 ! androgen binding protein secreting cell
is_a: CL:0000630 {is_inferred="true"} ! supporting cell
is_a: CL:0002625 ! seminiferous tubule epithelial cell
intersection_of: CL:0000630 ! supporting cell
intersection_of: part_of UBERON:0001343 ! seminiferous tubule of testis

[Term]
id: CL:0000217
name: insulating cell
namespace: cell
is_a: CL:0000215 ! barrier cell

[Term]
id: CL:0000218
name: myelinating Schwann cell
namespace: cell
def: "A neuroglial cell of the peripheral nervous system which forms the insulating myelin sheaths of peripheral axons." [GOC:cvs, GOC:tfm, MESH:A08.637.800]
synonym: "neurilemmal cell" EXACT []
synonym: "peripheral neuroglial cell" BROAD []
synonym: "Schwann cell" BROAD []
xref: CALOHA:TS-0898
xref: FMA:62121
is_a: CL:0000217 ! insulating cell
is_a: CL:0000328 ! myelin accumulating cell
is_a: CL:0002573 ! Schwann cell
relationship: develops_from CL:0002377 ! immature Schwann cell

[Term]
id: CL:0000219
name: motile cell
namespace: cell
def: "A cell that moves by its own activities." [FB:ma]
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0048870 ! cell motility
relationship: capable_of GO:0048870 ! cell motility

[Term]
id: CL:0000220
name: obsolete cell by lineage
namespace: cell
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell in a multicellular organiam, apart from a zygote, can potentially be classified by its lineage. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000221
name: ectodermal cell
namespace: cell
def: "A cell of the outer of the three germ layers of the embryo." [MESH:A16.254.425.273]
synonym: "ectoderm cell" EXACT []
xref: FMA:72549
is_a: BFO:0000004 ! independent continuant
is_a: CL:0002321 ! embryonic cell (metazoa)
relationship: part_of UBERON:0000924 ! ectoderm

[Term]
id: CL:0000222
name: mesodermal cell
namespace: cell
def: "A cell of the middle germ layer of the embryo." [MESH:A16.254.425.660]
synonym: "mesoblast" EXACT []
synonym: "mesoderm cell" EXACT []
xref: FMA:72554
is_a: BFO:0000004 ! independent continuant
is_a: CL:0002321 ! embryonic cell (metazoa)
relationship: part_of UBERON:0000926 ! mesoderm

[Term]
id: CL:0000223
name: endodermal cell
namespace: cell
def: "A cell of the inner of the three germ layers of the embryo." [MESH:A16.254.425.407]
synonym: "endoderm cell" EXACT []
xref: FMA:72555
is_a: BFO:0000004 ! independent continuant
is_a: CL:0002321 ! embryonic cell (metazoa)
relationship: part_of UBERON:0000925 ! endoderm

[Term]
id: CL:0000224
name: obsolete cell by nuclear number
namespace: cell
def: "OBSOLETE: A classification of cells by the number of their nuclei." [FB:ma, GOC:tfm]
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its nuclear number (note that this term was previously used as a parent class of enucleate cell). If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0001034

[Term]
id: CL:0000225
name: anucleate cell
namespace: cell
def: "A cell that lacks a nucleus." [FB:ma]
synonym: "non-nucleated cell" EXACT []
xref: FMA:68647
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001405 ! anucleate
disjoint_from: CL:0002242 ! nucleate cell
relationship: bearer_of PATO:0001405 ! anucleate

[Term]
id: CL:0000226
name: single nucleate cell
namespace: cell
def: "A cell with a single nucleus." [FB:ma, GOC:tfm]
is_a: CL:0002242 ! nucleate cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001407 ! mononucleate
relationship: bearer_of PATO:0001407 ! mononucleate

[Term]
id: CL:0000227
name: binucleate cell
namespace: cell
is_a: CL:0000228 ! multinucleate cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001406 ! binucleate
relationship: bearer_of PATO:0001406 ! binucleate

[Term]
id: CL:0000228
name: multinucleate cell
namespace: cell
def: "A cell with more than one nucleus." [FB:ma]
synonym: "syncitium" EXACT []
synonym: "syncytial cell" EXACT []
synonym: "syncytium" EXACT []
xref: AEO:0000203
xref: WBbt:0008074
is_a: CL:0002242 ! nucleate cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001908 ! multinucleate
relationship: bearer_of PATO:0001908 ! multinucleate

[Term]
id: CL:0000229
name: obsolete lymphoblast
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Refers to an activated mature lymphocyte phenotype rather than a distinct cell type; consider using 'lymphocyte ; CL:0000542' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000230
name: obsolete T lymphoblast
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Refers to an activated mature T lymphocyte phenotype rather than a distinct cell type; consider using 'T cell ; CL:0000084' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000231
name: obsolete B lymphoblast
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Refers to an activated mature B lymphocyte phenotype rather than a distinct cell type; consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000232
name: erythrocyte
namespace: cell
def: "A red blood cell. In mammals, mature erythrocytes are biconcave disks containing hemoglobin whose function is to transport oxygen." [GOC:tfm, MESH:A11.118.290]
synonym: "RBC" EXACT []
synonym: "red blood cell" EXACT []
xref: BTO:0000424
xref: CALOHA:TS-0290
xref: FMA:81100
is_a: CL:0000081 ! blood cell
is_a: CL:0000329 ! oxygen accumulating cell
is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell
intersection_of: CL:0000764 ! erythroid lineage cell
intersection_of: bearer_of PATO:0002039 ! biconcave
intersection_of: capable_of GO:0008015 ! blood circulation
intersection_of: capable_of GO:0015671 ! oxygen transport
intersection_of: lacks_part GO:0005840 ! ribosome
intersection_of: lacks_plasma_membrane_part PR:000001945 ! transferrin receptor protein 1
relationship: bearer_of PATO:0002039 ! biconcave
relationship: develops_from CL:0000558 ! reticulocyte
relationship: lacks_part GO:0005840 ! ribosome
relationship: lacks_plasma_membrane_part PR:000001945 ! transferrin receptor protein 1

[Term]
id: CL:0000233
name: platelet
namespace: cell
def: "A non-nucleated disk-shaped cell formed by extrusion from megakaryocytes, found in the blood of all mammals, and mainly involved in blood coagulation." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Platelet, MESH:A11.118.188, MESH:D001792, PMID:11110672, PMID:16987572, PMID:17204662, PMID:17479180, PMID:20414831]
comment: Platelets are reportedly CCR1-positive, CCR2-negative, CCR3-positive, CCR4-positive, CCR5-negative, CCR6-negative, CCR7-negative, CCR8-negative, CCR9-negative, CCR10-negative, CD16-positive, CD23-positive, CD32-positive, CD40-positive, CD41-positive CD42-positive, CD61-positive, CD62P-positive, CD64-positive, CD89-positive, CD102-positive, CD147-positive (activated platelets), CD154-positive (activated platelets), CD162-positive, CD209, CD282-positive, CD284-positive, CD289-positive, CD181-negative, CD182-negative, CD183-negative, CD184-positive, CLEC2-positive, GPVI-positive, JAMC-positive, PAR1-positive, PAR2-negative, PAR3-positive, PAR4-positive, TSP1-positive, and TXA2R-positive. Platelets can reportedly produce CCL2, CCL3, CCL5, CCL7, CCL17, CD40L, CXCL1, CXCL4, CXCL4L1, CXCL5, CXCL7, CXCL8, CXCL12, EGF, factor V, factor VII, factor XI, factor XIII, bFGF, histamine, IGF-1, IL-1beta, PAI-1, PDGF, plasminogen, protein S, serotonin, TGF-beta, TFPI, VEGF, and vWF.
synonym: "anucleate thrombocyte" EXACT []
synonym: "blood platelet" EXACT []
synonym: "enucleate thrombocyte" EXACT []
xref: BTO:0000132
xref: CALOHA:TS-0803
xref: FMA:62851
is_a: CL:0000081 ! blood cell
is_a: CL:0000225 ! anucleate cell
is_a: CL:0000458 ! serotonin secreting cell
is_a: CL:0000763 {is_inferred="true"} ! myeloid cell
intersection_of: CL:0000763 ! myeloid cell
intersection_of: bearer_of PATO:0001405 ! anucleate
intersection_of: bearer_of PATO:0001874 ! discoid
intersection_of: capable_of GO:0007596 ! blood coagulation
intersection_of: capable_of GO:0008015 ! blood circulation
relationship: bearer_of PATO:0001874 ! discoid
relationship: capable_of GO:0007596 ! blood coagulation
relationship: develops_from CL:0000556 ! megakaryocyte

[Term]
id: CL:0000234
name: phagocyte
namespace: cell
def: "Any cell capable of ingesting particulate matter via phagocytosis." [GOC:add, ISBN:0721601464]
xref: BTO:0001044
xref: FMA:83806
is_a: CL:0000219 ! motile cell
is_a: CL:0000325 ! stuff accumulating cell
is_a: CL:0000473 ! defensive cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0006909 ! phagocytosis
relationship: capable_of GO:0006909 ! phagocytosis

[Term]
id: CL:0000235
name: macrophage
namespace: cell
def: "A mononuclear phagocyte present in variety of tissues, typically differentiated from monocytes, capable of phagocytosing a variety of extracellular particulate material, including immune complexes, microorganisms, and dead cells." [GO_REF:0000031, GOC:add, GOC:tfm, PMID:16213494, PMID:1919437]
comment: Morphology: Diameter 30_M-80 _M, abundant cytoplasm, low N/C ratio, eccentric nucleus. Irregular shape with pseudopods, highly adhesive. Contain vacuoles and phagosomes, may contain azurophilic granules; markers: Mouse & Human: CD68, in most cases CD11b. Mouse: in most cases F4/80+; role or process: immune, antigen presentation, & tissue remodelling; lineage: hematopoietic, myeloid.
synonym: "histiocyte" EXACT []
xref: BTO:0000801
xref: CALOHA:TS-0587
xref: FMA:63261
xref: FMA:83585
is_a: CL:0000145 ! professional antigen presenting cell
is_a: CL:0000234 ! phagocyte
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
intersection_of: capable_of GO:0006909 ! phagocytosis
intersection_of: capable_of GO:0031268 ! pseudopodium organization
relationship: capable_of GO:0031268 ! pseudopodium organization
relationship: develops_from CL:0000576 ! monocyte

[Term]
id: CL:0000236
name: B cell
namespace: cell
def: "A lymphocyte of B lineage that is capable of B cell mediated immunity." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "B lymphocyte" EXACT []
synonym: "B-cell" EXACT []
synonym: "B-lymphocyte" EXACT []
xref: BTO:0000776
xref: CALOHA:TS-0068
xref: FMA:62869
xref: VHOG:0001480
is_a: CL:0000945 {is_inferred="true"} ! lymphocyte of B lineage
intersection_of: CL:0000945 ! lymphocyte of B lineage
intersection_of: capable_of GO:0019724 ! B cell mediated immunity
relationship: capable_of GO:0019724 ! B cell mediated immunity

[Term]
id: CL:0000237
name: keratinizing barrier epithelial cell
namespace: cell
is_a: CL:0000240 ! stratified squamous epithelial cell
is_a: CL:0000311 ! keratin accumulating cell
is_a: CL:0002077 ! ecto-epithelial cell
relationship: develops_from CL:0000114 ! surface ectodermal cell

[Term]
id: CL:0000238
name: non keratinizing barrier epithelial cell
namespace: cell
is_a: CL:0000240 ! stratified squamous epithelial cell

[Term]
id: CL:0000239
name: brush border epithelial cell
namespace: cell
is_a: CL:0000067 ! ciliated epithelial cell
is_a: CL:0000075 ! columnar/cuboidal epithelial cell

[Term]
id: CL:0000240
name: stratified squamous epithelial cell
namespace: cell
is_a: CL:0000076 ! squamous epithelial cell
is_a: CL:0000079 ! stratified epithelial cell

[Term]
id: CL:0000241
name: stratified cuboidal epithelial cell
namespace: cell
is_a: CL:0000075 ! columnar/cuboidal epithelial cell
is_a: CL:0000079 ! stratified epithelial cell

[Term]
id: CL:0000242
name: Merkel cell
namespace: cell
def: "A modified epidermal cell located in the stratum basale. They are found mostly in areas where sensory perception is acute. Merkel cells are closely associated with an expanded terminal bulb of an afferent myelinated nerve fiber." [MESH:A08.800.550.700.500.425]
synonym: "Merkel's cell" EXACT []
xref: FMA:70548
is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata)
is_a: CL:0000312 {xref="PMID:19782676"} ! keratinocyte
is_a: CL:0000710 ! neurecto-epithelial cell
relationship: part_of UBERON:0002025 ! stratum basale of epidermis

[Term]
id: CL:0000243
name: obsolete glial cell (sensu Vertebrata)
namespace: cell
def: "A non-neuronal cell of the nervous system. They not only provide physical support, but also respond to injury, regulate the ionic and chemical composition of the extracellular milieu. Form the myelin insulation of nervous pathways, guide neuronal migration during development, and exchange metabolites with neurons. Neuroglia have high-affinity transmitter uptake systems, voltage-dependent and transmitter-gated ion channels, and can release transmitters, but their role in signaling (as in many other functions) is unclear." [MESH:A08.637]
comment: This is a grouping class that is no longer needed or wanted.
property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/715 xsd:string
is_obsolete: true

[Term]
id: CL:0000244
name: transitional epithelial cell
namespace: cell
def: "A cell characteristically found lining hollow organs that are subject to great mechanical change due to contraction and distention; originally thought to represent a transition between stratified squamous and columnar epithelium." [GOC:tfm, ISBN:0721662544]
xref: FMA:66778
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000245
name: obsolete passage cell
namespace: cell
def: "Obsolete. Use PO:0000353 from Plant Ontology instead. Cell in exodermis or endodermis that remains thin walled when the associated cells develop thick secondary walls. Has casparian strip in endodermis." [ISBN:0471245208]
comment: replaced_by: PO:0000353
is_obsolete: true

[Term]
id: CL:0000246
name: Mauthner neuron
namespace: cell
is_a: CL:0000099 ! interneuron

[Term]
id: CL:0000247
name: Rohon-Beard neuron
namespace: cell
def: "Type of neuron that is a primary mechanosensory cell, with peripheral neurites innervating the skin with free nerve endings." [VHOG:0001484]
synonym: "RB neuron" RELATED [VHOG:0001484]
synonym: "Rohon Beard cell" EXACT [VHOG:0001484]
synonym: "Rohon-Beard cell" EXACT []
xref: AAO:0010316
xref: EFO:0003711
xref: VHOG:0001484
is_a: CL:0000531 ! primary sensory neuron

[Term]
id: CL:0000248
name: obsolete microsporocyte
namespace: cell
def: "Obsolete. Use PO:0020047 from Plant Ontology instead. A diploid (2n) cell that undergoes meiosis and forms four haploid (1n) microspores; also called microspore mother cell and, in seed plants, pollen mother cell." [ISBN:0471245208]
comment: replaced_by: PO:0020047
synonym: "pollen mother cell" EXACT []
synonym: "primary sporogenous cell" EXACT []
is_obsolete: true

[Term]
id: CL:0000249
name: hatching gland cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000250
name: obsolete megaspore
namespace: cell
def: "Obsolete. Use PO:0020019 from Plant Ontology instead. A haploid (1n) spore developing into a female gametophyte in heterosporous plants." [ISBN:0471245208]
comment: replaced_by: PO:0020019
is_obsolete: true

[Term]
id: CL:0000251
name: extramedullary cell
namespace: cell
is_a: CL:0000101 ! sensory neuron

[Term]
id: CL:0000252
name: obsolete microspore
namespace: cell
def: "Obsolete. Use PO:0020048 from Plant Ontology instead. A haploid (1n) spore developing into a male gametophyte in heterosporous plants; the uninucleate pollen grain in seed plants." [ISBN:0471245208]
comment: replaced_by: PO:0020048
is_obsolete: true

[Term]
id: CL:0000253
name: eurydendroid cell
namespace: cell
is_a: CL:0000527 ! efferent neuron

[Term]
id: CL:0000254
name: obsolete egg cell
namespace: cell
def: "Obsolete. Use PO:0020094 from Plant Ontology instead. The female gamete of plants." [TAIR:lr]
comment: replaced_by: PO:0020094
synonym: "female gametophyte egg cell" EXACT []
is_obsolete: true

[Term]
id: CL:0000255
name: eukaryotic cell
namespace: cell
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: only_in_taxon NCBITaxon:2759 ! Eukaryota
disjoint_from: CL:0000520 ! prokaryotic cell
relationship: only_in_taxon NCBITaxon:2759 ! Eukaryota

[Term]
id: CL:0000256
name: uric acid accumulating cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000257
name: Eumycetozoan cell
namespace: cell
is_a: CL:0000255 ! eukaryotic cell
intersection_of: CL:0000003 ! native cell
intersection_of: only_in_taxon NCBITaxon:142796 ! Eumycetozoa
relationship: only_in_taxon NCBITaxon:142796 ! Eumycetozoa

[Term]
id: CL:0000258
name: obsolete fiber tracheid
namespace: cell
def: "Obsolete. Use PO:0000355 from Plant Ontology instead. A fiber like tracheid in the secondary xylem; commonly thick walled, with pointed ends and bordered pits that have lenticular to slit like apertures." [ISBN:0471245208]
comment: replaced_by: PO:0000355
is_obsolete: true

[Term]
id: CL:0000259
name: obsolete aggregate cell
is_obsolete: true
replaced_by: DDANAT:0000403

[Term]
id: CL:0000260
name: obsolete mucilage cell
namespace: cell
def: "Obsolete. Use PO:0000373 from Plant Ontology instead. Cell containing mucilages or gums or similar carbohydrate material characterized by the property of swelling in water." [ISBN:0471245208]
comment: replaced_by: PO:0000373
is_obsolete: true

[Term]
id: CL:0000261
name: obsolete anterior cell
namespace: cell
comment: Obsoleted becuase this term has an overly general name, no definition, and by it's classification appears to refer to a very specific cell type in dictystelium.  If needed, the term should be in DDANAT - probably as a subclass of http://purl.obolibrary.org/obo/DDANAT_0000002
is_obsolete: true
consider: false
consider: http://purl.obolibrary.org/obo/DDANAT_0000002

[Term]
id: CL:0000262
name: obsolete guard mother cell
namespace: cell
def: "Obsolete. Use PO:0000351 from Plant Ontology instead. An epidermal cell that divides to produce the guard cells." [ISBN:0471245208]
comment: replaced_by: PO:0000351
is_obsolete: true

[Term]
id: CL:0000263
name: obsolete vegetative cell (sensu Mycetozoa)
is_obsolete: true
replaced_by: DDANAT:0000002

[Term]
id: CL:0000264
name: obsolete phloem initial
namespace: cell
def: "Obsolete. Use PO:0000400 from Plant Ontology instead. A cambial cell on the phloem side of the cambial zone that is the source of one or more cells arising by periclinal divisions and differentiating into phloem elements with or without additional divisions in various planes." [ISBN:0471245208]
comment: replaced_by: PO:0000400
synonym: "phloem mother cell" EXACT []
is_obsolete: true

[Term]
id: CL:0000265
name: obsolete anterior like cell
is_obsolete: true
replaced_by: DDANAT:0000404

[Term]
id: CL:0000266
name: obsolete meristemoid
namespace: cell
def: "Obsolete. Use PO:0004011 from Plant Ontology instead. A cell constituting an active locus of meristematic activity in a tissue composed of somewhat older, differentiating cells." [ISBN:0471245208]
comment: replaced_by: PO:0004011
is_obsolete: true

[Term]
id: CL:0000267
name: obsolete prespore cell
is_obsolete: true
replaced_by: DDANAT:0000405

[Term]
id: CL:0000268
name: obsolete sieve element
namespace: cell
def: "Obsolete. Consult Plant Ontology instead. The cell in the phloem tissue concerned with mainly longitudinal conduction of food materials. Classified into sieve cell and sieve tube member." [ISBN:0471245208]
is_obsolete: true

[Term]
id: CL:0000269
name: obsolete prestalk cell
is_obsolete: true
replaced_by: DDANAT:0000406

[Term]
id: CL:0000270
name: obsolete subsidiary cell
namespace: cell
def: "Obsolete. Use PO:0000284 from Plant Ontology instead. An epidermal cell associated with a stoma and at least morphologically distinguishable from the epidermal cells composing the groundmass of the tissue." [ISBN:047124520]
comment: replaced_by: PO:0000284
is_obsolete: true

[Term]
id: CL:0000271
name: obsolete prestalk A cell
is_obsolete: true
replaced_by: DDANAT:0000408

[Term]
id: CL:0000272
name: obsolete cambial initial
namespace: cell
def: "OBSOLETE, use term from Plant Ontology. A cell localized in the vascular cambium or phellogen. Its periclinal division can contribute cells either to the outside or to the inside of the axis; in vascular cambium, classified into fusiform initials (source of axial cells of xylem and phloem) and ray initials (source of the ray cells)." [ISBN:0471245208]
comment: replaced_by PO:0000295
is_obsolete: true

[Term]
id: CL:0000273
name: obsolete prestalk AB cell
is_obsolete: true
replaced_by: DDANAT:0000410

[Term]
id: CL:0000275
name: obsolete prestalk B cell
is_obsolete: true
replaced_by: DDANAT:0000409

[Term]
id: CL:0000276
name: obsolete sclerenchyma cell
namespace: cell
def: "Obsolete. Use PO:0000077 from Plant Ontology instead. Cell variable in form and size, being more or less thick, often lignified, secondary walls. Belongs to the category of subcells and may or may not be devoid of protoplast at maturity." [ISBN:0471245208]
comment: replaced_by: PO:0000077
is_obsolete: true

[Term]
id: CL:0000277
name: obsolete prestalk I cell
namespace: cell
def: "OBSOLETE: Initial population of prestalk cells that activate the ecmA promoter at the mound stage and that presumably further differentiate into pstA and pstO cells." [DictyBase:DDB]
comment: This cell type does not exist in Dictyostelium. it has been long deleted in their anatomy ontology.
is_obsolete: true
replaced_by: DDANAT:0000406

[Term]
id: CL:0000278
name: obsolete central cell
namespace: cell
def: "Obsolete. Use PO:0020090 from Plant Ontology instead. OBSOLETED, use term from Plant Ontology. A cell containing the two polar nuclei which, after double fertilization, will develop into the endosperm." [TAIR:lr]
comment: replaced_by: PO:0020090
is_obsolete: true

[Term]
id: CL:0000279
name: obsolete prestalk 0 cell
is_obsolete: true
replaced_by: DDANAT:0000407

[Term]
id: CL:0000280
name: obsolete generative cell
namespace: cell
def: "Obsolete. Use PO:0020097 from Plant Ontology instead. The cell that will give rise to the generative nuclei which will participate in fertilization." [TAIR:lr]
comment: replaced_by: PO:0020097
is_obsolete: true

[Term]
id: CL:0000281
name: obsolete pstAB/ALC
is_obsolete: true
replaced_by: DDANAT:0000411

[Term]
id: CL:0000282
name: obsolete trichome
namespace: cell
def: "Obsolete. Use PO:0000282 from Plant Ontology instead. An outgrowth from the epidermis. Trichomes vary in size and complexity and include hairs, scales, and other structures and may be glandular. In Arabidopsis, patterning of trichome development is not random but does not appear to be lineage-based like stomata." [ISBN:0471245208, PMID:10938806]
comment: replaced_by: PO:0000282
is_obsolete: true

[Term]
id: CL:0000283
name: obsolete pstO/ALC
is_obsolete: true
replaced_by: DDANAT:0000412

[Term]
id: CL:0000284
name: obsolete companion cell
namespace: cell
def: "Obsolete. Use PO:0000071 from Plant Ontology instead. A specialized parenchyma cell associated with a sieve-tube member in angiosperm phloem and arising from the same mother cell as the sieve-tube member." [ISBN:0879015322]
comment: replaced_by: PO:0000071
is_obsolete: true

[Term]
id: CL:0000285
name: obsolete stalk cell
is_obsolete: true
replaced_by: DDANAT:0000413

[Term]
id: CL:0000286
name: hyphal cell
namespace: cell
def: "A cell of a filament of a fungal mycelium." [ISBN:08199377X]
is_a: CL:0000521 ! fungal cell

[Term]
id: CL:0000287
name: eye photoreceptor cell
namespace: cell
is_a: CL:0000210 ! photoreceptor cell
intersection_of: CL:0000210 ! photoreceptor cell
intersection_of: part_of UBERON:0000970 ! eye
relationship: part_of UBERON:0000970 ! eye

[Term]
id: CL:0000288
name: obsolete synergid
namespace: cell
def: "Obsolete. Use PO:0000191 from Plant Ontology instead. A cell in the micropylar end of the embryo sac associated with the egg in the egg apparatus of angiosperms. Plays a vital role in fertilization." [ISBN:047125208]
comment: replaced_by: PO:0000191
is_obsolete: true

[Term]
id: CL:0000289
name: obsolete chemotactic amoeboid cell (sensu Mycetozoa)
is_obsolete: true
replaced_by: DDANAT:0000402

[Term]
id: CL:0000290
name: obsolete xylem fiber cell
namespace: cell
def: "Obsolete. Use PO:0000274 from Plant Ontology instead. A fiber of the xylem tissue, Two types are recognized in the secondary xylem: fiber tracheids and libriform fibers." [ISBN:0471245208]
comment: replaced_by: PO:0000274
is_obsolete: true

[Term]
id: CL:0000291
name: obsolete spore (sensu Mycetozoa)
is_obsolete: true
replaced_by: DDANAT:0000414

[Term]
id: CL:0000292
name: obsolete guard cell
namespace: cell
def: "Obsolete. Use PO:0000293 from Plant Ontology instead. One of a pair of cells flanking the stomatal pore and causing the opening and closing of the pore by changes in turgor." [ISBN:0471245208]
comment: replaced_by: PO:0000293
synonym: "stomatal guard cell" EXACT []
is_obsolete: true

[Term]
id: CL:0000293
name: structural cell
namespace: cell
def: "A cell whose primary function is to provide structural support, to provide strength and physical integrity to the organism." [TAIR:sr]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000294
name: obsolete sieve cell
namespace: cell
def: "Obsolete. Consult Plant Ontology instead. A type of sieve element that has relatively undifferentiated sieve areas (with narrow pores), rather uniform in structure on all walls; that is, there are no sieve plates. Typical of gymnosperms and lower vascular plants." [ISBN:0471245208]
is_obsolete: true

[Term]
id: CL:0000295
name: somatotropin secreting cell
namespace: cell
alt_id: CL:0000471
def: "A peptide hormone secreting cell that produces growth hormone, somatotropin." [GOC:tfm, SANBI:mhl]
synonym: "growth hormone secreting cell" EXACT []
synonym: "somatotrophin secreting cell" EXACT []
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0030252 ! growth hormone secretion
relationship: capable_of GO:0030252 ! growth hormone secretion

[Term]
id: CL:0000296
name: obsolete vegetative cell
namespace: cell
def: "Obsolete. Use PO:0020099 from Plant Ontology instead. Cell type formed after the first mitotic division of the microgametophye, The nucleus of this cell migrates to the tip of the pollen tube after germination and disintegrates when the pollen tube penetrates the nucellus." [ISBN:0140514031, TAIR:lr]
comment: replaced_by: PO:0020099
is_obsolete: true

[Term]
id: CL:0000297
name: obsolete socket cell
namespace: cell
def: "Obsolete. Use PO:0000115 from Plant Ontology instead. A cell that surrounds a trichome and provides support for the trichome." [PMID:10938806]
comment: replaced_by: PO:0000115
is_obsolete: true

[Term]
id: CL:0000298
name: obsolete xylem element
namespace: cell
def: "Obsolete. Use PO:0000273 from Plant Ontology instead. A cell composing the xylem." [ISBN:0471245208]
comment: replaced_by: PO:0000273
is_obsolete: true

[Term]
id: CL:0000299
name: obsolete trichoblast
namespace: cell
def: "OBSOLETED. Commonly used for a cell in root epidermis that gives rise to a root hair. The daughter cell produced by the asymmetric division of a root epidermal cell that gives rise to a root hair." [ISBN:0471245208]
comment: Obsoleted. Use trichoblast from the plant ontology (PO:0000262).
is_obsolete: true

[Term]
id: CL:0000300
name: gamete
namespace: cell
def: "A mature sexual reproductive cell having a single set of unpaired chromosomes." [GOC:tfm, ISBN:0721662544]
synonym: "haploid germ cell" RELATED []
synonym: "haploid nucleated cell" EXACT []
xref: CALOHA:TS-0395
xref: FBbt:00005412
xref: FMA:18649
is_a: CL:0000413 ! haploid cell
is_a: CL:0000586 {is_inferred="true"} ! germ cell
intersection_of: CL:0000586 ! germ cell
intersection_of: bearer_of PATO:0001375 ! haploid
intersection_of: capable_of GO:0009566 ! fertilization
relationship: capable_of GO:0009566 ! fertilization

[Term]
id: CL:0000301
name: pole cell
namespace: cell
xref: FBbt:00000092
is_a: CL:0000670 ! primordial germ cell

[Term]
id: CL:0000302
name: obsolete IgM B cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Not a differentiation state per se; consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000303
name: obsolete IgG B cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Not a differentiation state per se, and IgG isotypes vary by species; consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000304
name: obsolete IgA B cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Not a differentiation state per se, and IgA isotypes vary by species. Consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000305
name: obsolete IgE B cell
namespace: cell
def: "OBSOLETE (was not defined before being made obsolete)." []
comment: Not a differentiation state per se; consider using 'B cell ; CL:0000236' or one of its children instead.
is_obsolete: true

[Term]
id: CL:0000306
name: crystallin accumulating cell
namespace: cell
synonym: "lens cell" EXACT []
xref: FBbt:00004193
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000307
name: tracheal epithelial cell
namespace: cell
alt_id: CL:1000474
def: "An epithelial cell found in the trachea." [GOC:tfm]
comment: This class is for the vertebrate tracheal structure. For the analagous insect cell type, see 'respiratory tube epithelial cell'
synonym: "tracheocyte" EXACT []
xref: FMA:74793
is_a: CL:0002202 {is_inferred="true"} ! epithelial cell of tracheobronchial tree
intersection_of: CL:0000066 ! epithelial cell
intersection_of: part_of UBERON:0003126 ! trachea
relationship: develops_from CL:0000377 ! tracheoblast
relationship: part_of UBERON:0003126 ! trachea

[Term]
id: CL:0000308
name: metal ion accumulating cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000309
name: copper accumulating cell
namespace: cell
synonym: "cuprophilic cell" EXACT []
is_a: CL:0000308 ! metal ion accumulating cell

[Term]
id: CL:0000310
name: iron accumulating cell
namespace: cell
is_a: CL:0000308 ! metal ion accumulating cell

[Term]
id: CL:0000311
name: keratin accumulating cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000312
name: keratinocyte
namespace: cell
alt_id: CL:0002185
def: "An epidermal cell which synthesizes keratin and undergoes a characteristic change as it moves upward from the basal layers of the epidermis to the cornified (horny) layer of the skin. Successive stages of differentiation of the keratinocytes forming the epidermal layers are basal cell, spinous or prickle cell, and the granular cell." [GOC:dsd, http://en.wikipedia.org/wiki/Keratinocyte, MESH:A11.436.397, MESH:D015603, PMID:15582983, PMID:15749908, PMID:19727116]
comment: Keratinocytes are reportedly CDw210a-negative, CDw210b-positive, CD281-positive, CD282-positive, CD285-positive, IL22Ra1-positive, Human keratinocytes are reportedly capable of secreting BD-2, BD-3, hCAP-18, CXCL1, CXCL5, CXCL8, elafin, MMP-3, NGAL, PDGF-A, S100A7, S100A8, and S100A9. Transcription factors: STAT3-positive.
synonym: "keratinized cell of epidermis" EXACT []
synonym: "malpighian cell" EXACT []
xref: BTO:0000667
xref: CALOHA:TS-0500
xref: FMA:62879
is_a: BFO:0000040 ! material entity
is_a: CL:0000237 {is_inferred="true"} ! keratinizing barrier epithelial cell
is_a: CL:0000362 {is_inferred="true"} ! epidermal cell
intersection_of: CL:0000237 ! keratinizing barrier epithelial cell
intersection_of: part_of UBERON:0001003 ! skin epidermis
relationship: capable_of GO:0002775 ! antimicrobial peptide production
relationship: capable_of GO:0002776 ! antimicrobial peptide secretion
relationship: capable_of GO:0090023 ! positive regulation of neutrophil chemotaxis
relationship: part_of UBERON:0001003 ! skin epidermis

[Term]
id: CL:0000313
name: serous secreting cell
namespace: cell
def: "Columnar glandular cell with irregular nucleus, copious granular endoplasmic reticulum and supranuclear granules. Secretes a watery fluid containing proteins known as serous fluid." [GOC:tfm, ISBN:0517223651, ISBN:0721662544]
synonym: "serous cell" EXACT []
xref: BTO:0003687
xref: FMA:62511
is_a: CL:0000159 ! seromucus secreting cell

[Term]
id: CL:0000314
name: milk secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000315
name: tear secreting cell
namespace: cell
def: "A cell secreting tears, the fluid secreted by the lacrimal glands. This fluid moistens the conjunctiva and cornea." [MESH:A12.200.882]
synonym: "tears secreting cell" EXACT []
is_a: CL:0000152 ! exocrine cell
relationship: part_of UBERON:0001817 ! lacrimal gland

[Term]
id: CL:0000316
name: obsolete ray initial
namespace: cell
def: "Obsolete. Use PO:0000082 from Plant Ontology instead. A meristemic ray cell in the vascular cambium that gives rise to ray cells of the secondary xylem and secondary phloem." [ISBN:0471245208]
comment: replaced_by: PO:0000082
is_obsolete: true

[Term]
id: CL:0000317
name: sebum secreting cell
namespace: cell
def: "A cell secreting sebun, an oily substance secreted by sebaceous glands, composed of keratin, fat, and cellular debris." [MESH:A12.200.702]
synonym: "sebocyte" EXACT []
is_a: CL:0000152 ! exocrine cell
is_a: CL:2000021 ! sebaceous gland cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: part_of UBERON:0001821 ! sebaceous gland

[Term]
id: CL:0000318
name: sweat secreting cell
namespace: cell
def: "A cell secreting sweat, the fluid excreted by the sweat glands of mammals. It consists of water containing sodium chloride, phosphate, urea, ammonia, and other waste products." [MESH:A12.200.849]
is_a: CL:0000150 ! glandular epithelial cell

[Term]
id: CL:0000319
name: mucus secreting cell
namespace: cell
synonym: "mucous cell" EXACT []
xref: BTO:0003689
is_a: CL:0000159 ! seromucus secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0070254 ! mucus secretion
relationship: capable_of GO:0070254 ! mucus secretion

[Term]
id: CL:0000320
name: obsolete megasporocyte
namespace: cell
def: "Obsolete. Use PO:0000431 from Plant Ontology instead. A diploid (2n) cell that undergoes meiosis and produces four haploid (1n) megaspores; also called megaspore mother cell." [ISBN:0471245208]
comment: replaced_by: PO:0000431
synonym: "archesporial cell" EXACT []
synonym: "megaspore mother cell" EXACT []
is_obsolete: true

[Term]
id: CL:0000321
name: seminal fluid secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000322
name: pneumocyte
namespace: cell
def: "An epithelial cell that lines the peripheral gas exchange region of the lungs of air-breathing vertebrates." [GOC:tfm, PMID:20054144]
synonym: "alveolar epithelial cell" EXACT []
synonym: "pneumonocyte" EXACT []
xref: BTO:0000395
xref: CALOHA:TS-2168
xref: FMA:62499
is_a: CL:0010003 ! epithelial cell of alveolus of lung
relationship: part_of UBERON:0004821 ! pulmonary alveolus epithelium

[Term]
id: CL:0000323
name: lysozyme secreting cell
namespace: cell
is_a: CL:0000154 ! protein secreting cell

[Term]
id: CL:0000324
name: metanephric mesenchyme stem cell
namespace: cell
is_a: CARO:0000000
is_a: CL:0000134 ! mesenchymal stem cell
relationship: develops_from CL:0000222 ! mesodermal cell

[Term]
id: CL:0000325
name: stuff accumulating cell
namespace: cell
def: "A cell that is specialised to accumulate a particular substance(s)." [FB:ma]
subset: ubprop:upper_level
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000326
name: glycogen accumulating cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000327
name: extracellular matrix secreting cell
namespace: cell
is_a: CL:0000499 ! stromal cell

[Term]
id: CL:0000328
name: myelin accumulating cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000329
name: oxygen accumulating cell
namespace: cell
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0015671 ! oxygen transport
relationship: capable_of GO:0015671 ! oxygen transport

[Term]
id: CL:0000330
name: obsolete collenchymal cell
namespace: cell
def: "Obsolete. Use PO:0000075 from Plant Ontology instead. An elongated living cell with unevenly thickened nonlignified primary walls." [ISBN:0471245208]
comment: replaced_by: PO:0000075
is_obsolete: true

[Term]
id: CL:0000331
name: obsolete tracheid
namespace: cell
def: "Obsolete. Use PO:0000301 from Plant Ontology instead. A tracheary element of the xylem that has no perforations, as contrasted with a vessel member. May occur in primary and in secondary xylem. May have any kind of secondary wall thickening found in tracheary elements." [ISBN:0471245208]
comment: replaced_by: PO:0000301
is_obsolete: true

[Term]
id: CL:0000332
name: obsolete atrichoblast
namespace: cell
def: "OBSOLETE, use term from Plant Ontology. A cell formed after asymmetric division of root epidermal cell that does not give rise to a root hair." [ISBN:0387987819]
comment: replaced_by: PO:0020090
synonym: "non-hair cell" RELATED []
is_obsolete: true

[Term]
id: CL:0000333
name: migratory neural crest cell
namespace: cell
def: "A cell derived from the specialized ectoderm flanking each side of the embryonic neural plate, which after the closure of the neural tube, forms masses of cells that migrate out from the dorsal aspect of the neural tube to spread throughout the body." [MESH:A16.254.600]
xref: FMA:86667
is_a: CL:0000219 ! motile cell
is_a: CL:0011012 ! neural crest cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0007004 ! premigratory neural crest cell

[Term]
id: CL:0000334
name: vegetative cell (sensu Fungi)
namespace: cell
synonym: "yeast-form" RELATED []
xref: BTO:0002307
xref: FAO:0000032
is_a: CL:0000521 ! fungal cell

[Term]
id: CL:0000335
name: mesenchyme condensation cell
namespace: cell
def: "A mesenchymal cell in embryonic development found in a contracting mass and that gives rise to osteoprogenitors." [GOC:tfm, PMID:5025404]
is_a: CL:0008019 ! mesenchymal cell

[Term]
id: CL:0000336
name: adrenal medulla chromaffin cell
namespace: cell
alt_id: CL:1000422
def: "A cell found within the adrenal medulla that secrete biogenic amine hormones upon stimulation." [GOC:tfm, http://www.britannica.com/EBchecked/topic/6405/adrenal-gland]
synonym: "medullary chromaffin cell of adrenal gland" EXACT [FMA:69262]
xref: FMA:69262
is_a: CL:0000457 ! biogenic amine secreting cell
is_a: CL:1000426 ! chromaffin cell of adrenal gland
intersection_of: CL:0000166 ! chromaffin cell
intersection_of: part_of UBERON:0001236 ! adrenal medulla
relationship: develops_from CL:0000011 ! migratory trunk neural crest cell
relationship: part_of UBERON:0001236 ! adrenal medulla

[Term]
id: CL:0000338
name: neuroblast (sensu Nematoda and Protostomia)
namespace: cell
synonym: "neuroblast" BROAD []
is_a: CL:0000047 ! neuronal stem cell

[Term]
id: CL:0000339
name: glioblast (sensu Vertebrata)
namespace: cell
def: "An early neural cell developing from the early ependymal cell of the neural tube." [GOC:tfm, ISBN:0618947256]
synonym: "spongioblast" EXACT []
xref: FMA:70564
is_a: CL:0000030 ! glioblast
is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata)
is_a: CL:0011026 ! progenitor cell

[Term]
id: CL:0000340
name: glioblast (sensu Nematoda and Protostomia)
namespace: cell
is_a: CL:0000030 ! glioblast
is_a: CL:0000130 ! neuron associated cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000341
name: pigment cell (sensu Nematoda and Protostomia)
namespace: cell
is_a: CL:0000147 ! pigment cell

[Term]
id: CL:0000342
name: pigment cell (sensu Vertebrata)
namespace: cell
def: "Any animal cell containing pigment granules." [GOC:tfm, ISBN:0721662544]
is_a: CL:0000147 ! pigment cell
is_a: CL:0000548 ! animal cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>

[Term]
id: CL:0000343
name: visual pigment cell (sensu Vertebrata)
namespace: cell
def: "A pigment cell that is capable of detecting light stimulus that is involved in visual perception." [GOC:tfm]
xref: FMA:63846
is_a: BFO:0000040 ! material entity
is_a: CL:0000149 ! visual pigment cell
is_a: CL:0000342 {is_inferred="true"} ! pigment cell (sensu Vertebrata)
intersection_of: CL:0000342 ! pigment cell (sensu Vertebrata)
intersection_of: capable_of GO:0050908 ! detection of light stimulus involved in visual perception
relationship: capable_of GO:0050908 ! detection of light stimulus involved in visual perception

[Term]
id: CL:0000344
name: obsolete non-visual cell (sensu Vertebrata)
namespace: cell
is_obsolete: true

[Term]
id: CL:0000345
name: dental papilla cell
namespace: cell
def: "A mesenchymal cell that is part of a small mass of condensed mesenchyme in the enamel organ; it differentiates into the dentin and dental pulp." [GOC:tfm, ISBN:0721662544]
comment: Merge with odontoblast?
is_a: CARO:0000000
is_a: CL:0008019 ! mesenchymal cell
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell
relationship: part_of UBERON:0001763 ! odontogenic papilla

[Term]
id: CL:0000346
name: hair follicle dermal papilla cell
namespace: cell
def: "A specialized mesenchymal cell that resides in the dermal papilla located at the bottom of hair follicles. This cell plays a pivotal roles in hair formation, growth, and cycling." [GOC:tfm, PMID:9893172]
comment: Are these really all stem cells?
is_a: CL:0000134 {is_inferred="true"} ! mesenchymal stem cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000134 ! mesenchymal stem cell
intersection_of: part_of UBERON:0000412 ! dermal papilla
relationship: develops_from CL:0000333 ! migratory neural crest cell
relationship: part_of UBERON:0000412 ! dermal papilla

[Term]
id: CL:0000347
name: scleral cell
namespace: cell
def: "A cell of the sclera of the eye." [GOC:add]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000293 ! structural cell
intersection_of: CL:0000293 ! structural cell
intersection_of: part_of UBERON:0001773 ! sclera
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell
relationship: part_of UBERON:0001773 ! sclera

[Term]
id: CL:0000348
name: choroidal cell of the eye
namespace: cell
def: "A cell of the choroid of the eye." [GOC:add]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000293 ! structural cell
intersection_of: CL:0000293 ! structural cell
intersection_of: part_of UBERON:0001776 ! optic choroid
relationship: develops_from CL:0000008 ! migratory cranial neural crest cell
relationship: part_of UBERON:0001776 ! optic choroid

[Term]
id: CL:0000349
name: extraembryonic cell
namespace: cell
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000548 ! animal cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000548 ! animal cell
intersection_of: part_of UBERON:0000478 ! extraembryonic structure
relationship: part_of UBERON:0000478 ! extraembryonic structure

[Term]
id: CL:0000350
name: amnioserosal cell
namespace: cell
is_a: CL:0000349 ! extraembryonic cell
intersection_of: CL:0000349 ! extraembryonic cell
intersection_of: part_of UBERON:0010302 ! amnioserosa
relationship: part_of UBERON:0010302 ! amnioserosa

[Term]
id: CL:0000351
name: trophoblast cell
namespace: cell
def: "A cell lining the outside of the blastocyst. After binding to the endometrium, trophoblast cells develop into two distinct layers, an inner layer of mononuclear cytotrophoblast cells and an outer layer of continuous multinuclear cytoplasm, the syncytiotrophoblast cells, which form the early fetal-maternal interface." [GOC:tfm, MESH:A11.936]
synonym: "trophoblastic cell" EXACT []
xref: FMA:83028
is_a: CL:0000349 {is_inferred="true"} ! extraembryonic cell
relationship: part_of UBERON:0000358 ! blastocyst

[Term]
id: CL:0000352
name: epiblast cell
namespace: cell
def: "A cell of the outer layer of a blastula that gives rise to the ectoderm after gastrulation." [GOC:tfm, ISBN:0618947256]
is_a: CL:0000052 ! totipotent stem cell

[Term]
id: CL:0000353
name: blastoderm cell
namespace: cell
def: "An undifferentiated cell produced by early cleavages of the fertilized egg (zygote)." [MESH:A11.104]
synonym: "blastomere" EXACT []
xref: BTO:0001473
xref: FMA:72551
is_a: CL:0000007 ! early embryonic cell (metazoa)

[Term]
id: CL:0000354
name: blastemal cell
namespace: cell
synonym: "blastema cell" EXACT []
xref: ncithesaurus:Blastemal_Cell
is_a: CL:0000048 ! multi fate stem cell

[Term]
id: CL:0000355
name: multi-potent skeletal muscle stem cell
namespace: cell
def: "A multifate stem cell found in skeletal muscle than can differentiate into many different cell types, including muscle. Distinct cell type from satellite cell." [PMID:18282570]
comment: Multi-potency demonstrated ex vivo.  At the time of writing, it is unclear whether the endogenous population differentiates into multiple cell types in vivo.
xref: FMA:86767
is_a: CL:0000048 {is_inferred="true"} ! multi fate stem cell
is_a: CL:0000188 ! cell of skeletal muscle
intersection_of: CL:0000048 ! multi fate stem cell
intersection_of: part_of UBERON:0001134 ! skeletal muscle tissue

[Term]
id: CL:0000356
name: hair matrix stem cell
namespace: cell
is_a: CL:0000035 ! single fate stem cell

[Term]
id: CL:0000357
name: stratified epithelial stem cell
namespace: cell
is_a: CL:0000036 ! epithelial fate stem cell

[Term]
id: CL:0000358
name: sphincter associated smooth muscle cell
namespace: cell
def: "A smooth muscle cell that is part of a sphincter. A sphincter is a typically circular muscle that normally maintains constriction of a natural body passage or orifice and which relaxes as required by normal physiological functioning." [GOC:cjm]
is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell
intersection_of: CL:0000192 ! smooth muscle cell
intersection_of: part_of UBERON:0004590 ! sphincter muscle
relationship: part_of UBERON:0004590 ! sphincter muscle

[Term]
id: CL:0000359
name: vascular associated smooth muscle cell
namespace: cell
def: "A smooth muscle cell associated with the vasculature." [GOC:dsd, GOC:tfm]
synonym: "vascular smooth muscle cell" EXACT []
synonym: "VSMC" EXACT []
is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell
intersection_of: CL:0000192 ! smooth muscle cell
intersection_of: part_of UBERON:0002049 ! vasculature
relationship: part_of UBERON:0002049 ! vasculature

[Term]
id: CL:0000360
name: morula cell
namespace: cell
def: "A cell of the early embryo at the developmental stage in which the blastomeres, resulting from repeated mitotic divisions of the fertilized ovum (zygote), form a compact cell mass." [MESH:A16.254.270.550]
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000007 ! early embryonic cell (metazoa)
relationship: part_of UBERON:0000085 ! morula

[Term]
id: CL:0000361
name: gastrula cell
namespace: cell
def: "A cell of the embryo in the early stage following the blastula, characterized by morphogenetic cell movements, cell differentiation, and the formation of the three germ layers." [MESH:A16.254.412]
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000007 ! early embryonic cell (metazoa)
relationship: part_of UBERON:0004734 ! gastrula

[Term]
id: CL:0000362
name: epidermal cell
namespace: cell
alt_id: CL:1000396
def: "An epithelial cell of the integument (the outer layer of an organism)." [Flybase:dsj, MA:ma]
synonym: "cell of epidermis" EXACT [FMA:62411]
synonym: "epithelial cell of skin" NARROW [FMA:62411]
xref: BTO:0001470
xref: CALOHA:TS-0283
xref: FMA:62411
is_a: CL:0002159 ! general ecto-epithelial cell
intersection_of: CL:0000066 ! epithelial cell
intersection_of: part_of UBERON:0007376 ! outer epithelium
relationship: part_of UBERON:0007376 ! outer epithelium

[Term]
id: CL:0000363
name: obsolete axial cell
namespace: cell
def: "Obsolete. Use PO:0000081 from Plant Ontology instead. OBSOLETE, use term from the Plant Ontology. A secondary vascular cell that develops from the fusiform cambial initials and oriented with their longest diameter parallel with the main axis of stem or root. These cells make up the axial system, also known as vertical or longitudinal system." [ISBN:0471245208]
comment: replaced_by: PO:0000081
is_obsolete: true

[Term]
id: CL:0000364
name: obsolete ray cell
namespace: cell
def: "Obsolete. Consult Plant Ontology. A cell that develops from the ray initial and composes all rays (panels of tissue variable in height and width, formed by the ray initials in the vascular cambium and extending radially in the secondary xylem and secondary phloem) in the secondary vascular tissues." [ISBN:0471245208]
is_obsolete: true

[Term]
id: CL:0000365
name: animal zygote
namespace: cell
def: "Diploid cell produced by the fusion of sperm cell nucleus and egg cell." [ISBN:0471245208]
synonym: "zygote" BROAD []
xref: BTO:0000854
xref: EHDAA2:0004546
xref: FMA:72395
is_a: CL:0000007 ! early embryonic cell (metazoa)
is_a: CL:0010017 ! zygote
intersection_of: CL:0010017 ! zygote
intersection_of: only_in_taxon NCBITaxon:33208 ! Metazoa

[Term]
id: CL:0000366
name: obsolete sperm cell (sensu Viridiplantae)
namespace: cell
def: "Obsolete. Use PO:0000084 from Plant Ontology instead. Male gamete, part of male germ unit." [ISBN:0471245208]
comment: replaced_by: PO:0000084
synonym: "gametophyte sperm cell" RELATED []
synonym: "male gametophyte sperm cell" RELATED []
synonym: "pollen germ cell" RELATED []
is_obsolete: true

[Term]
id: CL:0000367
name: sheath cell (sensu Nematoda)
namespace: cell
synonym: "glial cell (sensu Nematoda)" RELATED []
is_a: CL:0000619 ! supporting cell (sensu Nematoda)

[Term]
id: CL:0000368
name: obsolete myrosin cell
namespace: cell
def: "Obsolete. Use PO:0000352 from Plant Ontology instead. Cell containing glucosinolates ('mustard oil glucosides') and myrosinases, enzymes hydrolyzing the glucosinolates. Occurs in eleven dicotyledon families, the two largest of which are the Brassicaceae and Euphorbiaceae." [ISBN:0471245208]
comment: replaced_by: PO:0000352
is_obsolete: true

[Term]
id: CL:0000370
name: obsolete transfer cell
namespace: cell
def: "Obsolete. Use PO:0000078 from Plant Ontology instead. Parenchyma cell with the wall ingrowth (or invaginations) that increase the surface of the plasmalemma. Appears to be specialized for short-distance transfer of solutes." [ISBN:0471245208]
comment: replaced_by: PO:0000078
synonym: "intermediary cell" RELATED []
is_obsolete: true

[Term]
id: CL:0000371
name: protoplast
namespace: cell
def: "The cell protoplasm after removal of the cell wall." [ISBN:08199377X]
is_a: CL:0000578 ! experimentally modified cell in vitro

[Term]
id: CL:0000372
name: tormogen cell
namespace: cell
def: "An epidermal cell that is part of a cell cluster organ of the insect integument (such as a sensillum) and that secretes a cuticular specialization that forms a socket around the base of a cuticular specialization produced by a trichogen cell." [ISBN:978-0801481253]
synonym: "socket cell" BROAD [ISBN:978-0801481253]
xref: FBbt:00005171
is_a: CL:0000463 ! epidermal cell (sensu arthropoda)

[Term]
id: CL:0000373
name: histoblast
namespace: cell
xref: FBbt:00001789
is_a: CL:0000146 ! simple columnar epithelial cell

[Term]
id: CL:0000374
name: trichogen cell
namespace: cell
def: "An epidermal cell that is part of a cell cluster organ of the insect integument (such as a sensillum) and that secretes a cuticular specialization, often in the form of a hair, bristle, peg or scale. The base of this specialization is often surrounded by a socket produced by a closely associated tormogen cell." [ISBN:978-0801481253]
synonym: "hair cell" BROAD []
xref: BTO:0004744
xref: FBbt:00005169
is_a: CL:0000463 ! epidermal cell (sensu arthropoda)

[Term]
id: CL:0000375
name: obsolete osteoprogenitor cell
namespace: cell
xref: BTO:0002051
is_obsolete: true
replaced_by: CL:0007010

[Term]
id: CL:0000376
name: humidity receptor cell
namespace: cell
is_a: CL:0000006 ! neuronal receptor cell

[Term]
id: CL:0000377
name: tracheoblast
namespace: cell
is_a: CL:0000069 ! branched duct epithelial cell

[Term]
id: CL:0000378
name: supporting cell (sensu Nematoda and Protostomia)
namespace: cell
synonym: "support cell (sensu Nematoda and Protostomia)" EXACT []
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000379
name: sensory processing neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000380
name: thecogen cell
namespace: cell
def: "The support cell that makes the thecogen dendritic cap - a cuticle-like matrix around the tip of the eo-dendrite and which encloses the soma of the eo-neuron." [Fbbt:00005173]
synonym: "fly sheath cell" EXACT []
is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000381
name: neurosecretory neuron
namespace: cell
xref: FBbt:00005130
is_a: CL:0000151 ! secretory cell
is_a: CL:0000527 ! efferent neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0046879 ! hormone secretion
relationship: capable_of GO:0046879 ! hormone secretion

[Term]
id: CL:0000382
name: scolopale cell
namespace: cell
xref: FBbt:00005219
is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000383
name: nephrogenic mesenchyme stem cell
namespace: cell
is_a: CL:0000134 ! mesenchymal stem cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0000134 ! mesenchymal stem cell

[Term]
id: CL:0000384
name: ligament cell
namespace: cell
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000385
name: prohemocyte (sensu Nematoda and Protostomia)
namespace: cell
xref: FBbt:00005062
is_a: CL:0000390 ! blood cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000386
name: attachment cell
namespace: cell
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000387
name: hemocyte (sensu Arthropoda)
namespace: cell
xref: FBbt:00005063
is_a: CARO:0000000
is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia)
is_a: CL:0000548 ! animal cell
relationship: capable_of GO:0035010 {xref="PMID:18025161"} ! encapsulation of foreign target
relationship: develops_from CL:0000385 ! prohemocyte (sensu Nematoda and Protostomia)
relationship: only_in_taxon NCBITaxon:6656 ! Arthropoda

[Term]
id: CL:0000388
name: tendon cell
namespace: cell
def: "An elongated fibrocyte that is part of a tendon. The cytoplasm is stretched between the collagen fibres of the tendon. They have a central cell nucleus with a prominent nucleolus. Tendon cells have a well-developed rough endoplasmic reticulum and they are responsible for synthesis and turnover of tendon fibres and ground substance." [GOC:NV, GOC:tfm, PMID:957445]
synonym: "muscle attachment cell" EXACT []
synonym: "tenocyte" RELATED []
is_a: CL:0000135 {is_inferred="true"} ! fibrocyte
is_a: CL:0000386 ! attachment cell
intersection_of: CL:0000135 ! fibrocyte
intersection_of: part_of UBERON:0000043 ! tendon
relationship: part_of UBERON:0000043 ! tendon

[Term]
id: CL:0000389
name: socket cell (sensu Nematoda)
namespace: cell
is_a: CL:0000619 ! supporting cell (sensu Nematoda)
is_a: CL:0000658 ! cuticle secreting cell

[Term]
id: CL:0000390
name: blood cell (sensu Nematoda and Protostomia)
namespace: cell
is_a: CL:0000081 ! blood cell

[Term]
id: CL:0000391
name: podocyte (sensu Diptera)
namespace: cell
def: "An insect immune cell that develops from plasmatocyte." [PMID:12930778]
xref: FBbt:00001688
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)
relationship: develops_from CL:0000394 ! plasmatocyte

[Term]
id: CL:0000392
name: crystal cell
namespace: cell
xref: FMA:63847
is_a: CL:0000391 ! podocyte (sensu Diptera)

[Term]
id: CL:0000393
name: electrically responsive cell
namespace: cell
def: "A cell whose function is determined by its response to an electric signal." [FB:ma]
is_a: CL:0000211 ! electrically active cell

[Term]
id: CL:0000394
name: plasmatocyte
namespace: cell
xref: FBbt:00001685
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)

[Term]
id: CL:0000395
name: procrystal cell
namespace: cell
xref: FBbt:00001689
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)

[Term]
id: CL:0000396
name: lamellocyte
namespace: cell
xref: FBbt:00001687
is_a: CL:0000394 ! plasmatocyte

[Term]
id: CL:0000397
name: ganglion interneuron
namespace: cell
is_a: CL:0000099 {is_inferred="true"} ! interneuron
intersection_of: CL:0000099 ! interneuron
intersection_of: RO:0002100 UBERON:0000045 ! has soma location ganglion
relationship: RO:0002100 UBERON:0000045 ! has soma location ganglion

[Term]
id: CL:0000398
name: polygonal cell
namespace: cell
xref: FBbt:00001691
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)

[Term]
id: CL:0000399
name: obsolete phloem element
namespace: cell
def: "Obsolete. Consult Plant Ontology instead. OBSOLETED, not defined prior to obsoletion." [GOC:tfm]
is_obsolete: true

[Term]
id: CL:0000400
name: obsolete pavement cell
namespace: cell
def: "Obsolete. Use PO:0000332 from Plant Ontology instead. An epidermal cell with a characteristic convoluted anticlinal cell wall that gives a jigsaw like appearance to the lamina." [ISBN:087694289]
comment: replaced_by: PO:0000332
is_obsolete: true

[Term]
id: CL:0000401
name: macrophage (sensu Diptera)
namespace: cell
xref: FBbt:00001686
is_a: CL:0000394 ! plasmatocyte

[Term]
id: CL:0000402
name: CNS interneuron
namespace: cell
is_a: CL:0000099 {is_inferred="true"} ! interneuron
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)
is_a: CL:2000029 ! central nervous system neuron
intersection_of: CL:0000099 ! interneuron
intersection_of: RO:0002100 UBERON:0001017 ! has soma location central nervous system

[Term]
id: CL:0000404
name: electrically signaling cell
namespace: cell
def: "A cell that initiates an electrical signal and passes that signal to another cell." [FB:ma]
is_a: CL:0000211 ! electrically active cell

[Term]
id: CL:0000405
name: neuroepidermoblast
namespace: cell
xref: FBbt:00005148
is_a: CL:0000338 ! neuroblast (sensu Nematoda and Protostomia)

[Term]
id: CL:0000406
name: CNS short range interneuron
namespace: cell
is_a: CL:0000402 ! CNS interneuron

[Term]
id: CL:0000407
name: scolopidial ligament cell
namespace: cell
xref: FBbt:00005221
is_a: CL:0000384 ! ligament cell

[Term]
id: CL:0000408
name: male gamete
namespace: cell
xref: BTO:0001277
xref: CALOHA:TS-0949
is_a: CL:0000015 {is_inferred="true"} ! male germ cell
is_a: CL:0000300 {is_inferred="true"} ! gamete
intersection_of: CL:0000015 ! male germ cell
intersection_of: bearer_of PATO:0001375 ! haploid
intersection_of: capable_of GO:0009566 ! fertilization

[Term]
id: CL:0000409
name: scolopidial sheath cell
namespace: cell
xref: FBbt:00005219
is_a: CL:0000618 ! sheath cell

[Term]
id: CL:0000410
name: CNS long range interneuron
namespace: cell
is_a: CL:0000402 ! CNS interneuron

[Term]
id: CL:0000411
name: Caenorhabditis hypodermal cell
namespace: cell
def: "An epithelial cell of the hypodermis of Caenorhabditis." [GOC:tfm, http://www.wormatlas.org/hermaphrodite/hypodermis/mainframe.htm]
comment: This term was originally added to CL for parity with the Worm anatomy ontology, which is dedicated to C elegans. It is not clear if it makes sense to try and generalize the concept and include in CL, and this term may be obsoleted in future. Note there is no similarity to the hypodermis in vertebrates.
synonym: "roundworm hypodermal cell" BROAD []
xref: WBbt:0007846
is_a: CL:0000076 ! squamous epithelial cell
is_a: CL:0000228 ! multinucleate cell
is_a: CL:0002371 ! somatic cell
relationship: in_taxon NCBITaxon:6237 ! Caenorhabditis

[Term]
id: CL:0000412
name: polyploid cell
namespace: cell
def: "A cell whose nucleus, or nuclei, each contain more than two haploid genomes." [FB:ma]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000413
name: haploid cell
namespace: cell
def: "A cell whose nucleus contains a single haploid genome." [FB:ma, GOC:tfm]
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: bearer_of PATO:0001375 ! haploid
relationship: bearer_of PATO:0001375 ! haploid

[Term]
id: CL:0000414
name: obsolete cell by ploidy
namespace: cell
def: "OBSOLETE: A classification of cells by the number of haploid genome equivalents of their nucleus or nuclei." [FB:ma, GOC:tfm]
comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell with chromosomes can be classified by its ploidy. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), eukaryotic cell (CL:0000255) or cell in vitro (CL:0001034) as appropriate.
is_obsolete: true
consider: CL:0000000
consider: CL:0000003
consider: CL:0000255
consider: CL:0001034

[Term]
id: CL:0000415
name: diploid cell
namespace: cell
def: "A cell whose nucleus has two haploid genomes." [FB:ma]
xref: FMA:72300
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000416
name: polytene cell
namespace: cell
is_a: CL:0000412 ! polyploid cell

[Term]
id: CL:0000417
name: endopolyploid cell
namespace: cell
is_a: CL:0000412 ! polyploid cell

[Term]
id: CL:0000418
name: arcade cell
namespace: cell
def: "An epithelial cell found in C. elegans that firmly hold the outer body wall and the lips to the inner cylinder of the pharynx in a manner that keeps these organs from breaking apart, while still giving each organ freedom of movement during feeding." [GOC:tfm, http://www.wormatlas.org/ver1/handbook/hypodermis/hypsupportother.htm#arcadecells]
xref: WBbt:0005793
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell
relationship: in_taxon NCBITaxon:6237 ! Caenorhabditis

[Term]
id: CL:0000419
name: seam cell
namespace: cell
def: "An epithelial fate stem cell found in flatworms." [GOC:tfm, http://www.wormatlas.org/hermaphrodite/seam%20cells/mainframe.htm]
xref: BTO:0003039
is_a: CL:0000036 ! epithelial fate stem cell

[Term]
id: CL:0000420
name: syncytial epithelial cell
namespace: cell
is_a: CL:0000066 ! epithelial cell
is_a: CL:0000228 ! multinucleate cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000421
name: coelomocyte
def: "A free floating cell, including amebocytes and eleocytes, in the coelom of certain animals, especially annelids." [GOC:tfm, ISBN:0721662544]
xref: BTO:0002856
xref: WBbt:0005751
is_a: CL:0000080 ! circulating cell
is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia)

[Term]
id: CL:0000422
name: mitogenic signaling cell
namespace: cell
def: "A cell whose primary function is to cause growth by stimulating cell division in its immediate cellular environment." [FB:ma]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000423
name: tip cell
namespace: cell
is_a: CL:0000422 ! mitogenic signaling cell

[Term]
id: CL:0000424
name: excretory cell
namespace: cell
def: "A cell involved in the elimination of metabolic and foreign toxins, and in maintaining the ionic, acid-base and water balance of biological fluids." [GOC:tfm, PMID:19783135]
xref: WBbt:0005812
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000425
name: pore cell
namespace: cell
def: "Forms the terminal part of the cuticle-lined excretory duct of C. elegans." [JB:jb]
is_a: CL:0000658 ! cuticle secreting cell

[Term]
id: CL:0000426
name: obsolete scaffold cell
namespace: cell
comment: This is a cell used in tissue engineering and is out of scope for CL.
property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/708 xsd:string
is_obsolete: true

[Term]
id: CL:0000427
name: GLR cell
namespace: cell
def: "A scaffolding cell type found in C. elegans, this cell plays a supportive role to the muscle arms. May also have an endocrine role." [GOC:tfm, http://wormatlas.psc.edu/hermaphrodite/muscleGLR/mainframe.htm]
is_a: CL:0002320 ! connective tissue cell

[Term]
id: CL:0000428
name: yolk cell
namespace: cell
is_a: CL:0000325 ! stuff accumulating cell
is_a: CL:0000349 ! extraembryonic cell

[Term]
id: CL:0000429
name: imaginal disc cell
namespace: cell
is_a: CL:0000146 ! simple columnar epithelial cell

[Term]
id: CL:0000430
name: xanthophore cell
namespace: cell
def: "A pigment cell derived from the neural crest. Contains cartenoid pigments in structures called pterinosomes or xanthosomes. This gives an appearance ranging from a golden yellow to orange and red." [SANBI:mhl]
synonym: "xanthophore" RELATED []
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 ! pigment cell
relationship: develops_from CL:0005002 ! xanthoblast

[Term]
id: CL:0000431
name: iridophore
namespace: cell
def: "A pigment cell derived from the neural crest. The cell contains flat light-reflecting platelets, probably of guanine, in stacks called reflecting platets or iridisomes. The color-generating components produce a silver, gold, or iridescent color." [SANBI:mhl]
synonym: "guanophore" RELATED []
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 ! pigment cell
relationship: develops_from CL:0005001 ! iridoblast

[Term]
id: CL:0000432
name: reticular cell
namespace: cell
def: "Large, stellate fibroblast found along the network of collagen fibers of the reticulum of the spleen; synthesize the matrix components of the reticulum." [GOC:tfm, http://en.wikipedia.org/wiki/Reticular_cell, ISBN:0517223651]
synonym: "reticulum cell" EXACT []
xref: FMA:62877
is_a: CL:0000057 ! fibroblast

[Term]
id: CL:0000433
name: obsolete functional megaspore
namespace: cell
def: "Obsolete. Use PO:0000244 from Plant Ontology instead. In monosporic and bisporic megasporogenesis: the megaspore(s) that will undergo megagametogenesis." [TAIR:lr]
comment: replaced_by: PO:0000244
is_obsolete: true

[Term]
id: CL:0000434
name: eccrine cell
namespace: cell
def: "A secretory cell that discharges its product without loss of cytoplasm." [ISBN:0198547684]
is_a: CL:0000150 ! glandular epithelial cell

[Term]
id: CL:0000435
name: alkali secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000436
name: vaginal lubricant secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell
relationship: part_of UBERON:0000996 ! vagina

[Term]
id: CL:0000437
name: gonadtroph
namespace: cell
def: "A rounded cell that is usually situated next to sinusoids; secretes follicular stimulating hormone (FSH) and luteinizing hormone (LH)." [GOC:tfm, http://en.wikipedia.org/wiki/Gonadotroph, ISBN:0517223651]
synonym: "delta basophil" EXACT []
synonym: "follicle stimulating hormone secreting cell" EXACT []
synonym: "gonadotrope" EXACT []
synonym: "gonadotrope cell" EXACT []
synonym: "gonadotroph" EXACT []
synonym: "gonadotropic cell" EXACT []
synonym: "pituitary delta cell" EXACT []
xref: BTO:0002482
xref: FMA:83100
is_a: CL:0000438 ! luteinizing hormone secreting cell
is_a: CL:0000639 ! basophil cell of pars distalis of adenohypophysis

[Term]
id: CL:0000438
name: luteinizing hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell pituitary that produces luteinizing hormone." [GOC:tfm]
is_a: CL:0000163 ! endocrine cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0032275 ! luteinizing hormone secretion
relationship: capable_of GO:0032275 ! luteinizing hormone secretion

[Term]
id: CL:0000439
name: prolactin secreting cell
namespace: cell
def: "A peptide hormone cell that secretes prolactin." [GOC:tfm, SANBI:mhl]
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0070459 ! prolactin secretion
relationship: capable_of GO:0070459 ! prolactin secretion

[Term]
id: CL:0000440
name: melanocyte stimulating hormone secreting cell
namespace: cell
def: "A cell of the intermediate pituitary that produces melanocyte stimulating hormone." [SANBI:mhl]
synonym: "melanotrope" EXACT []
synonym: "melanotroph" EXACT []
xref: BTO:0002277
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0036160 ! melanocyte-stimulating hormone secretion
relationship: capable_of GO:0036160 ! melanocyte-stimulating hormone secretion

[Term]
id: CL:0000441
name: follicle stem cell
namespace: cell
xref: FBbt:00004903
is_a: CL:0000036 ! epithelial fate stem cell

[Term]
id: CL:0000442
name: follicular dendritic cell
namespace: cell
def: "A cell with extensive dendritic processes found in the B cell areas (primary follicles and germinal centers) of lymphoid tissue. They are unrelated to the dendritic cell associated with T cells. Follicular dendritic cells have Fc receptors and C3b receptors, but unlike other dendritic cells, they do not process or present antigen in a way that allows recognition by T cells. Instead, they hold antigen in the form of immune complexes on their surfaces for long periods and can present antigen to B cells during an immune response." [ISBN:127520252]
comment: Due to its unique lineage and distinct function, this is not a type of dendritic cell; CL:0000451.
xref: BTO:0004267
xref: FMA:83037
is_a: CL:0000473 ! defensive cell

[Term]
id: CL:0000443
name: calcitonin secreting cell
namespace: cell
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0036161 ! calcitonin secretion
relationship: capable_of GO:0036161 ! calcitonin secretion

[Term]
id: CL:0000444
name: obliquely striated muscle cell
namespace: cell
def: "A muscle cell in which the fibers are organised into sarcomeres but in which adjacent myofibrils are offset from each other, producing an oblique banding pattern." [GOC:DOS, PMID:8720463]
comment: Examples include the somatic muscles of nemotodes and cephalopods.
is_a: CL:0000737 ! striated muscle cell
intersection_of: CL:0000187 ! muscle cell
intersection_of: bearer_of PATO:0002479 ! obliquely striated
intersection_of: has_part GO:0030017 ! sarcomere
relationship: bearer_of PATO:0002479 ! obliquely striated

[Term]
id: CL:0000445
name: apoptosis fated cell
namespace: cell
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000446
name: chief cell of parathyroid gland
namespace: cell
def: "An epithelial cell of the parathyroid gland that is arranged in wide, irregular interconnecting columns; responsible for the synthesis and secretion of parathyroid hormone." [FMA:69078, GOC:tfm, ISBN:0517223651]
synonym: "parathyroid chief cell" EXACT []
synonym: "parathyroid gland chief cell" EXACT []
synonym: "parathyroid hormone secreting cell" EXACT []
synonym: "principal cell of parathyroid gland" EXACT []
xref: BTO:0004712
xref: CALOHA:TS-2140
xref: FMA:69078
is_a: CL:0000167 ! peptide hormone secreting cell
is_a: CL:0002260 ! epithelial cell of parathyroid gland

[Term]
id: CL:0000447
name: carbohydrate secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000448
name: white fat cell
namespace: cell
def: "Fat cells with light coloration and few mitochondria. They contain a scant ring of cytoplasm surrounding a single large lipid droplet or vacuole." [GOC:tfm, MESH:A11.329.114.500]
synonym: "white adipocyte" RELATED []
synonym: "white adipose cell" EXACT []
synonym: "white fat cell" EXACT []
xref: CALOHA:TS-1119
xref: FMA:83434
is_a: CL:0000136 ! fat cell
relationship: develops_from CL:0002334 ! preadipocyte
relationship: part_of UBERON:0001347 ! white adipose tissue

[Term]
id: CL:0000449
name: brown fat cell
namespace: cell
def: "A cell from the thermogenic form of adipose tissue found in many species,  particularly in newborns and hibernating mammals, but also in lesser amounts in adults of other mammals including humans. Brown fat is capable of rapid liberation of energy and seems to be important in the maintenance of body temperature immediately after birth and upon waking from hibernation." [MESH:A10.165.114.322]
synonym: "brown adipocyte" EXACT []
synonym: "brown adipose cell" EXACT []
xref: CALOHA:TS-0099
xref: FMA:83435
is_a: CL:0000136 ! fat cell
relationship: develops_from CL:0002335 ! brown preadipocyte
relationship: part_of UBERON:0001348 ! brown adipose tissue

[Term]
id: CL:0000451
name: dendritic cell
namespace: cell
def: "A cell of hematopoietic origin, typically resident in particular tissues, specialized in the uptake, processing, and transport of antigens to lymph nodes for the purpose of stimulating an immune response via T cell activation. These cells are lineage negative (CD3-negative, CD19-negative, CD34-negative, and CD56-negative)." [GOC:add, ISBN:0781735149]
synonym: "interdigitating cell" RELATED []
synonym: "veiled cell" RELATED []
xref: BTO:0002042
xref: CALOHA:TS-0194
xref: FMA:83036
is_a: CL:0000145 ! professional antigen presenting cell
is_a: CL:0000842 ! mononuclear cell
intersection_of: CL:0000738 ! leukocyte
intersection_of: bearer_of PATO:0001407 ! mononucleate
intersection_of: capable_of GO:0001816 ! cytokine production
intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
intersection_of: capable_of GO:0019882 ! antigen processing and presentation
intersection_of: capable_of GO:0045580 ! regulation of T cell differentiation
intersection_of: has_part GO:0042613 ! MHC class II protein complex
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
disjoint_from: CL:0000542 ! lymphocyte
relationship: capable_of GO:0001816 ! cytokine production
relationship: capable_of GO:0045580 ! regulation of T cell differentiation
relationship: has_part GO:0042613 ! MHC class II protein complex
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000452
name: thyroid hormone secreting cell
namespace: cell
is_a: CL:0000163 ! endocrine cell

[Term]
id: CL:0000453
name: Langerhans cell
namespace: cell
def: "Langerhans cell is a conventional dendritic cell that has plasma membrane part CD207. A Langerhans cell is a stellate dendritic cell of myeloid origin, that appears clear on light microscopy and has a dark-staining, indented nucleus and characteristic inclusions (Birbeck granules) in the cytoplasm; Langerhans cells are found principally in the stratum spinosum of the epidermis, but they also occur in other stratified epithelia and have been identified in the lung, lymph nodes, spleen, and thymus." [GO_REF:0000031, GOC:add, GOC:amm, ISBN:0721601464, ISBN:0781735149, PMCID:PMC2346585, PMID:17850486]
comment: Originally described in the dendritic cell ontology (DC_CL:0000021 )(PMID:19243617). These cells are also CD1a-high, CD14-negative, CD207-positive (langerin), CD324-positive (E-cadherin), and DCIR-positive. They reside in the epidermis.
synonym: "Langerhans' cell" EXACT []
synonym: "LC" EXACT []
xref: BTO:0000705
xref: CALOHA:TS-2375
xref: FMA:63072
is_a: CL:0000766 ! myeloid leukocyte
is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell
intersection_of: CL:0000990 ! conventional dendritic cell
intersection_of: capable_of GO:0002828 ! regulation of type 2 immune response
intersection_of: RO:0002104 PR:000001293 ! has plasma membrane part C-type lectin domain family 4 member K
relationship: capable_of GO:0002828 ! regulation of type 2 immune response
relationship: develops_from CL:0000763 ! myeloid cell
relationship: RO:0002104 PR:000001293 ! has plasma membrane part C-type lectin domain family 4 member K

[Term]
id: CL:0000454
name: epinephrine secreting cell
namespace: cell
def: "A cell capable of producing epinephrine. Epiniphrine is synthesized from norepiniphrine by the actions of the phenylethanolamine N-methyltransferase enzyme, which is expressed in the adrenal glands, androgenic neurons, and in other cell types." [GOC:tfm, PMID:12438093]
synonym: "adrenaline secreting cell" EXACT [GO:0048242]
synonym: "epinephrin secreting cell" EXACT []
is_a: CL:0000457 ! biogenic amine secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0048242 ! epinephrine secretion
relationship: capable_of GO:0048242 ! epinephrine secretion

[Term]
id: CL:0000455
name: obsolete starch sheath cell
namespace: cell
def: "Obsolete. Use PO:0004531 from Plant Ontology instead. A cell characterized by conspicuous and rather stable accumulation of starch." [ISBN:044174520]
comment: replaced_by: PO:0004531
is_obsolete: true

[Term]
id: CL:0000456
name: mineralocorticoid secreting cell
namespace: cell
is_a: CL:0000174 ! steroid hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035931 ! mineralocorticoid secretion
relationship: capable_of GO:0035931 ! mineralocorticoid secretion

[Term]
id: CL:0000457
name: biogenic amine secreting cell
namespace: cell
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000458
name: serotonin secreting cell
namespace: cell
def: "A cell type that secretes 5-Hydroxytryptamine (serotonin)." [GOC:tfm, PMID:19630576]
synonym: "5-HT secreting cell" EXACT []
synonym: "5-Hydroxytryptamine secreting cell" EXACT []
is_a: CL:0000457 ! biogenic amine secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0001820 ! serotonin secretion
relationship: capable_of GO:0001820 ! serotonin secretion

[Term]
id: CL:0000459
name: noradrenergic cell
namespace: cell
def: "A cell capable of producting norepiniphrine. Norepiniphrine is a catecholamine with multiple roles including as a hormone and a neurotransmitter. In addition, epiniphrine is synthesized from norepiniphrine by the actions of the phenylethanolamine N-methyltransferase enzyme." [GOC:tfm, ISBN:068340007X]
synonym: "noradrenaline secreting cell" EXACT []
synonym: "norepinephrin secreting cell" EXACT []
synonym: "norepinephrine secreting cell" EXACT []
is_a: CL:0000457 ! biogenic amine secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0048243 ! norepinephrine secretion
relationship: capable_of GO:0048243 ! norepinephrine secretion

[Term]
id: CL:0000460
name: glucocorticoid secreting cell
namespace: cell
is_a: CL:0000174 ! steroid hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035933 ! glucocorticoid secretion
relationship: capable_of GO:0035933 ! glucocorticoid secretion

[Term]
id: CL:0000462
name: adepithelial cell
namespace: cell
xref: FBbt:00003219
is_a: CL:0000680 ! muscle precursor cell

[Term]
id: CL:0000463
name: epidermal cell (sensu arthropoda)
namespace: cell
def: "An epidermal cell that secretes chitinous cuticle from its apical side." [FlyBase:ds, ISBN:ISBN\:978-0801481253]
comment: While insect epidermis is generally columnar/cuboidal, there are certainly well studied cases where it is not (e.g.- Rhodnius prolixus when starved). So it would be safer to add this as a differentium for particular species where this is known. -DSJ.
is_a: CL:0000362 ! epidermal cell
is_a: CL:0000710 ! neurecto-epithelial cell
relationship: develops_from CL:0000464 ! epidermoblast

[Term]
id: CL:0000464
name: epidermoblast
namespace: cell
def: "An epidermal progenitor cell that arises from neuroectoderm and in turn gives rise to the epidermal sheath of ventral and cephalic regions." [GOC:tfm, PMID:7576311]
xref: FBbt:00004994
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0000710 ! neurecto-epithelial cell
relationship: develops_from CL:0000114 ! surface ectodermal cell

[Term]
id: CL:0000465
name: cardioblast (sensu Arthropoda)
namespace: cell
xref: FBbt:00001666
is_a: CL:0010021 ! cardiac myoblast

[Term]
id: CL:0000467
name: adrenocorticotropic hormone secreting cell
namespace: cell
alt_id: CL:0000640
def: "A peptide hormone secreting cell that produces adrenocorticotropin, or corticotropin." [GOC:tfm, SANBI:mhl]
synonym: "ACTH secreting cell" EXACT [GO:0051458]
synonym: "adrenocorticotrophic hormone secreting cell" EXACT []
synonym: "corticotrophin hormone secreting cell" EXACT []
synonym: "corticotropin hormone secreting cell" EXACT []
synonym: "corticotropin secreting cell" EXACT [GO:0051458]
is_a: CL:0000163 ! endocrine cell
is_a: CL:0000167 ! peptide hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0051458 ! corticotropin secretion
relationship: capable_of GO:0051458 ! corticotropin secretion

[Term]
id: CL:0000468
name: neuroglioblast (sensu Nematoda and Protostomia)
namespace: cell
synonym: "neuroglioblast" EXACT []
xref: FBbt:00005147
is_a: CL:0000047 ! neuronal stem cell

[Term]
id: CL:0000469
name: ganglion mother cell
namespace: cell
def: "A neural progenitor cell that is the daughter of a neuroblast (sensu arthopoda).  The progeny of ganglion mother cells develop into neurons, glia and (occasionally) epithelial cells." []
xref: FBbt:00005149
is_a: CL:0011020 ! neural progenitor cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0000338 ! neuroblast (sensu Nematoda and Protostomia)

[Term]
id: CL:0000470
name: digestive enzyme secreting cell
namespace: cell
is_a: CL:0000154 ! protein secreting cell

[Term]
id: CL:0000472
name: obsolete chlorenchyma cell
namespace: cell
def: "Obsolete. Use PO:0000076 from Plant Ontology instead. OBSOLETE, use term from Plant Ontology. Parenchyma cells containing chloroplasts; a component of leaf mesophyll and other green parenchyma tissue." [ISBN:0471245208]
comment: replaced_by: PO:0000076
is_obsolete: true

[Term]
id: CL:0000473
name: defensive cell
namespace: cell
def: "A cell whose primary function is to protect the organism." [JB:jb]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000474
name: pericardial nephrocyte
namespace: cell
def: "An insect renal cell that filters hemolymph and is found with other pericardial nephrocytes in two rows flanking the dorsal vessel." [FBbt:00003184, GO:0061320, GOC:tfm, PMID:19783135]
synonym: "pericardial cell" NARROW [FBbt:00005058, GO:0061320]
xref: FBbt:00005058
is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia)
is_a: CL:0002520 ! nephrocyte

[Term]
id: CL:0000475
name: obsolete degenerate megaspore
namespace: cell
def: "Obsolete. Use PO:0000245 from Plant Ontology instead. In monosporic and bisporic megasporogenesis: the megaspore(s) that do not participate in megagametogenesis." [TAIR:lr]
comment: replaced_by: PO:0000245
is_obsolete: true

[Term]
id: CL:0000476
name: thyrotroph
namespace: cell
def: "A basophil cell of the anterior pituitary that produces thyroid stimulating hormone, thyrotrophin. This cell type is elongated, polygonal and lie in clusters towards the adenohypophyseal center." [ISBN:0517223651, SANBI:mhl]
synonym: "beta-basophil" EXACT []
synonym: "thyroid stimulating hormone secreting cell" EXACT []
synonym: "thyrotrope" EXACT []
xref: FMA:83099
is_a: CL:0000639 ! basophil cell of pars distalis of adenohypophysis
relationship: capable_of GO:0070460 ! thyroid-stimulating hormone secretion

[Term]
id: CL:0000477
name: ovarian follicle cell
namespace: cell
def: "A somatic epithelial cell of the ovarian follicle/egg chamber." []
comment: Editors note: check this. Currently used in goxp
synonym: "follicle cell" BROAD []
xref: FBbt:00004904
is_a: CARO:0000000
is_a: CL:2000064 ! ovarian surface epithelial cell
relationship: develops_from CL:0000441 ! follicle stem cell

[Term]
id: CL:0000478
name: oxytocin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes oxytocin stimulating hormone" [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000479
name: vasopressin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes vasopressin stimulating hormone" [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000480
name: secretin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes secretin stimulating hormone" [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000481
name: cholecystokin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes cholecystokin stimulating hormone." [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000482
name: juvenile hormone secreting cell
namespace: cell
def: "An endocrine cell that secretes juvenile hormone." [GO:tfm]
is_a: CL:0000163 ! endocrine cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0045443 ! juvenile hormone secretion
relationship: capable_of GO:0045443 ! juvenile hormone secretion

[Term]
id: CL:0000483
name: bombesin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes bombesin stimulating hormone." [GO:tfm, https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000484
name: connective tissue type mast cell
namespace: cell
def: "Mast cell subtype whose granules contain both the serine proteases tryptase and chymase. These cells are primarily found in connective tissue, such as the peritoneal cavity, skin, and intestinal submucosa. Their development is T-cell independent." [GOC:add, GOC:dsd, GOC:tfm, PMID:19923473, PMID:9354811]
comment: They are CD88-positive. The cytoplasmic granules contain high levels of histamine and heparin (mouse) or major neutral proteases, tryptase, chymase, carboxypeptidase A, and cathepsin G (humans). Reportedly, they cannot produce leukotrienes (LTC4) and IL-4. They are reportedly very heterogeneous depending upon location and can convert to the MC(T) phenotype.
synonym: "MC(TC)" EXACT []
synonym: "MCTC" EXACT []
synonym: "TC mast cells" EXACT []
is_a: CL:0000097 {is_inferred="true"} ! mast cell
is_a: CL:0002320 ! connective tissue cell
intersection_of: CL:0000097 ! mast cell
intersection_of: part_of UBERON:0002384 ! connective tissue

[Term]
id: CL:0000485
name: mucosal type mast cell
namespace: cell
def: "Mast cell subtype that contains only the serine protease trypase in its granules. These cells are primarily found in mucosal tissue, such as intestinal mucosa and alveoli. They depend upon T-cells for development of phenotype." [GOC:add, GOC:dsd, PMID:19923473, PMID:9354811]
comment: They are CD88-negative. The cytoplasmic granules contain low levels of histamine and high levels of chondroitin sulfate (mouse) or major neutral proteases and tryptase (humans). Additionally, they can produce leukotrienes (LTC4), IL-5, IL-6, and low levels of IL-4. They are reportedly very heterogeneous depending upon location and can convert to the MC(T) phenotype.
synonym: "MC(T)" EXACT []
synonym: "MCT" EXACT []
synonym: "T mast cells" EXACT []
is_a: CL:0000097 {is_inferred="true"} ! mast cell
intersection_of: CL:0000097 ! mast cell
intersection_of: capable_of GO:0002540 ! leukotriene production involved in inflammatory response
intersection_of: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue
relationship: capable_of GO:0002540 ! leukotriene production involved in inflammatory response
relationship: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue

[Term]
id: CL:0000486
name: garland cell
namespace: cell
def: "A large binucleate cell that forms a 'garland' around the anterior end of the proventriculus (cardia) at its junction with the esophagus in both adults and larvae flies. Each cell is surrounded by a basement membrane and there are numerous micro-invaginations (lacunae) extending from the surface into the cytoplasm. At the mouth of each lacuna is a doubled filament forming a specialised filtration system (diaphragm). The filtrate is endocytosed from the lacunae." [fbbt:00005059, GOC:tfm, PMID:19783135]
synonym: "garland nephrocyte" BROAD [GO:0061321]
xref: BTO:0004596
xref: FBbt:00005059
is_a: CL:0000227 ! binucleate cell
is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia)
is_a: CL:0002520 ! nephrocyte

[Term]
id: CL:0000487
name: oenocyte
namespace: cell
def: "A large secretory cell found in clusters underlying the epidermis of the abdominal segments of larval abdominal segments." [GOC:bf, PMID:11171397]
xref: FBbt:00004995
is_a: CL:0000151 ! secretory cell
relationship: in_taxon NCBITaxon:6656 ! Arthropoda

[Term]
id: CL:0000488
name: visible light photoreceptor cell
namespace: cell
def: "A photoreceptor cell that detects visible light." [GOC:tfm]
is_a: CL:0000210 ! photoreceptor cell
intersection_of: CL:0000210 ! photoreceptor cell
intersection_of: capable_of GO:0009584 ! detection of visible light
relationship: capable_of GO:0009584 ! detection of visible light

[Term]
id: CL:0000489
name: scotopic photoreceptor cell
namespace: cell
is_a: CL:0000210 ! photoreceptor cell

[Term]
id: CL:0000490
name: photopic photoreceptor cell
namespace: cell
is_a: CL:0000488 ! visible light photoreceptor cell

[Term]
id: CL:0000491
name: obsolete cytotoxic T cell
namespace: cell
def: "OBSOLETE: A cell responsible for spontaneous cytotoxicity of a variety of tumor cells without prior immunization. These natural killer cells are found in non-immune humans and experimental animals and are thought by some to be the same as killer cells (killing by antibody-dependent cell cytotoxicity), but they can also kill in the absence of antibody." []
comment: This term had an incorrect definition and was overly broad. Consider using 'cytotoxic T cell ; CL:0000910' (in most cases) or another lymphocyte cell type if cytotoxicity is shown to be part of the cell's phenotype in a particular experimental situation.
is_obsolete: true

[Term]
id: CL:0000492
name: CD4-positive helper T cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that cooperates with other lymphocytes via direct contact or cytokine release to initiate a variety of immune functions." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149, MESH:A11.118.637.555.567.569.200.400]
synonym: "CD4-positive helper T lymphocyte" EXACT []
synonym: "CD4-positive helper T-cell" EXACT []
synonym: "CD4-positive helper T-lymphocyte" EXACT []
synonym: "CD4-positive T-helper cell" EXACT []
xref: CALOHA:TS-1146
xref: FMA:70572
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: capable_of GO:0001816 ! cytokine production
relationship: capable_of GO:0001816 ! cytokine production
relationship: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell
relationship: has_completed GO:0030217 ! T cell differentiation

[Term]
id: CL:0000493
name: obsolete regulatory T cell
namespace: cell
def: "OBSOLETE: Subpopulation of CD4+ cells which induce CD8+ suppressor T cells to suppress antibody production by B cells. They also stimulate other cellular immune responses." []
comment: This term was defined too narrowly; consider using the term 'regulatory T cell ; CL:0000815' instead.
is_obsolete: true

[Term]
id: CL:0000494
name: UV sensitive photoreceptor cell
namespace: cell
def: "A photoreceptor cell that detects ultraviolet light." [GOC:tfm]
is_a: CL:0000210 ! photoreceptor cell
intersection_of: CL:0000210 ! photoreceptor cell
intersection_of: capable_of GO:0009589 ! detection of UV
relationship: capable_of GO:0009589 ! detection of UV

[Term]
id: CL:0000495
name: blue sensitive photoreceptor cell
namespace: cell
def: "A photoreceptor cell that is sensitive to blue light." [GO:tfm]
is_a: CL:0000490 ! photopic photoreceptor cell

[Term]
id: CL:0000496
name: green sensitive photoreceptor cell
namespace: cell
def: "A photoreceptor cell that is sensitive to green light." [GO:tfm]
is_a: CL:0000490 ! photopic photoreceptor cell

[Term]
id: CL:0000497
name: red sensitive photoreceptor cell
namespace: cell
def: "A photoreceptor cell that is sensitive to red light." [GO:tfm]
is_a: CL:0000490 ! photopic photoreceptor cell

[Term]
id: CL:0000498
name: inhibitory interneuron
namespace: cell
def: "An interneuron (also called relay neuron, association neuron or local circuit neuron) is a multipolar neuron which connects afferent neurons and efferent neurons in neural pathways. Like motor neurons, interneuron cell bodies are always located in the central nervous system (CNS)." [GOC:tfm, http://en.wikipedia.org/wiki/Interneuron]
xref: FMA:84776
is_a: CL:0000099 ! interneuron

[Term]
id: CL:0000499
name: stromal cell
namespace: cell
def: "A connective tissue cell of an organ found in the loose connective tissue. These are most often associated with the uterine mucosa and the ovary as well as the hematopoietic system and elsewhere." [GOC:tfm, MESH:A11.329.830]
xref: BTO:0002064
xref: FMA:83624
is_a: CARO:0000000
is_a: CL:0002320 ! connective tissue cell
relationship: develops_from CL:0000134 ! mesenchymal stem cell

[Term]
id: CL:0000500
name: follicular epithelial cell
namespace: cell
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000501
name: granulosa cell
namespace: cell
def: "A supporting cell for the developing female gamete in the ovary of mammals. They develop from the coelomic epithelial cells of the gonadal ridge. Granulosa cells form a single layer around the mammalian oocyte in the primordial ovarian follicle and advance to form a multilayered cumulus oophorus surrounding the ovum in the Graafian follicle. The major functions of granulosa cells include the production of steroids and LH receptors." [MESH:A05.360.319.114.630.535.200]
synonym: "granulosa cell of ovary" EXACT []
xref: BTO:0000542
xref: CALOHA:TS-0729
xref: FMA:18718
is_a: CL:0000174 ! steroid hormone secreting cell
is_a: CL:0002174 ! follicular cell of ovary

[Term]
id: CL:0000502
name: type D enteroendocrine cell
namespace: cell
def: "A cell found throughout the gastrointestinal tract and in the pancreas. They secrete somatostatin in both an endocrine and paracrine manner. Somatostatin inhibits gastrin, cholecystokinin, insulin, glucagon, pancreatic enzymes, and gastric hydrochloric acid. A variety of substances which inhibit gastric acid secretion (vasoactive intestinal peptide, calcitonin gene-related peptide, cholecystokinin, beta-adrenergic agonists, and gastric inhibitory peptide) are thought to act by releasing somatostatin." [MESH:A03.492.766.440.175]
synonym: "D cell" EXACT []
xref: FMA:62935
is_a: CL:0000164 ! enteroendocrine cell
is_a: CL:0000172 ! somatostatin secreting cell

[Term]
id: CL:0000503
name: theca cell
namespace: cell
def: "A flattened stroma cell forming a sheath or theca outside the basal lamina lining the mature ovarian follicle. Thecal interstitial or stromal cells are steroidogenic, and produce primarily androgens which serve as precusors of estrogens in the granulosa cells." [MESH:A05.360.319.114.630.535.400]
xref: BTO:0002850
xref: FMA:18690
is_a: CL:0000593 ! androgen secreting cell
is_a: CL:0002132 ! stromal cell of ovary
relationship: part_of UBERON:0001305 ! ovarian follicle

[Term]
id: CL:0000504
name: enterochromaffin-like cell
namespace: cell
def: "A enteroendocrine cell part of the glands of the gastric mucosa. They produce histamine and peptides such as chromogranins. This cell type respond to gastrin by releasing histamine which acts as a paracrine stimulator of the release of hydrochloric acid from the gastric parietal cells." [GOC:tfm, MESH:A06.224.365]
comment: Consider enterochromaffin cell (CL:0002065). For several years this cell type was "enterochromaffin cell" despite a MESH dbxref and a free text definition that clearly meant enterochromaffin-like cell.
synonym: "ECL" EXACT []
xref: BTO:0002692
is_a: CL:0000164 ! enteroendocrine cell
is_a: CL:0002274 ! histamine secreting cell

[Term]
id: CL:0000505
name: substance P secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes substance P." [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000506
name: enkephalin secreting cell
namespace: cell
def: "An endorphine cell that secretes enkephalin." [GO:tfm]
is_a: CL:0000507 ! endorphin secreting cell

[Term]
id: CL:0000507
name: endorphin secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes endorphin." [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000508
name: type G enteroendocrine cell
namespace: cell
def: "An endocrine cell found in the pyloric gland mucosa (antral mucosa) of the stomach of mammals and responsible for the secretion of gastrin and enkephalin. Most abundant in pyloric antrum, pyramidal in form with a narrow apex bearing long microvilli." [GOC:tfm, ISBN:0517223651, MESH:A03.492.766.440.300]
synonym: "G cell" EXACT []
xref: BTO:0004108
xref: FMA:67609
is_a: CL:0000164 ! enteroendocrine cell
is_a: CL:0000506 ! enkephalin secreting cell
is_a: CL:0000509 ! gastrin secreting cell
is_a: CL:0002180 ! mucous cell of stomach
relationship: part_of UBERON:0004997 ! mucosa of pyloric antrum

[Term]
id: CL:0000509
name: gastrin secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes gastrin." [GO:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000510
name: paneth cell
namespace: cell
def: "An epithelial cell found in the basal part of the intestinal glands (crypts of Lieberkuhn) including the appendix. Paneth cells synthesize and secrete lysozyme and cryptdins. Numerous in the deeper parts of the intestinal crypts, particularly in the duodenum, rich in zinc, contain large acidophilic granules, with irregular apical microvilli and prominent membrane-bound vacuoles containing matrix." [GOC:tfm, ISBN:0517223651, MESH:A03.492.411.369.700]
xref: BTO:0000993
xref: FMA:62897
is_a: CL:0000150 {is_inferred="true"} ! glandular epithelial cell
is_a: CL:0000323 ! lysozyme secreting cell
is_a: CL:0002563 ! intestinal epithelial cell

[Term]
id: CL:0000511
name: androgen binding protein secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes androgen binding protein." [GO:tfm]
is_a: CL:0000154 ! protein secreting cell

[Term]
id: CL:0000512
name: paracrine cell
namespace: cell
def: "A paracrine cell is a secretory cell that secretes an agonist into intercellular spaces in which it diffuses to a target cell other than that which produced it." [GOC:tfm, ISBN:0198529171]
is_a: CL:0000151 ! secretory cell

[Term]
id: CL:0000513
name: cardiac muscle myoblast
namespace: cell
alt_id: CL:0000714
def: "A precursor cell destined to differentiate into cardiac muscle cell." [GOC:tfm, MESH:A11.635.470]
synonym: "cardiac muscle progenitor cell" EXACT []
synonym: "cardiomyocyte progenitor cell" EXACT []
xref: FMA:84797
is_a: CL:0002494 ! cardiocyte
is_a: CL:0010021 ! cardiac myoblast
intersection_of: CL:0000056 ! myoblast
intersection_of: develops_into CL:0000746 ! cardiac muscle cell
intersection_of: part_of UBERON:0001133 ! cardiac muscle tissue
relationship: part_of UBERON:0001133 ! cardiac muscle tissue

[Term]
id: CL:0000514
name: smooth muscle myoblast
namespace: cell
def: "A precursor cell destined to differentiate into smooth muscle myocytes." [GOC:tfm, MESH:A11.635.510, MESH:D032390]
synonym: "myoblast, smooth muscle" EXACT [MESH:D032390]
synonym: "satellite cell" RELATED []
xref: FMA:84798
is_a: CL:0000056 {is_inferred="true"} ! myoblast
intersection_of: CL:0000056 ! myoblast
intersection_of: develops_into CL:0000192 ! smooth muscle cell
relationship: develops_into CL:0000192 ! smooth muscle cell

[Term]
id: CL:0000515
name: skeletal muscle myoblast
namespace: cell
def: "A myoblast that differentiates into skeletal muscle fibers." [SANBI:mhl]
synonym: "skeletal myoblast" EXACT []
xref: FMA:84799
is_a: CL:0000056 {is_inferred="true"} ! myoblast
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000056 ! myoblast
intersection_of: develops_into CL:0008002 ! skeletal muscle fiber
relationship: develops_from CL:0000355 ! multi-potent skeletal muscle stem cell
relationship: develops_into CL:0008002 ! skeletal muscle fiber

[Term]
id: CL:0000516
name: perineuronal satellite cell
namespace: cell
def: "A non-neuronal cell that surrounds the neuronal cell bodies of the ganglia." [GOC:tfm, MESH:A08.340.685]
synonym: "perineural satellite cell" EXACT []
synonym: "perineuronal satellite oligodendroglial cell" EXACT []
synonym: "satellite oligodendrocyte" EXACT []
xref: FMA:54550
is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata)
relationship: develops_from CL:0000339 ! glioblast (sensu Vertebrata)

[Term]
id: CL:0000517
name: macrophage derived foam cell
namespace: cell
def: "A type of foam cell derived from a macrophage containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add, PMID:20213546]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000891 ! foam cell
relationship: develops_from CL:0000235 ! macrophage

[Term]
id: CL:0000518
name: phagocyte (sensu Vertebrata)
namespace: cell
def: "A phagocyte in vertebrates that is able to phagocytosis." [GOC:tfm]
is_a: CL:0000234 ! phagocyte
is_a: CL:0000548 ! animal cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>

[Term]
id: CL:0000519
name: phagocyte (sensu Nematoda and Protostomia)
namespace: cell
def: "A phagocyte from organisms in the Nematoda or Protostomia clades." [GOC:tfm]
is_a: CL:0000234 ! phagocyte

[Term]
id: CL:0000520
name: prokaryotic cell
namespace: cell
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000521
name: fungal cell
namespace: cell
is_a: CL:0000255 ! eukaryotic cell
intersection_of: CL:0000003 ! native cell
intersection_of: only_in_taxon NCBITaxon:4751 ! Fungi
disjoint_from: CL:0000548 ! animal cell
relationship: only_in_taxon NCBITaxon:4751 ! Fungi

[Term]
id: CL:0000522
name: obsolete spore
namespace: cell
def: "OBSOLETE: The reproductive structure of bacteria, fungi and cryptograms." [ISBN:08199377X]
is_obsolete: true

[Term]
id: CL:0000523
name: mononuclear cytotrophoblast cell
namespace: cell
def: "A cell from the inner layer of the trophoblast of the early mammalian embryo that gives rise to the outer surface and villi of the chorion. Mononuclear crytoblasts fuse to give rise to a multinuclear cytotrophoblast." [GOC:tfm, ISBN:0323052908]
synonym: "Langhans' cell" EXACT []
xref: FMA:83042
is_a: CL:0000351 ! trophoblast cell

[Term]
id: CL:0000524
name: spheroplast
namespace: cell
def: "A cell, usually of bacteria or yeast, which has partially lost its cell wall." [MESH:A11.868]
synonym: "sphaeroplast" EXACT []
is_a: CL:0000371 ! protoplast

[Term]
id: CL:0000525
name: syncytiotrophoblast cell
namespace: cell
def: "A cell from the outer syncytial layer of the trophoblast of an early mammalian embryo, directly associated with the maternal blood supply. It secretes hCG in order to maintain progesterone secretion and sustain a pregnancy." [GOC:tfm, ISBN:0323052908]
synonym: "plasmidotrophoblast" EXACT []
synonym: "syncytial trophoblast" EXACT []
synonym: "syntrophoblast" EXACT []
xref: FMA:83043
is_a: CL:0000228 ! multinucleate cell
is_a: CL:2000060 ! placental villous trophoblast
intersection_of: CL:0000351 ! trophoblast cell
intersection_of: bearer_of PATO:0001908 ! multinucleate

[Term]
id: CL:0000526
name: afferent neuron
namespace: cell
def: "A neuron which conveys sensory information centrally from the periphery." [GOC:tfm, MESH:A08.663.650]
synonym: "input neuron" EXACT []
xref: FMA:87653
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000527
name: efferent neuron
namespace: cell
def: "A neuron which sends impulses peripherally to activate muscles or secretory cells." [MESH:A08.663.655]
synonym: "output neuron" EXACT []
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000528
name: nitrergic neuron
namespace: cell
def: "A nerve cell where transmission is mediated by nitric oxide." [MESH:A08.663.748]
xref: FMA:84792
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000529
name: pigmented epithelial cell
namespace: cell
is_a: CL:0000710 ! neurecto-epithelial cell

[Term]
id: CL:0000530
name: primary neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000531
name: primary sensory neuron
namespace: cell
is_a: CL:0000101 ! sensory neuron
is_a: CL:0000530 ! primary neuron
intersection_of: CL:0000101 ! sensory neuron
intersection_of: CL:0000530 ! primary neuron

[Term]
id: CL:0000532
name: CAP motoneuron
namespace: cell
is_a: CL:0000533 ! primary motor neuron

[Term]
id: CL:0000533
name: primary motor neuron
namespace: cell
xref: FMA:83619
is_a: CL:0000100 ! motor neuron
is_a: CL:0000530 ! primary neuron

[Term]
id: CL:0000534
name: primary interneuron
namespace: cell
is_a: CL:0000099 ! interneuron
is_a: CL:0000530 ! primary neuron

[Term]
id: CL:0000535
name: secondary neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000536
name: secondary motor neuron
namespace: cell
xref: FMA:83620
is_a: CL:0000100 ! motor neuron
is_a: CL:0000535 ! secondary neuron
intersection_of: CL:0000100 ! motor neuron
intersection_of: CL:0000535 ! secondary neuron

[Term]
id: CL:0000537
name: obsolete antipodal cell
namespace: cell
def: "Obsolete. Use PO:0020093 from Plant Ontology instead. OBSOLETE, use term from plant ontology. A cell located at the chalazal end of the mature embryo sac in angiosperms." [ISBN:047125208]
comment: replaced_by: PO:0020093
is_obsolete: true

[Term]
id: CL:0000538
name: obsolete epidermal initial
namespace: cell
def: "Obsolete. Use PO:0000349 from Plant Ontology instead. A relatively unspecialized cell that will give rise to specialized cell types of the epidermis." [TAIR:lr]
comment: replaced_by: PO:0000349
is_obsolete: true

[Term]
id: CL:0000539
name: obsolete idioblast
namespace: cell
def: "OBSOLETE: A cell in a tissue that markedly differs in form, size, or contents from other cells in the same tissue." [ISBN:0471245208]
is_obsolete: true

[Term]
id: CL:0000540
name: neuron
namespace: cell
def: "The basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system." [http://en.wikipedia.org/wiki/Neuron, MESH:A08.663, MESH:D009474]
comment: These cells are also reportedly CD4-negative and CD200-positive. They are also capable of producing CD40L and IFN-gamma.
synonym: "nerve cell" EXACT []
xref: BTO:0000938
xref: CALOHA:TS-0683
xref: FBbt:00005106
xref: FMA:54527
xref: VHOG:0001483
xref: WBbt:0003679
is_a: BFO:0000040 ! material entity
is_a: CL:0000393 ! electrically responsive cell
is_a: CL:0000404 ! electrically signaling cell
is_a: CL:0002319 ! neural cell
relationship: capable_of GO:0019226 ! transmission of nerve impulse
relationship: develops_from CL:0000031 {gci_relation="in_taxon", gci_filler="NCBITaxon:7742", xref="https://github.com/obophenotype/cell-ontology/issues/757"} ! neuroblast (sensu Vertebrata)

[Term]
id: CL:0000541
name: melanoblast
namespace: cell
def: "A cell that originates from the neural crest and differentiates into a pigment cell." [GOC:tfm, SANBI:mhl]
comment: Derived from UBERON:0002342 neural crest.
xref: BTO:0003217
xref: FMA:83377
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0002371 ! somatic cell
is_a: CL:0011026 ! progenitor cell
relationship: develops_from CL:0000333 ! migratory neural crest cell

[Term]
id: CL:0000542
name: lymphocyte
namespace: cell
def: "A lymphocyte is a leukocyte commonly found in the blood and lymph that has the characteristics of a large nucleus, a neutral staining cytoplasm, and prominent heterochromatin." [GOC:add, ISBN:0683073696, ISBN:0781735149]
comment: Editors note: consider adding taxon constraint to vertebrata (PMID:18025161)
xref: BTO:0000775
xref: CALOHA:TS-0583
xref: FMA:62863
xref: VHOG:0001535
is_a: CL:0000842 ! mononuclear cell
intersection_of: CL:0000738 ! leukocyte
intersection_of: bearer_of PATO:0001407 ! mononucleate
intersection_of: has_part CL:0017500 ! neutrophillic cytoplasm
intersection_of: has_part CL:0017505 ! increased nucleus size
intersection_of: has_part GO:0000792 ! heterochromatin
disjoint_from: CL:0000766 ! myeloid leukocyte
relationship: develops_from CL:0000051 ! common lymphoid progenitor
relationship: has_part CL:0017500 ! neutrophillic cytoplasm
relationship: has_part CL:0017505 ! increased nucleus size
relationship: has_part GO:0000792 ! heterochromatin

[Term]
id: CL:0000543
name: obsolete sieve tube member
namespace: cell
def: "Obsolete. Use PO:0000289 from Plant Ontology instead. One of the series of cellular components of a sieve tube. It shows a more or less pronounced differentiation between sieve plates (wide pores) and lateral sieve areas (narrow pores). Also sieve tube element and the obsolete sieve tube segment." [ISBN:0471245208]
comment: replaced_by: PO:0000289
synonym: "sieve tube element" EXACT []
is_obsolete: true

[Term]
id: CL:0000544
name: slowly adapting mechanoreceptor cell
namespace: cell
is_a: CL:0000199 ! mechanoreceptor cell

[Term]
id: CL:0000545
name: T-helper 1 cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that has the phenotype T-bet-positive, CXCR3-positive, CCR6-negative, and is capable of producing interferon-gamma." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19375293, PMID:20303875, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'Th1 CD4+ T cell', but its logical definition includes additional known characteristics of T-helper 1 T cells.
synonym: "helper T cell type 1" EXACT []
synonym: "T helper cells type 1" EXACT [PMID:9419219]
synonym: "T(H)-1 cell" EXACT []
synonym: "Th1 CD4+ T cell" EXACT [PMID:22343568]
synonym: "Th1 cell" EXACT []
synonym: "Th1 T cell" EXACT []
synonym: "Th1 T lymphocyte" EXACT []
synonym: "Th1 T-cell" EXACT []
synonym: "Th1 T-lymphocyte" EXACT []
xref: BTO:0001678
xref: FMA:84382
is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell
intersection_of: CL:0000492 ! CD4-positive helper T cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: has_part PR:000001835 ! T-box transcription factor TBX21
intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
intersection_of: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: has_part PR:000001835 ! T-box transcription factor TBX21
relationship: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
relationship: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3

[Term]
id: CL:0000546
name: T-helper 2 cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that has the phenotype GATA-3-positive, CXCR3-negative, CCR6-negative, and is capable of producing interleukin-4." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19375293, PMID:20103781, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'non-Th1/Th17 CD4+ T cell' (see CL:0001051), but includes the additional necessary and sufficient conditions to allow classification as a T-helper 2 T cell.
synonym: "helper T cell type 2" EXACT []
synonym: "T helper cells type 2" EXACT [PMID:9419219]
synonym: "T(H)-2 cell" EXACT []
synonym: "Th2 cell" EXACT []
synonym: "Th2 T cell" EXACT []
synonym: "Th2 T lymphocyte" EXACT []
synonym: "Th2 T-cell" EXACT []
synonym: "Th2 T-lymphocyte" EXACT []
xref: BTO:0001679
xref: FMA:84385
is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell
is_a: CL:0001051 ! CD4-positive, CXCR3-negative, CCR6-negative, alpha-beta T cell
intersection_of: CL:0000492 ! CD4-positive helper T cell
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3
intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3

[Term]
id: CL:0000547
name: proerythroblast
namespace: cell
def: "An immature, nucleated erythrocyte occupying the stage of erythropoeisis that follows formation of erythroid progenitor cells. This cell is CD71-positive, has both a nucleus and a nucleolus, and lacks hematopoeitic lineage markers." [ISBN:0721601464, MESH:A11.118.290.350.200, PMID:1638021]
synonym: "pronormoblast" RELATED []
synonym: "rubriblast" EXACT [ISBN:0721601464]
xref: FMA:83518
is_a: CARO:0000006
is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell
is_a: CL:0002242 ! nucleate cell
intersection_of: CL:0000764 ! erythroid lineage cell
intersection_of: bearer_of PATO:0002505 ! nucleated
intersection_of: has_part CL:0017503 ! basophilic cytoplasm
intersection_of: has_part CL:0017505 ! increased nucleus size
intersection_of: has_part GO:0005730 ! nucleolus
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1
relationship: develops_from CL:0000038 ! erythroid progenitor cell
relationship: has_part CL:0017503 ! basophilic cytoplasm
relationship: has_part CL:0017505 ! increased nucleus size
relationship: has_part GO:0005730 ! nucleolus
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1

[Term]
id: CL:0000548
name: animal cell
namespace: cell
subset: ubprop:upper_level
is_a: CL:0000255 ! eukaryotic cell
intersection_of: CL:0000003 ! native cell
intersection_of: only_in_taxon NCBITaxon:33208 ! Metazoa
relationship: only_in_taxon NCBITaxon:33208 ! Metazoa

[Term]
id: CL:0000549
name: basophilic erythroblast
namespace: cell
def: "A nucleated immature erythrocyte, having cytoplasm generally similar to that of the earlier proerythroblast but sometimes even more basophilic, and usually regular in outline. The nucleus is still relatively large, but the chromatin strands are thicker and more deeply staining, giving a coarser appearance; the nucleoli have disappeared. This cell is CD71-positive and lacks hematopoeitic lineage markers." [GOC:tfm, ISBN:0721601464]
synonym: "basophilic normoblast" EXACT [ISBN:0721601464]
synonym: "early erythroblast" EXACT [ISBN:0721601464]
synonym: "early normoblast" EXACT [ISBN:0721601464]
synonym: "prorubricyte" EXACT [ISBN:0721601464]
xref: FMA:83505
is_a: CARO:0000006
is_a: CL:0000765 {is_inferred="true"} ! erythroblast
intersection_of: CL:0000765 ! erythroblast
intersection_of: has_part CL:0017503 ! basophilic cytoplasm
intersection_of: has_part GO:0000792 ! heterochromatin
intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1
relationship: has_part CL:0017503 ! basophilic cytoplasm
relationship: has_part GO:0000792 ! heterochromatin
relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1

[Term]
id: CL:0000550
name: polychromatophilic erythroblast
namespace: cell
def: "A nucleated, immature erythrocyte in which the nucleus occupies a relatively smaller part of the cell than in its precursor, the basophilic erythroblast. The cytoplasm is beginning to acquire hemoglobin and thus is no longer a purely basophilic, but takes on acidophilic aspects, which becomes progressively more marked as the cell matures. The chromatin of the nucleus is arranged in coarse, deeply staining clumps. This cell is CD71-positive and lacks hematopoeitic lineage markers." [ISBN:0721601464]
synonym: "intermediate erythroblast" EXACT [ISBN:0721601464]
synonym: "intermediate normoblast" EXACT [ISBN:0721601464]
synonym: "polychromatic erythroblast" EXACT [ISBN:0721601464]
synonym: "polychromatic normoblast" EXACT [ISBN:0721601464]
synonym: "polychromatophilic normoblast" EXACT [ISBN:0721601464]
synonym: "rubricyte" EXACT [ISBN:0721601464]
xref: FMA:83506
is_a: CARO:0000006
is_a: CL:0000765 {is_inferred="true"} ! erythroblast
intersection_of: CL:0000765 ! erythroblast
intersection_of: has_part CL:0017504 ! polychromatophilic cytoplasm
intersection_of: has_part GO:0000792 ! heterochromatin
intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1
relationship: develops_from CL:0000549 ! basophilic erythroblast
relationship: has_part CL:0017504 ! polychromatophilic cytoplasm
relationship: has_part GO:0000792 ! heterochromatin
relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1

[Term]
id: CL:0000551
name: unimodal nocireceptor
namespace: cell
is_a: CL:0000198 ! pain receptor cell

[Term]
id: CL:0000552
name: orthochromatic erythroblast
namespace: cell
def: "The final stage of the nucleated, immature erythrocyte, before nuclear loss. Typically the cytoplasm is described as acidophilic, but it still shows a faint polychromatic tint. The nucleus is small and initially may still have coarse, clumped chromatin, as in its precursor, the polychromatophilic erythroblast, but ultimately it becomes pyknotic, and appears as a deeply staining, blue-black, homogeneous structureless mass. The nucleus is often eccentric and sometimes lobulated." [ISBN:0721601464]
synonym: "acidophilic erythroblast" EXACT [ISBN:0721601464]
synonym: "eosinophilic erythroblast" EXACT [ISBN:0721601464]
synonym: "late erythoblast" EXACT []
synonym: "orthochromatic normoblast" EXACT [ISBN:0721601464]
synonym: "pyknotic eto enrythroblast" EXACT [ISBN:0721601464]
xref: FMA:84646
is_a: CL:0000765 {is_inferred="true"} ! erythroblast
intersection_of: CL:0000765 ! erythroblast
intersection_of: has_part CL:0017502 ! acidophilic cytoplasm
intersection_of: participates_in GO:0030263 ! apoptotic chromosome condensation
relationship: develops_from CL:0000550 ! polychromatophilic erythroblast
relationship: has_part CL:0017502 ! acidophilic cytoplasm
relationship: participates_in GO:0030263 ! apoptotic chromosome condensation

[Term]
id: CL:0000553
name: megakaryocyte progenitor cell
namespace: cell
def: "The earliest cytologically identifiable precursor in the thrombocytic series. This cell is capable of endomitosis and lacks expression of hematopoieitic lineage markers (lin-negative)." [GOC:dsd, GOC:tfm, ISBN:0721601464]
comment: Lineage negative is described here as CD2-negative, CD3-negative, CD4-negative, CD5-negative, CD8a-negative, CD14-negative, CD19-negative, CD20-negative, CD56-negative, Ly6g-negative, and Ter119-negative.
synonym: "CFU-Meg" EXACT [PMID:11722431, PMID:12482498]
synonym: "colony-forming unit-megakaryocyte" EXACT []
synonym: "Meg-CFC" EXACT [PMCID:PMC1794060]
synonym: "megacaryoblast" EXACT []
synonym: "megacaryocyte progenitor cell" EXACT []
synonym: "megakaryoblast" EXACT []
synonym: "megakaryocytic progenitor cell" EXACT [PMID:12482498]
synonym: "MkP" EXACT [PMID:21116988]
synonym: "promegacaryocyte" RELATED []
synonym: "promegakaryocyte" RELATED []
xref: BTO:0001164
xref: CALOHA:TS-0610
xref: FMA:84235
is_a: CL:0000763 ! myeloid cell
is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell
intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell
intersection_of: capable_of GO:0007113 ! endomitotic cell cycle
intersection_of: capable_of GO:0030219 ! megakaryocyte differentiation
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: capable_of GO:0007113 ! endomitotic cell cycle
relationship: capable_of GO:0030219 ! megakaryocyte differentiation
relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)

[Term]
id: CL:0000554
name: gastrin stimulating hormone secreting cell
namespace: cell
def: "A peptide hormone secreting cell that secretes gastrin stimulating hormone." [GOC:tfm]
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000555
name: neuronal brush cell
namespace: cell
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)

[Term]
id: CL:0000556
name: megakaryocyte
namespace: cell
def: "A giant cell 50 to 100 micron in diameter, with a greatly lobulated nucleus, found in the bone marrow; mature blood platelets are released from its cytoplasm." [http://en.wikipedia.org/wiki/Megakaryocyte, ISBN:0721601464, MESH:D008533]
comment: Megakaryocytes are reportedly CD181-positive and CD182-positive.
synonym: "megacaryocyte" EXACT []
synonym: "megalocaryocyte" EXACT []
synonym: "megalokaryocyte" EXACT []
xref: BTO:0000843
xref: CALOHA:TS-0611
xref: FMA:83555
is_a: CL:0000763 {is_inferred="true"} ! myeloid cell
is_a: CL:1001610 ! bone marrow hematopoietic cell
intersection_of: CL:0000763 ! myeloid cell
intersection_of: bearer_of PATO:0001393 ! euploid
intersection_of: part_of UBERON:0002371 ! bone marrow
disjoint_from: CL:0000764 ! erythroid lineage cell
relationship: bearer_of PATO:0001393 ! euploid
relationship: develops_from CL:0000553 ! megakaryocyte progenitor cell

[Term]
id: CL:0000557
name: granulocyte monocyte progenitor cell
namespace: cell
def: "A hematopoietic progenitor cell that is committed to the granulocyte and monocyte lineages. These cells are CD123-positive, and do not express Gata1 or Gata2 but do express C/EBPa, and Pu.1." [GO_REF:0000031, GOC:amm, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/CFU-GM, http://www.copewithcytokines.de, ISBN:0721601464, MESH:D055014, PMCID:PMC2213186, PMCID:PMC548021, PMID:16551251, PMID:16647566]
comment: Originally described in the dendritic cell ontology (DC_CL:0000042)(PMID:19243617). GMPs are reportedly CD16-positive, CD32-positive, CD34-positive, CD38-positive, CD45RA-positive, CD110-negative, CD117-positive, CD123-positive, and SCA1-negative.
synonym: "CFU-C , Colony forming unit in culture" BROAD [http://www.copewithcytokines.de]
synonym: "CFU-GM" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021]
synonym: "colony forming unit granulocyte macrophage" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021]
synonym: "GMP" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021]
synonym: "granulocyte-macrophage progenitor" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021]
synonym: "granulocyte/monocyte precursor" EXACT []
synonym: "granulocyte/monocyte progenitor" EXACT []
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0001012 ! CD7-negative lymphoid progenitor OR granulocyte monocyte progenitor
is_a: CL:0011026 ! progenitor cell
is_a: CL:1001610 ! bone marrow hematopoietic cell
intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell
intersection_of: capable_of GO:0030225 ! macrophage differentiation
intersection_of: capable_of GO:0030851 ! granulocyte differentiation
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: lacks_part PR:000007857 ! erythroid transcription factor
intersection_of: lacks_part PR:000007858 ! endothelial transcription factor GATA-2
intersection_of: part_of UBERON:0002371 ! bone marrow
intersection_of: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain
relationship: capable_of GO:0030225 ! macrophage differentiation
relationship: capable_of GO:0030851 ! granulocyte differentiation
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: lacks_part PR:000007857 ! erythroid transcription factor
relationship: lacks_part PR:000007858 ! endothelial transcription factor GATA-2
relationship: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain

[Term]
id: CL:0000558
name: reticulocyte
namespace: cell
def: "An immature erythrocyte that changes the protein composition of its plasma membrane by exosome formation and extrusion. The types of protein removed differ between species though removal of the transferrin receptor is apparent in mammals and birds." [GOC:add, GOC:tfm, PMID:15946868, PMID:2037622]
xref: BTO:0001173
xref: CALOHA:TS-0864
is_a: BFO:0000040 ! material entity
is_a: CARO:0000006
is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell
intersection_of: CL:0000764 ! erythroid lineage cell
intersection_of: capable_of GO:0071971 ! extracellular exosome assembly
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1
relationship: capable_of GO:0071971 ! extracellular exosome assembly
relationship: develops_from CL:0000552 ! orthochromatic erythroblast
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1

[Term]
id: CL:0000559
name: promonocyte
namespace: cell
def: "A precursor in the monocytic series, being a cell intermediate in development between the monoblast and monocyte. This cell is CD11b-positive and has fine azurophil granules." [GOC:tfm, ISBN:0721601464]
comment: Morphology: Mononuclear cell, diameter 14-18 _M, fine azurophilic granules; markers: CD11b (shared with many other myeloid cells); location: Adult: bone marrow; Fetal: Liver, Yolk Sac; role or process: hematopoiesis, monocyte development; lineage: hematopoietic, myeloid.
xref: BTO:0004657
xref: FMA:83551
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002194 {is_inferred="true"} ! monopoietic cell
intersection_of: CL:0002194 ! monopoietic cell
intersection_of: capable_of GO:0030224 ! monocyte differentiation
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: develops_from CL:0000040 ! monoblast
relationship: has_part GO:0042582 ! azurophil granule
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M

[Term]
id: CL:0000560
name: band form neutrophil
namespace: cell
def: "A late neutrophilic metamyelocyte in which the nucleus is indented to more than half the distance to the farthest nuclear margin but in no area being condensed to a single filament. The nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature neutrophil. These cells are fMLP receptor-positive, CD11b-positive, CD35-negative, and CD49d-negative." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007]
comment: Found in the Band 1 fraction.
synonym: "band" BROAD []
synonym: "band cell" BROAD []
synonym: "band form" BROAD []
synonym: "rod neutrophil" EXACT []
synonym: "stab cell" BROAD []
is_a: CL:0000096 {is_inferred="true"} ! mature neutrophil
intersection_of: CL:0000096 ! mature neutrophil
intersection_of: has_part CL:0017506 ! banded nucleus
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000007597 ! proto-oncogene c-Fos
intersection_of: lacks_part PR:000009978 ! lactotransferrin
intersection_of: lacks_part PR:000010799 ! myb proto-oncogene protein
intersection_of: lacks_plasma_membrane_part PR:000009129 ! integrin alpha-4
intersection_of: lacks_plasma_membrane_part PR:000010543 ! myeloperoxidase
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001337 ! has plasma membrane part complement receptor type 1
intersection_of: RO:0002104 PR:000001580 ! has plasma membrane part fMet-Leu-Phe receptor
relationship: develops_from CL:0000582 ! neutrophilic metamyelocyte
relationship: has_part CL:0017506 ! banded nucleus
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000007597 ! proto-oncogene c-Fos
relationship: lacks_part PR:000009978 ! lactotransferrin
relationship: lacks_part PR:000010799 ! myb proto-oncogene protein
relationship: lacks_plasma_membrane_part PR:000009129 ! integrin alpha-4
relationship: lacks_plasma_membrane_part PR:000010543 ! myeloperoxidase
relationship: RO:0002104 PR:000001337 ! has plasma membrane part complement receptor type 1
relationship: RO:0002104 PR:000001580 ! has plasma membrane part fMet-Leu-Phe receptor

[Term]
id: CL:0000561
name: amacrine cell
namespace: cell
def: "Interneuron of the vertebrate retina. They integrate, modulate, and interpose a temporal domain in the visual message presented to the retinal ganglion cells, with which they synapse in the inner plexiform layer. They lack large axons." [GOC:tfm, MESH:A08.663.358.050, WikipediaVersioned:Amacrine_cell&oldid=1023572246]
synonym: "amacrine neuron" EXACT []
xref: BTO:0004044
xref: FMA:67766
is_a: CARO:0000000
is_a: CL:0000099 ! interneuron
is_a: CL:0009004 ! retinal cell
relationship: in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>
relationship: part_of UBERON:0000966 ! retina
relationship: RO:0002120 CL:0000740 ! synapsed to retinal ganglion cell

[Term]
id: CL:0000562
name: nucleate erythrocyte
namespace: cell
def: "An erythrocyte having a nucleus." [GOC:add, GOc:tfm]
synonym: "RBC" BROAD []
synonym: "red blood cell" BROAD []
is_a: CL:0000232 {is_inferred="true"} ! erythrocyte
is_a: CL:0002242 ! nucleate cell
intersection_of: CL:0000232 ! erythrocyte
intersection_of: bearer_of PATO:0002505 ! nucleated
relationship: develops_from CL:0002421 ! nucleated reticulocyte

[Term]
id: CL:0000563
name: endospore
namespace: cell
def: "A rounded, inactive form that certain bacteria assume under conditions of extreme temperature, dryness, or lack of food. The bacterium develops a waterproof cell wall that protects it from being dried out or damaged." [GOC:tfm, ISBN:0618947256]
synonym: "bacterial spore" EXACT []
xref: BTO:0002779
is_a: CL:0000520 ! prokaryotic cell

[Term]
id: CL:0000564
name: neutrophilic promyelocyte
namespace: cell
def: "A promyelocyte committed to the neutrophil lineage. This cell type is GATA-1-positive, C/EBPa-positive, AML-1-positive, MPO-positive, has low expression of PU.1 transcription factor and lacks lactotransferrin expression." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0721601464, PMID:12560239, PMID:15514007]
comment: These cells are CD11b-negative, CD15-positive, CD16-negative, CD49d-positive, CD68-positive, CD35-negative, and fMLP receptor-negative. They are found in the Band 3 fraction.
synonym: "neutrophilic premyelocyte" EXACT []
synonym: "neutrophilic progranulocyte" EXACT []
xref: FMA:84196
is_a: CL:0000834 ! neutrophil progenitor cell
is_a: CL:0000836 {is_inferred="true"} ! promyelocyte
intersection_of: CL:0000836 ! promyelocyte
intersection_of: capable_of GO:0030223 ! neutrophil differentiation
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000007857 ! erythroid transcription factor
intersection_of: has_part PR:000010543 ! myeloperoxidase
intersection_of: has_part PR:000014362 ! runt-related transcription factor 1
intersection_of: lacks_part PR:000009978 ! lactotransferrin
relationship: develops_from CL:0000042 ! neutrophilic myeloblast
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: has_part PR:000010543 ! myeloperoxidase
relationship: has_part PR:000014362 ! runt-related transcription factor 1
relationship: lacks_part PR:000009978 ! lactotransferrin

[Term]
id: CL:0000565
name: fat body cell
namespace: cell
def: "A cell found in fat bodies whose primary function is intermediary metabolism." [FB:ma]
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000566
name: angioblastic mesenchymal cell
namespace: cell
def: "A mesenchymal stem cell capable of developing into blood vessel endothelium." [GOC:dsd, GOC:tfm, PMID:12768659]
comment: These cells are reportedly CD31-positive, CD34-positive, CD144-positive, CD309-positive, and TAL1-positive.
synonym: "angioblast" EXACT []
synonym: "chondroplast" EXACT []
is_a: CARO:0000006
is_a: CL:0000134 {is_inferred="true"} ! mesenchymal stem cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000134 ! mesenchymal stem cell
intersection_of: RO:0002104 PR:000001444 ! has plasma membrane part cadherin-5
intersection_of: RO:0002104 PR:000002112 ! has plasma membrane part vascular endothelial growth factor receptor 2
intersection_of: RO:0002104 PR:000016043 ! has plasma membrane part T-cell acute lymphocytic leukemia protein 1
relationship: develops_from CL:0000134 ! mesenchymal stem cell
relationship: RO:0002104 PR:000001444 ! has plasma membrane part cadherin-5
relationship: RO:0002104 PR:000002112 ! has plasma membrane part vascular endothelial growth factor receptor 2
relationship: RO:0002104 PR:000016043 ! has plasma membrane part T-cell acute lymphocytic leukemia protein 1

[Term]
id: CL:0000567
name: polymodal nocireceptor
namespace: cell
is_a: CL:0000198 ! pain receptor cell

[Term]
id: CL:0000568
name: amine precursor uptake and decarboxylation cell
namespace: cell
def: "A cell that originates in the neural crest, that has certain cytochemical and ultrastructural characteristics and is found scattered throughout the body; types include melanocytes, the cells of the chromaffin system, and cells in the hypothalamus, hypophysis, thyroid, parathyroids, lungs, gastrointestinal tract, and pancreas. This cell type concentrates the amino acid precursors of certain amines and decarboxylate them, forming amines that function as regulators and neurotransmitters. This cell type produces substances such as epinephrine, norepinephrine, dopamine, serotonin, enkephalin, somatostatin, neurotensin, and substance P, the actions of which may affect contiguous cells, nearby groups of cells, or distant cells, thus functioning as local or systemic hormones. The name is an acronym for amine precursor uptake and decarboxylation cell." [GOC:tfm, ISBN:0721662544, MESH:A11.070]
synonym: "APUD cell" EXACT []
xref: BTO:0003866
xref: FMA:83114
is_a: CL:0000165 ! neuroendocrine cell

[Term]
id: CL:0000569
name: cardiac mesenchymal cell
namespace: cell
def: "A mesenchymal cell found in the developing heart and that develops into some part of the heart.  These cells derive from intra- and extra-cardiac sources, including the endocardium, epicardium, neural crest, and second heart field." [PMID:18816864]
is_a: CARO:0000000
is_a: CL:0008019 ! mesenchymal cell
intersection_of: CL:0008019 ! mesenchymal cell
intersection_of: develops_into CL:0002494 ! cardiocyte
relationship: develops_into CL:0002494 ! cardiocyte

[Term]
id: CL:0000570
name: parafollicular cell
namespace: cell
def: "A neuroepithelial cells that occurs singly or in small groups, close to the outer follicular borders but within the follicular basement membrane of the thyroid. Expresses a form of the neural cell adhesion molecule (N-CAM) on their surface. Secretes calcitonin, 5-hydroxytryptamine and dopamine." [GOC:tfm, ISBN:0517223651]
synonym: "C cell" EXACT []
synonym: "C cell of thyroid gland" EXACT [FMA:68653]
synonym: "clear cell of thyroid gland" EXACT [FMA:68653]
synonym: "parafollicular cell of thyroid gland" EXACT [FMA:68653]
synonym: "thyroid parafollicular cell" EXACT [FMA:68653]
xref: FMA:68653
xref: SCTID:176770005
is_a: CARO:0000006
is_a: CL:0000443 {is_inferred="true"} ! calcitonin secreting cell
is_a: CL:0000458 ! serotonin secreting cell
is_a: CL:0000710 {is_inferred="true"} ! neurecto-epithelial cell
intersection_of: CL:0000710 ! neurecto-epithelial cell
intersection_of: capable_of GO:0001820 ! serotonin secretion
intersection_of: capable_of GO:0014046 ! dopamine secretion
intersection_of: capable_of GO:0036161 ! calcitonin secretion
intersection_of: RO:0002104 PR:000001024 ! has plasma membrane part neural cell adhesion molecule 1
relationship: capable_of GO:0014046 ! dopamine secretion
relationship: develops_from CL:0000333 ! migratory neural crest cell
relationship: part_of UBERON:0001747 ! parenchyma of thyroid gland
relationship: RO:0002104 PR:000001024 ! has plasma membrane part neural cell adhesion molecule 1

[Term]
id: CL:0000571
name: leucophore
namespace: cell
def: "A pigment cell derived from the neural crest. Contains uric acid or other purine crystals deposited in stacks called leucosomes. The crystals reflect light and this gives a white appearance under white light." [SANBI:mhl]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 ! pigment cell
relationship: develops_from CL:0005003 ! leucoblast

[Term]
id: CL:0000573
name: retinal cone cell
namespace: cell
def: "One of the two photoreceptor cell types in the vertebrate retina. In cones the photopigment is in invaginations of the cell membrane of the outer segment. Cones are less sensitive to light than rods, but they provide vision with higher spatial and temporal acuity, and the combination of signals from cones with different pigments allows color vision." [MESH:A08.663.650.650.670.100]
xref: BTO:0001036
xref: CALOHA:TS-0866
xref: FMA:67748
is_a: CL:0010009 ! camera-type eye photoreceptor cell
relationship: develops_from CL:0002672 ! retinal progenitor cell

[Term]
id: CL:0000574
name: erythrophore
namespace: cell
def: "A pigment cell derived from the neural crest. Contains pteridine and/or carotenoid pigments in structures called pterinosomes or erythrosomes. This gives an orange to red appearance." [SANBI:mhl]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 ! pigment cell
relationship: develops_from CL:0005004 ! pigment erythroblast

[Term]
id: CL:0000575
name: corneal epithelial cell
namespace: cell
alt_id: CL:1000431
def: "An epithelial cell of the cornea." [GOC:tfm]
synonym: "epithelial cell of cornea" EXACT [FMA:70551]
xref: BTO:0004298
xref: CALOHA:TS-0173
xref: FMA:70551
is_a: CL:0000076 {is_inferred="true"} ! squamous epithelial cell
is_a: CL:0002159 ! general ecto-epithelial cell
intersection_of: CL:0000076 ! squamous epithelial cell
intersection_of: part_of UBERON:0000964 ! cornea
relationship: part_of UBERON:0000964 ! cornea

[Term]
id: CL:0000576
name: monocyte
namespace: cell
def: "Myeloid mononuclear recirculating leukocyte that can act as a precursor of tissue macrophages, osteoclasts and some populations of tissue dendritic cells." [GO_REF:0000031, MESH:A11.118.637.555.652]
comment: Morphology: Mononuclear cell, diameter, 14 to 20 _M, N/C ratio 2:1-1:1. Nucleus may appear in variety of shapes: round, kidney, lobulated, or convoluted. Fine azurophilic granules present; markers: CD11b (shared with other myeloid cells), human: CD14, mouse: F4/80-mid,GR1-low; location: Blood, but can be recruited into tissues; role or process: immune & tissue remodelling; lineage: hematopoietic, myeloid.
xref: BTO:0000876
xref: CALOHA:TS-0638
xref: FMA:62864
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
is_a: CL:0000842 ! mononuclear cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: bearer_of PATO:0001407 ! mononucleate
intersection_of: capable_of GO:0030225 ! macrophage differentiation
intersection_of: capable_of GO:0030316 ! osteoclast differentiation
intersection_of: capable_of GO:0043011 ! myeloid dendritic cell differentiation
relationship: capable_of GO:0030225 ! macrophage differentiation
relationship: capable_of GO:0030316 ! osteoclast differentiation
relationship: capable_of GO:0043011 ! myeloid dendritic cell differentiation
relationship: develops_from CL:0000559 ! promonocyte

[Term]
id: CL:0000577
name: type EC enteroendocrine cell
namespace: cell
alt_id: CL:0002065
def: "A subtype of enteroendocrine cells found in the gastrointestinal mucosa, particularly in the glands of pyloric antrum; duodenum; and ileum. These cell type secretes serotonin and some neurotransmitters including enkephalins and substance P. Their secretory granules stain readily with silver (argentaffin stain)." [MESH:A03.492.766.440.250, PMID:9505449]
synonym: "argentaffin cell" EXACT []
synonym: "enterochromaffin cell" EXACT []
synonym: "Kulchitsky cell" EXACT []
xref: FMA:62934
xref: FMA:83132
is_a: CL:0000164 ! enteroendocrine cell
is_a: CL:0000166 ! chromaffin cell
is_a: CL:0000458 ! serotonin secreting cell
is_a: CL:0000506 ! enkephalin secreting cell
is_a: CL:0002251 ! epithelial cell of alimentary canal
relationship: part_of UBERON:0004786 ! gastrointestinal system mucosa

[Term]
id: CL:0000578
name: experimentally modified cell in vitro
namespace: cell
def: "A cell in vitro that has undergone physical changes as a consequence of a deliberate and specific experimental procedure." [FB:ma, ReO:mhb]
comment: This class has been re-labeled to imply reference only to in vitro experimentally modified cells, similarly, the definition has been slightly updated to reflect this. 'experimentally modified cell' refers only to cells in vitro, and not modified in vivo/in environment cells. There is currently no class representing unmodified in vitro cells (other than the parent 'cell in vitro'), or a class representing modified native cells. More granular subclassing of experimentally modified cell can be found in ReO. MHB 1.12.12
is_a: CL:0001034 ! cell in vitro

[Term]
id: CL:0000579
name: border follicle cell
namespace: cell
xref: FBbt:00004905
is_a: CL:0000477 ! ovarian follicle cell

[Term]
id: CL:0000580
name: neutrophilic myelocyte
namespace: cell
def: "A neutrophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte; in this stage, production of primary granules is complete and neutrophil-specific granules has started. No nucleolus is present. This cell type is CD13-positive, CD16-negative, integrin alpha-M-positive, CD15-positive, CD33-positive, CD24-positive, C/EBP-a-positive, C/EBPe-positive, PU.1-positive, lactotransferrin-positive, myeloperoxidase-positive and NGAL-positive." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007]
comment: These cells are also CD15-positive, CD35-negative, CD49d-positive, and fMLP receptor-negative. They are found in the Band 2 fraction.
xref: BTO:0003455
xref: FMA:83540
is_a: CL:0000776 {is_inferred="true"} ! immature neutrophil
is_a: CL:0002087 ! nongranular leukocyte
is_a: CL:0002193 ! myelocyte
intersection_of: CL:0000776 ! immature neutrophil
intersection_of: has_part CL:0017502 ! acidophilic cytoplasm
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon
intersection_of: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin
intersection_of: has_part PR:000009978 ! lactotransferrin
intersection_of: has_part PR:000010543 ! myeloperoxidase
intersection_of: lacks_part GO:0070820 ! tertiary granule
intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: has_part CL:0017502 ! acidophilic cytoplasm
relationship: has_part GO:0042582 ! azurophil granule
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon
relationship: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin
relationship: has_part PR:000009978 ! lactotransferrin
relationship: has_part PR:000010543 ! myeloperoxidase
relationship: lacks_part GO:0070820 ! tertiary granule
relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000581
name: peritoneal macrophage
namespace: cell
def: "A macrophage resident in the peritoneum under non-inflammatory conditions. Markers include F4/80-high, CD11b-high, CD68-positive, SIGNR1-positive, CD115-high, MHC-II-negative, and Dectin-1-positive." [MESH:A11.329.372.630, PMID:15771589, PMID:19201820]
comment: Markers: Mouse: F4/80-high, CD11b-high, CD68+, SIGNR1+, Dectin-1+.
xref: BTO:0001034
xref: FMA:83025
is_a: CARO:0000006
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: capable_of GO:0042742 ! defense response to bacterium
intersection_of: has_high_plasma_membrane_amount PR:000001012 ! integrin alpha-M
intersection_of: has_high_plasma_membrane_amount PR:000001813 ! adhesion G protein-coupled receptor E1
intersection_of: has_high_plasma_membrane_amount PR:000002062 ! macrophage colony-stimulating factor 1 receptor
intersection_of: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex
intersection_of: located_in UBERON:0001179 ! peritoneal cavity
intersection_of: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
intersection_of: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B
relationship: capable_of GO:0042742 ! defense response to bacterium
relationship: has_high_plasma_membrane_amount PR:000001012 ! integrin alpha-M
relationship: has_high_plasma_membrane_amount PR:000001813 ! adhesion G protein-coupled receptor E1
relationship: has_high_plasma_membrane_amount PR:000002062 ! macrophage colony-stimulating factor 1 receptor
relationship: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex
relationship: located_in UBERON:0001179 ! peritoneal cavity
relationship: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B

[Term]
id: CL:0000582
name: neutrophilic metamyelocyte
namespace: cell
def: "A neutrophil precursor in the granulocytic series, being a cell intermediate in development between a myelocyte and the band form neutrophil. The protein synthesis seen in earlier stages decreases or stops; the nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare; and the cytoplasm becomes amphophilic like that of a mature granulocyte. This cell type is integrin alpha-M-positive, CD13-negative, CD15-positive, CD16-positive, CD33-positive, CD24-positive, fMLP receptor-negative and has expression of C/EBP-a, C/EBP-e, PU.1 transcription factor, lactotransferrin, myeloperoxidase and neutrophil gelatinase associated lipocalin." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007]
comment: These cells are also CD35-negative, CD49d-positive, and fMLP receptor-negative. They are found in the Band 2 fraction.
synonym: "juvenile neutrophil" EXACT []
xref: FMA:84197
is_a: CL:0000776 {is_inferred="true"} ! immature neutrophil
is_a: CL:0002192 ! metamyelocyte
intersection_of: CL:0000776 ! immature neutrophil
intersection_of: has_part CL:0017502 ! acidophilic cytoplasm
intersection_of: has_part CL:0017507 ! reniform nucleus
intersection_of: has_part GO:0000792 ! heterochromatin
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: has_part GO:0070820 ! tertiary granule
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon
intersection_of: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin
intersection_of: has_part PR:000009978 ! lactotransferrin
intersection_of: has_part PR:000010543 ! myeloperoxidase
intersection_of: lacks_plasma_membrane_part PR:000001580 ! fMet-Leu-Phe receptor
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: develops_from CL:0000580 ! neutrophilic myelocyte
relationship: has_part CL:0017502 ! acidophilic cytoplasm
relationship: has_part CL:0017507 ! reniform nucleus
relationship: has_part GO:0000792 ! heterochromatin
relationship: has_part GO:0042582 ! azurophil granule
relationship: has_part GO:0070820 ! tertiary granule
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon
relationship: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin
relationship: has_part PR:000009978 ! lactotransferrin
relationship: has_part PR:000010543 ! myeloperoxidase
relationship: lacks_plasma_membrane_part PR:000001580 ! fMet-Leu-Phe receptor
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000583
name: alveolar macrophage
namespace: cell
def: "A tissue-resident macrophage found in the alveoli of the lungs. Ingests small inhaled particles resulting in degradation and presentation of the antigen to immunocompetent cells. Markers include F4/80-positive, CD11b-/low, CD11c-positive, CD68-positive, sialoadhesin-positive, dectin-1-positive, MR-positive, CX3CR1-negative." [GO_REF:0000031, GOC:ana, GOC:dsd, GOC:tfm, MESH:A11.329.372.600]
comment: Markers: Mouse: F4/80mid, CD11b-/low, CD11c+, CD68+, sialoadhesin+, dectin-1+, MR+, CX3CR1-.
synonym: "dust cell" EXACT []
synonym: "MF.Lu" RELATED []
xref: BTO:0000802
xref: CALOHA:TS-0030
xref: FMA:83023
is_a: CARO:0000006
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
is_a: CL:1001603 ! lung macrophage
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: capable_of GO:0019882 ! antigen processing and presentation
intersection_of: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001206 ! CX3C chemokine receptor 1
intersection_of: located_in UBERON:0002299 ! alveolus of lung
intersection_of: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X
intersection_of: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A
intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
intersection_of: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1
relationship: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001206 ! CX3C chemokine receptor 1
relationship: located_in UBERON:0002299 ! alveolus of lung
relationship: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X
relationship: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A
relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1

[Term]
id: CL:0000584
name: enterocyte
namespace: cell
def: "An epithelial cell that has its apical plasma membrane folded into microvilli to provide ample surface for the absorption of nutrients from the intestinal lumen." [SANBI:mhl]
xref: BTO:0000398
xref: FMA:62122
is_a: CL:0000239 ! brush border epithelial cell
is_a: CL:0000677 ! gut absorptive cell
is_a: CL:0002563 ! intestinal epithelial cell

[Term]
id: CL:0000585
name: obsolete null cell
namespace: cell
def: "OBSOLETE: A class of lymphocytes characterized by the lack of surface markers specific for either T or B cells." []
comment: This term is rather archaic; consider using 'natural killer cell ; CL:0000623', 'pro-B cell ; CL:0000826', 'pro-T cell ; CL:0000827', or other appropriate lymphocyte-related term depending on the context.
is_obsolete: true

[Term]
id: CL:0000586
name: germ cell
namespace: cell
def: "The reproductive cell in multicellular organisms." [MESH:A05.360.490]
xref: BTO:0000535
xref: VHOG:0001534
xref: WBbt:0006796
is_a: CL:0000039 {is_inferred="true"} ! germ line cell
relationship: capable_of GO:0048609 ! multicellular organismal reproductive process

[Term]
id: CL:0000587
name: cold sensing thermoreceptor cell
namespace: cell
def: "A thermoreceptor cell that detects reduced temperatures." [GOC:tfm]
is_a: CL:0000205 ! thermoreceptor cell

[Term]
id: CL:0000588
name: odontoclast
namespace: cell
def: "A specialized osteoclast associated with the absorption and removal of cementum." [GOC:add, MESH:A11.329.679]
xref: BTO:0002516
xref: FMA:83027
is_a: CL:0000092 {is_inferred="true"} ! osteoclast
intersection_of: CL:0000092 ! osteoclast
intersection_of: capable_of GO:0042483 ! negative regulation of odontogenesis
relationship: capable_of GO:0042483 ! negative regulation of odontogenesis

[Term]
id: CL:0000589
name: cochlear inner hair cell
namespace: cell
def: "A bulbous cell that is medially placed in one row in the organ of Corti. In contrast to the outer hair cells, the inner hair cells are fewer in number, have fewer sensory hairs, and are less differentiated." [MESH:A08.663.650.250.250]
synonym: "inner hair cell" BROAD []
xref: BTO:0003667
xref: FMA:62365
is_a: CL:4023120 ! cochlea auditory hair cell

[Term]
id: CL:0000590
name: small luteal cell
namespace: cell
def: "A progesterone secreting cell in the corpus luteum that develops from theca cells." [GOC:tfm, MESH:A05.360.319.114.630.278.400]
synonym: "small lutein cell" EXACT []
synonym: "theca lutein cell" EXACT []
xref: BTO:0002850
xref: FMA:18690
is_a: CL:0000175 ! luteal cell
relationship: develops_from CL:0000503 ! theca cell

[Term]
id: CL:0000591
name: warmth sensing thermoreceptor cell
namespace: cell
def: "A thermoreceptor cell that detects increased temperatures." [GOC:tfm, https://orcid.org/0000-0001-5208-3432]
is_a: CL:0000205 ! thermoreceptor cell

[Term]
id: CL:0000592
name: large luteal cell
namespace: cell
def: "A large, progesterone secreting cell in the corpus luteum that develops from the granulosa cells." [GOC:tfm, MESH:A05.360.319.114.630.278.400]
synonym: "granulosa lutein cell" EXACT []
synonym: "granulosoluteocytus" RELATED []
xref: FMA:18689
is_a: CL:0000175 ! luteal cell
is_a: CL:0000177 ! testosterone secreting cell
relationship: develops_from CL:0000501 ! granulosa cell

[Term]
id: CL:0000593
name: androgen secreting cell
namespace: cell
def: "A steroid hormone secreting cell that secretes androgen." [GOC:tfm]
is_a: CL:0000174 ! steroid hormone secreting cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0035935 ! androgen secretion
relationship: capable_of GO:0035935 ! androgen secretion

[Term]
id: CL:0000594
name: skeletal muscle satellite cell
namespace: cell
def: "An elongated, spindle-shaped, cell that is located between the basal lamina and the plasmalemma of a muscle fiber. These cells are mostly quiescent, but upon activation they divide to produce cells that generate new muscle fibers." [GOC:tfm, MESH:A11.635.500.700, PMID:21849021, PMID:23303905]
comment: Skeletal muscle satellite cells are not traditionally referred to as myoblasts.  They are a heterogeneous population whose division, following activiation, contributes to the formation of skeletal muscle fibers and to maintenance of the skeletal muscle statelite cell population.
is_a: CL:0000188 ! cell of skeletal muscle
is_a: CL:0000680 ! muscle precursor cell

[Term]
id: CL:0000595
name: enucleate erythrocyte
namespace: cell
def: "An erythrocyte lacking a nucleus." [GOC:add, GOC:tfm]
synonym: "RBC" BROAD []
synonym: "red blood cell" BROAD []
is_a: CL:0000225 ! anucleate cell
is_a: CL:0000232 {is_inferred="true"} ! erythrocyte
intersection_of: CL:0000232 ! erythrocyte
intersection_of: bearer_of PATO:0001405 ! anucleate
relationship: develops_from CL:0002422 ! enucleated reticulocyte

[Term]
id: CL:0000596
name: sexual spore
namespace: cell
def: "A spore formed following meiosis. Sometimes following meiosis, prospores may undergo one or more rounds of mitosis before they are fully mature." [FAO:0000017, GOC:tfm, SGD:clt]
synonym: "meiotically-derived spore" EXACT []
xref: FAO:0000017
is_a: CL:0002369 ! fungal spore

[Term]
id: CL:0000597
name: microconidium
namespace: cell
def: "The smaller of two types of asexual spores formed by some fungi. An ovoid to pear-shaped asexual spore that contains very little cytoplasm and organelles, is uninucleate, and forms in vegetative hypae within a mycelium. Micronidia are extruded from the hyphal cell wall." [GOC:tfm, ISBN:0471940526, PMID:8357339, SGD:clt]
xref: FAO:0000028
is_a: CL:0002381 ! uninucleate conidium

[Term]
id: CL:0000598
name: pyramidal neuron
namespace: cell
def: "Pyramidal neurons have a pyramid-shaped soma with a single axon, a large apical dendrite and multiple basal dendrites. The apex and an apical dendrite typically point toward the pial surface and other dendrites and an axon emerging from the base. The axons may have local collaterals but also project outside their region. Pyramidal neurons are found in the cerebral cortex, the hippocampus, and the amygdala." [GOC:tfm, MESH:A08.186.211.577.405.700]
subset: BDS_subset
synonym: "projection neuron" EXACT []
synonym: "pyramidal cell" EXACT []
synonym: "pyramidal neuron" EXACT []
xref: BTO:0003102
xref: FMA:67310
xref: FMA:86775
xref: NIFSTD:sao862606388
is_a: CL:0000104 ! multipolar neuron
intersection_of: CL:0000540 ! neuron
intersection_of: bearer_of PATO:0070015 ! pyramidal family morphology
relationship: bearer_of PATO:0070015 ! pyramidal family morphology

[Term]
id: CL:0000599
name: conidium
namespace: cell
def: "An asexual, nonmotile spore formed by higher fungi; conidia are usually made from the side or tip of specialized sporogenous cells and do not form by progressive cleavage of the cytoplasm." [ISBN:08199377X, PMID:2524423, PMID:9529886, SGD:clt]
xref: BTO:0000283
xref: FAO:0000024
is_a: CL:0000605 ! fungal asexual spore

[Term]
id: CL:0000600
name: heterokaryon
namespace: cell
def: "A fungal cell with two or more genetically distinct nuclei." [ISBN:08199377X]
is_a: CL:0000228 ! multinucleate cell
is_a: CL:0000521 ! fungal cell

[Term]
id: CL:0000601
name: cochlear outer hair cell
namespace: cell
def: "A mechanoreceptor in the organ of Corti. In mammals the outer hair cells are arranged in three rows which are further from the modiolus than the single row of inner hair cells. The motile properties of the outer hair cells may contribute actively to tuning the sensitivity and frequency selectivity of the cochlea." [MESH:A08.663.650.250.315]
xref: BTO:0003666
xref: FMA:62366
is_a: CL:4023120 ! cochlea auditory hair cell

[Term]
id: CL:0000602
name: pressoreceptor cell
namespace: cell
def: "A receptor in the vascular system, particularly the aorta and carotid sinus, which is sensitive to stretch of the vessel walls." [MESH:A08.800.050.800.900.700]
is_a: CL:1000082 ! stretch receptor cell

[Term]
id: CL:0000603
name: dikaryon
namespace: cell
def: "A fungal cell with two genetically distinct haploid nuclei." [ISBN:08199377X]
is_a: CL:0000227 ! binucleate cell
is_a: CL:0000600 ! heterokaryon

[Term]
id: CL:0000604
name: retinal rod cell
namespace: cell
def: "One of the two photoreceptor cell types of the vertebrate retina. In rods the photopigment is in stacks of membranous disks separate from the outer cell membrane. Rods are more sensitive to light than cones, but rod mediated vision has less spatial and temporal resolution than cone vision." [MESH:A08.663.650.650.670.650]
xref: BTO:0001024
xref: CALOHA:TS-0870
xref: FMA:67747
is_a: CL:0010009 ! camera-type eye photoreceptor cell
relationship: develops_from CL:0002672 ! retinal progenitor cell

[Term]
id: CL:0000605
name: fungal asexual spore
namespace: cell
def: "A spore formed following mitosis or mitoses." [GOC:tfm, PMID:2524423, PMID:9529886, SGD:clt]
xref: FAO:0000023
is_a: CL:0002369 ! fungal spore

[Term]
id: CL:0000606
name: macroconidium
namespace: cell
def: "The larger of two types of asexual spores formed by some fungi; usually round or oblong." [GOC:tfm, ISBN:0471940526, SGD:clt]
xref: FAO:0000038
is_a: CL:0000599 ! conidium

[Term]
id: CL:0000607
name: ascospore
namespace: cell
def: "A thick walled spore that stores and protects one or more nuclei following sexual reproduction in an Ascomycete." [GOC:tfm, ISBN:08199377X, SGD:clt]
xref: BTO:0000097
xref: FAO:0000020
is_a: CL:0000596 ! sexual spore

[Term]
id: CL:0000608
name: zygospore
namespace: cell
def: "A thick walled, sexual, resting spore formed by Zygomycetes; sometimes refers to the spore and the multi-layered cell wall that encloses the spore, the zygosporangium." [ISBN:0471940526, ISBN:08199377X, SGD:clt]
xref: FAO:0000040
is_a: CL:0000596 ! sexual spore

[Term]
id: CL:0000609
name: vestibular hair cell
namespace: cell
def: "A mechanoreceptor located in the acoustic maculae and the semicircular canals that mediates the sense of balance, movement, and head position. The vestibular hair cells are connected to accessory structures in such a way that movements of the head displace their stereocilia. This influences the membrane potential of the cells which relay information about movements via the vestibular part of the vestibulocochlear nerve to the brain stem." [GOC:tfm, MESH:A08.663.650.250.380]
synonym: "vestibular receptor cell" EXACT []
xref: FMA:62351
is_a: CL:0002374 ! ear hair cell

[Term]
id: CL:0000610
name: obsolete plant cell
namespace: cell
comment: This term was obsoleted as it is redundant with PO:0009002 in the cell ontology (PO)
is_obsolete: true
consider: PO:0009002

[Term]
id: CL:0000611
name: eosinophil progenitor cell
namespace: cell
comment: These cells are CD34-positive, CD45RA-negative, CD71-negative, and lineage-negative (CD2, CD3 epsilon, CD4, CD5, CD8a, CD14, CD19, CD20, integrin alpha-M, NCAM-1, SCA-1, Ly6G, Ly76).
synonym: "CFU-Eo" RELATED []
synonym: "colony forming unit eosinophil" RELATED []
synonym: "EoP" EXACT [PMCID:PMC2212039, PMCID:PMC2626675]
synonym: "eosinophil stem cell" RELATED []
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell
intersection_of: CL:0002191 ! granulocytopoietic cell
intersection_of: capable_of GO:0030222 ! eosinophil differentiation
intersection_of: has_part PR:000001944 ! transcription factor PU.1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000007857 ! erythroid transcription factor
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
intersection_of: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain
intersection_of: RO:0002104 PR:000001867 ! has plasma membrane part interleukin-5 receptor subunit alpha
intersection_of: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor
relationship: capable_of GO:0030222 ! eosinophil differentiation
relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell
relationship: has_part PR:000001944 ! transcription factor PU.1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain
relationship: RO:0002104 PR:000001867 ! has plasma membrane part interleukin-5 receptor subunit alpha
relationship: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor

[Term]
id: CL:0000612
name: eosinophilic myelocyte
namespace: cell
def: "A eosinophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte;in this stage, production of primary granules is complete and eosinophil-specific granules has started. No nucleolus is present. These cells are integrin alpha-M-positive, CD13-positive, CD15-positive, CD16-negative, CD24-positive, and CD33-positive." [GOC:add, GOC:dsd, http://www.cap.org, ISBN:0721601464, PMID:19622087]
xref: BTO:0003454
xref: FMA:83542
is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil
is_a: CL:0002087 ! nongranular leukocyte
is_a: CL:0002193 ! myelocyte
intersection_of: CL:0000772 ! immature eosinophil
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: lacks_part GO:0070820 ! tertiary granule
intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: has_part GO:0042582 ! azurophil granule
relationship: lacks_part GO:0070820 ! tertiary granule
relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000613
name: basophil progenitor cell
namespace: cell
def: "A progenitor cell committed to the basophil lineage. This cell lacks hematopoietic lineage markers (lin-negative) and is CD34-positive, T1/ST2-low, CD117-negative, and FceRIa-high. This cell also expresses Gata-1, Gata-2 and C/EBPa." [GOC:add, GOC:dsd, http://www.copewithcytokines.de, PMCID:PMC1312421]
comment: BaP are also CD13-low and integrin beta-7-low. They are lin-negative (CD2, CD3e, CD4, CD5, CD8, CD11b, CD14, CD19, CD20, ly6g, ly76, and NCAM-1). They also lack expression of mast cell protease 1 (MCP-1) and microphthalmia-associated transcription factor (mitf).
synonym: "BaP" EXACT []
synonym: "basophilic stem cell" RELATED []
synonym: "CFU-Bas" RELATED []
synonym: "colony forming unit basophil" RELATED []
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell
intersection_of: CL:0002191 ! granulocytopoietic cell
intersection_of: capable_of GO:0030221 ! basophil differentiation
intersection_of: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
intersection_of: has_low_plasma_membrane_amount PR:000016401 ! transmembrane emp24 domain-containing protein 1
intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: has_part PR:000007857 ! erythroid transcription factor
intersection_of: has_part PR:000007858 ! endothelial transcription factor GATA-2
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: capable_of GO:0030221 ! basophil differentiation
relationship: develops_from CL:0002028 ! basophil mast progenitor cell
relationship: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
relationship: has_low_plasma_membrane_amount PR:000016401 ! transmembrane emp24 domain-containing protein 1
relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)

[Term]
id: CL:0000614
name: basophilic myelocyte
namespace: cell
def: "A basophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte; in this stage, production of primary granules is complete and basophil-specific granules has started. No nucleolus is present. Markers are being integrin alpha-M-positive, fucosyltransferase FUT4-positive, CD33-positive, CD24-positive, aminopeptidase N-positive." [GOC:add, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:18466030]
xref: BTO:0003456
xref: FMA:83543
is_a: CL:0000768 {is_inferred="true"} ! immature basophil
is_a: CL:0002087 ! nongranular leukocyte
intersection_of: CL:0000768 ! immature basophil
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: lacks_part GO:0005730 ! nucleolus
intersection_of: lacks_part GO:0070820 ! tertiary granule
intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: has_part GO:0042582 ! azurophil granule
relationship: lacks_part GO:0005730 ! nucleolus
relationship: lacks_part GO:0070820 ! tertiary granule
relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000615
name: basidiospore
namespace: cell
def: "A thick walled spore containing one or more haploid nuclei produced by sexual reproduction in an Basidiomycete; formed externally on extrusions of the basidium." [GOC:clt, ISBN:0471940526, ISBN:08199377X]
xref: BTO:0002166
xref: FAO:0000021
is_a: CL:0000596 ! sexual spore

[Term]
id: CL:0000616
name: obsolete sporangiospore
namespace: cell
def: "OBSOLETE: A walled spore produced in a sporangium." [ISBN:08199377X]
is_obsolete: true

[Term]
id: CL:0000617
name: GABAergic neuron
namespace: cell
def: "A neuron that uses GABA as a vesicular neurotransmitter" [GOC:tfm]
synonym: "GABA-ergic neuron" EXACT []
xref: FMA:84788
xref: WBbt:0005190
is_a: CL:0000161 ! acid secreting cell
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission
relationship: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission

[Term]
id: CL:0000618
name: sheath cell
namespace: cell
is_a: CL:0000075 ! columnar/cuboidal epithelial cell

[Term]
id: CL:0000619
name: supporting cell (sensu Nematoda)
namespace: cell
synonym: "support cell (sensu Nematoda)" EXACT []
is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000620
name: obsolete zoospore
namespace: cell
def: "OBSOLETE: A sporangiospore that is motile, having flagella." [ISBN:08199377X]
xref: FAO:0000039
is_obsolete: true

[Term]
id: CL:0000621
name: fusion competent myoblast
namespace: cell
def: "A myoblast that is committed to a myotube-specific program of differentiation but not yet fused. It undergoes very limited additional proliferation. After fusion, it will take on a muscle identity specified by a `muscle founder cell` (CL:0008006)." [PMID:22274696]
is_a: CL:0008018 ! somatic muscle myoblast

[Term]
id: CL:0000622
name: acinar cell
namespace: cell
def: "A secretory cell that is grouped together with other cells of the same type to form grape shaped clusters known as acini (singular acinus)." [GOC:tfm, http://www.copewithcytokines.de]
synonym: "acinic cell" EXACT []
synonym: "acinous cell" EXACT []
xref: FMA:83625
is_a: CL:0000150 ! glandular epithelial cell
is_a: CL:0000154 ! protein secreting cell
relationship: part_of UBERON:0009842 ! glandular acinus

[Term]
id: CL:0000623
name: natural killer cell
namespace: cell
def: "A lymphocyte that can spontaneously kill a variety of target cells without prior antigenic activation via germline encoded activation receptors and also regulate immune responses via cytokine release and direct contact with other cells." [GOC:add, ISBN:0781735149, PMID:15771571]
synonym: "large granular lymphocyte" BROAD []
synonym: "NK cell" EXACT []
synonym: "null cell" BROAD []
xref: BTO:0000914
xref: BTO:0004716
xref: CALOHA:TS-0664
xref: FMA:63147
xref: FMA:83601
xref: VHOG:0001697
is_a: CL:0001067 ! group 1 innate lymphoid cell
intersection_of: CL:0001067 ! group 1 innate lymphoid cell
intersection_of: capable_of GO:0002228 ! natural killer cell mediated immunity
intersection_of: capable_of GO:0050776 ! regulation of immune response
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: capable_of GO:0002228 ! natural killer cell mediated immunity
relationship: capable_of GO:0050776 ! regulation of immune response
relationship: develops_from CL:0000825 ! pro-NK cell
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule

[Term]
id: CL:0000624
name: CD4-positive, alpha-beta T cell
namespace: cell
def: "A mature alpha-beta T cell that expresses an alpha-beta T cell receptor and the CD4 coreceptor." [GOC:add, ISBN:0781735149]
synonym: "CD4-positive, alpha-beta T lymphocyte" EXACT []
synonym: "CD4-positive, alpha-beta T-cell" EXACT []
synonym: "CD4-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell
intersection_of: CL:0000791 ! mature alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
disjoint_from: CL:0000625 ! CD8-positive, alpha-beta T cell
relationship: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8
relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule

[Term]
id: CL:0000625
name: CD8-positive, alpha-beta T cell
namespace: cell
def: "A T cell expressing an alpha-beta T cell receptor and the CD8 coreceptor." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD8-positive, alpha-beta T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta T-cell" EXACT []
synonym: "CD8-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell
intersection_of: CL:0000791 ! mature alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8

[Term]
id: CL:0000626
name: olfactory granule cell
namespace: cell
def: "Granule cell that is part of the olfactory bulb." [GOC:mah]
is_a: CL:0000120 ! granule cell
is_a: CL:0012001 ! neuron of the forebrain
intersection_of: CL:0000120 ! granule cell
intersection_of: RO:0002100 UBERON:0002264 ! has soma location olfactory bulb
relationship: RO:0002100 UBERON:0002264 ! has soma location olfactory bulb

[Term]
id: CL:0000627
name: transporting cell
namespace: cell
def: "A cell involved in transporting nutrients, minerals, water, gases and other chemicals between cells for a variety of purposes including conveying nutrition to other tissues, removing waste products from the tissues, conveying gases for respiration, distributing heat and repelling invasion of foreign substances." [TAIR:sr]
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000628
name: photosynthetic cell
namespace: cell
def: "A cell that can perform photosynthesis, in which carbohydrates are synthesized from carbon dioxide and water, using light as the energy source." [TAIR:sr]
comment: see PMID:21177950, The making of a photosynthetic animal.
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
relationship: capable_of GO:0015979 ! photosynthesis

[Term]
id: CL:0000629
name: storage cell
namespace: cell
def: "A cell that is specialized to store a particular substance(s), which is(are) later released from the store for a particular purpose." [FB:ma]
is_a: CL:0000325 ! stuff accumulating cell

[Term]
id: CL:0000630
name: supporting cell
namespace: cell
def: "A cell whose primary function is to support other cell types." [FB:ma, GOC:tfm]
synonym: "supportive cell" EXACT []
xref: BTO:0002315
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000631
name: labyrinth supporting cell
namespace: cell
def: "Cells forming a framework supporting the organ of Corti. Specific cells are those of Claudius, Deiters and Hensen." [MESH:A09.246.631.246.577.543]
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000632
name: hepatic stellate cell
namespace: cell
def: "A cell that is found in the perisinusoidal space of the liver that is capable of multiple roles including storage of retinol, presentation of antigen to T cells (including CD1d-restricted NKT cells), and upon activation, production of extracellular matrix components that can contribute to liver fibrosis. This activated state has a myofibroblast-like phenotype, though it's not clear in the literature if this is terminally differentiated. This cell type comprises approximately 8-15% of total cells in the liver." [GOC:dsd, http://en.wikipedia.org/wiki/Hepatic_stellate_cell, MESH:D055166, PMID:12808230, PMID:17239632, PMID:18222966, PMID:9302568]
comment: Hepatic stellate cells are CD271-positive, desmin-positive, DDR-2-positive, GFAP-positive, synamin-positive, synaptophysin-positive, vimentin-positive, They are capable of producing angiotensin II, fibronectin, laminin, MMP-1, MMP-2, MMP-3, MMP-9, MMP-11, TGF-beta1, TIMP-1, TIMP-2, type I collagen, type III collagen, type IV collagen, and type VI collagen.
synonym: "fat-storing cell" RELATED []
synonym: "hepatic perisinusoidal cell" EXACT []
synonym: "Ito cell" EXACT []
synonym: "lipocyte" RELATED []
synonym: "perisinusoidal cell" EXACT []
synonym: "vitamin A-storing cells" RELATED [PMID:12808230]
xref: BTO:0002741
xref: CALOHA:TS-0452
xref: FMA:67763
is_a: CARO:0000006
is_a: CL:0000057 ! fibroblast
is_a: CL:0000327 ! extracellular matrix secreting cell
intersection_of: CL:0002320 ! connective tissue cell
intersection_of: part_of UBERON:0002107 ! liver
intersection_of: RO:0002104 PR:000007939 ! has plasma membrane part glial fibrillary acidic protein
relationship: part_of UBERON:0002107 ! liver
relationship: RO:0002104 PR:000007939 ! has plasma membrane part glial fibrillary acidic protein

[Term]
id: CL:0000633
name: Hensen cell
namespace: cell
def: "A tall supporting cell that is arranged in rows adjacent to the last row of outer phalangeal cells. This cell type constitutes the outer border of the organ of Corti." [GOC:tfm, ISBN:0721662544]
synonym: "cell of Hensen" EXACT []
synonym: "external limiting cell of organ of Corti" EXACT []
synonym: "Hensen's cell" EXACT []
xref: FMA:79799
is_a: CL:0002490 ! organ of Corti supporting cell

[Term]
id: CL:0000634
name: Claudius cell
namespace: cell
def: "A cuboidal cell which along with Boettcher's cells form the floor of the external spiral sulcus, external to the organ of Corti." [GOC:tfm, ISBN:0721662544]
synonym: "cell of Claudius" EXACT []
synonym: "external supporting cell of Claudius" RELATED []
synonym: "external supporting cell of vestibular epithelium" EXACT []
xref: FMA:79802
is_a: CL:0002315 ! supporting cell of cochlea

[Term]
id: CL:0000635
name: Deiter's cell
namespace: cell
def: "The outer phalangeal cells of the organ of Corti. This cell holds the base of the hair cell in a cup-shaped depression." [GOC:tfm, http://www.britannica.com/EBchecked/topic/156177/Deiters-cell, ISBN:0721662544]
synonym: "Deiters cell" EXACT []
synonym: "outer phalangeal cell" EXACT []
xref: FMA:75725
is_a: CL:0002165 ! phalangeal cell

[Term]
id: CL:0000636
name: Mueller cell
namespace: cell
def: "Astrocyte-like radial glial cell that extends vertically throughout the retina, with the nucleus are usually in the middle of the inner nuclear layer." [GOC:NV, PMID:21911394]
synonym: "Muller glia" EXACT []
synonym: "Müller cell" EXACT []
xref: BTO:0003064
is_a: CL:0000681 ! radial glial cell
is_a: CL:0009004 ! retinal cell
relationship: part_of UBERON:0000966 ! retina

[Term]
id: CL:0000637
name: chromophil cell of anterior pituitary gland
namespace: cell
def: "A cell that stains readily in the anterior pituitary gland." [GOC:tfm, ISBN:0618947256]
xref: FMA:83089
is_a: CL:0000150 ! glandular epithelial cell
is_a: CL:0000166 ! chromaffin cell
is_a: CL:0000167 ! peptide hormone secreting cell
is_a: CL:0002319 ! neural cell
is_a: CL:2000004 ! pituitary gland cell
intersection_of: CL:0000166 ! chromaffin cell
intersection_of: part_of UBERON:0002196 ! adenohypophysis
relationship: part_of UBERON:0002196 ! adenohypophysis

[Term]
id: CL:0000638
name: acidophil cell of pars distalis of adenohypophysis
namespace: cell
def: "An acidophilic chromophil cell that of the anterior pituitary gland." [GOC:tfm]
synonym: "acidophil cell of pars anterior of adenohypophysis" EXACT []
synonym: "acidophil of pars anterior of adenohypophysis" EXACT []
synonym: "acidophil of pars distalis of adenohypophysis" EXACT []
synonym: "pituitary alpha cell" EXACT []
xref: FMA:83093
is_a: CL:0000637 ! chromophil cell of anterior pituitary gland
relationship: part_of UBERON:0006964 ! pars distalis of adenohypophysis

[Term]
id: CL:0000639
name: basophil cell of pars distalis of adenohypophysis
namespace: cell
def: "A basophillic chromophil cell that of the anterior pituitary gland." [GOC:tfm]
synonym: "basophil cell of anterior lobe of hypophysis" EXACT []
synonym: "beta cell" RELATED []
synonym: "pituitary beta cell" RELATED []
xref: FMA:83094
is_a: CL:0000637 ! chromophil cell of anterior pituitary gland

[Term]
id: CL:0000641
name: chromophobe cell
namespace: cell
def: "A cell that is resistant to stains." [GOC:tfm]
synonym: "chromophobic cell" EXACT []
xref: FMA:83626
is_a: CL:0000163 ! endocrine cell

[Term]
id: CL:0000642
name: folliculostellate cell
namespace: cell
def: "A supportive cell of the vertebrate pituitary that provides macromolecular transport and secretes hormones." [JB:jb]
is_a: CL:0000163 ! endocrine cell
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000644
name: Bergmann glial cell
namespace: cell
def: "Type of radial astrocyte in the cerebellar cortex that have their cell bodies in the Purkinje cell layer and processes that extend into the molecular layer, terminating with bulbous endfeet at the pial surface. Bergmann glia express high densities of glutamate transporters that limit diffusion of the neurotransmitter glutamate during its release from synaptic terminals. Besides their role in early development of the cerebellum, Bergmann glia are also required for the pruning or addition of synapses." [GOC:tfm, http://www.neurolex.org/wiki/Category\:Bergmann_Glial_Cell]
synonym: "Bergmann astrocyte" EXACT []
synonym: "Bergmann glial cell of cerebellum" EXACT []
xref: FMA:54559
is_a: CL:0000127 ! astrocyte

[Term]
id: CL:0000645
name: pituicyte
namespace: cell
def: "A cell with long processes running parallel to adjacent axons in the proximal infundibulum of the neurohypophysis. These processes form a three-dimensional network among the axons of the hypothalamic neurosecretory cells and are connected by gap junctions which provide for their metabolic coupling. This cell type constitutes most of the nonexcitable tissue in the neurohypophsis; function may include possibly acting as an intermediate in the modulation of oxytocin and vasopressin release. This cell type is highly variable in size and shape and commonly contain lipid droplets and deposits of lipochrome pigment." [http://en.wikipedia.org/wiki/Pituicyte, ISBN:0412046911, ISBN:0517223651]
xref: BTO:0003793
xref: FMA:83503
is_a: CL:0000127 ! astrocyte

[Term]
id: CL:0000646
name: basal cell
namespace: cell
def: "Undifferentiated; mitotic stem cell for other epithelial cell types; rounded or elliptical with little cytoplasm and few organelles; contain cytokeratin intermediate filament." [GOC:tfm, ISBN:0517223651]
xref: BTO:0000939
xref: FMA:62516
is_a: CL:0000036 ! epithelial fate stem cell

[Term]
id: CL:0000647
name: multinucleated giant cell
namespace: cell
def: "A phagocytic cell formed by the fusion of macrophages, occurs in chronic inflammatory responses to persistent microorganism such as M.tuberculosis, component of granulomas. Sometimes used to refer to megakaryocytes." [GOC:add, GOC:tfm, ISBN:0702022918, ISBN:0702024783]
comment: Role or process: Chronic infection, granulomatous inflammation. Consider also megakaryocyte (CL:0000556) as sometimes multinucleated giant cell is used to refer to this.
synonym: "foreign body giant cell" EXACT [ISBN:0702022918, ISBN:0702024783]
synonym: "Langerhans giant cell" EXACT [ISBN:0702022918, ISBN:0702024783]
synonym: "macrophage polykaryon" EXACT [ISBN:0702022918, ISBN:0702024783]
synonym: "multinucleate giant cell" EXACT [ISBN:0702022918, ISBN:0702024783]
synonym: "syncytial giant cell" EXACT [ISBN:0702022918, ISBN:0702024783]
xref: BTO:0003107
xref: FMA:83035
is_a: CL:0000228 ! multinucleate cell
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: bearer_of PATO:0001908 ! multinucleate
intersection_of: participates_in GO:0002432 ! granuloma formation
intersection_of: participates_in GO:0002544 ! chronic inflammatory response
relationship: develops_from CL:0000235 ! macrophage
relationship: participates_in GO:0002432 ! granuloma formation
relationship: participates_in GO:0002544 ! chronic inflammatory response

[Term]
id: CL:0000648
name: kidney granular cell
namespace: cell
alt_id: CL:0000461
def: "A smooth muscle cell that synthesizes, stores, and secretes the enzyme renin. This cell type are located in the wall of the afferent arteriole at the entrance to the glomerulus. While having a different origin than other kidney smooth muscle cells, this cell type expresses smooth muscle actin upon maturation." [GOC:cvs, GOC:tfm, PMID:11457727]
synonym: "JG cell" EXACT []
synonym: "juxtaglomerular cell" BROAD []
synonym: "renin secreting cell" EXACT []
xref: FMA:84138
is_a: CL:0000154 ! protein secreting cell
is_a: CL:0000192 ! smooth muscle cell
is_a: CL:1000618 ! juxtaglomerular complex cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0002001 ! renin secretion into blood stream
intersection_of: part_of UBERON:0002113 ! kidney
relationship: capable_of GO:0002001 ! renin secretion into blood stream

[Term]
id: CL:0000649
name: prickle cell
namespace: cell
alt_id: CL:0002186
def: "A cell with delicate radiating processes known as desmosomes that form intercellular bridges between other cells of this type. This cell type forms the stratum spinosum (prickle cell layer). A function of this cell is to generate keratin." [GOC:tfm, ISBN:0721662544, ISBN:0815332181]
synonym: "prickle cell of epidermis" EXACT []
xref: FMA:69059
is_a: CL:0000312 ! keratinocyte
relationship: part_of UBERON:0002026 ! stratum spinosum of epidermis

[Term]
id: CL:0000650
name: mesangial cell
namespace: cell
def: "A cell type that encapsulates the capillaries and venules in the kidney. This cell secretes mesangial matrix that provides the structural support for the capillaries." [GOC:tfm, http://www.copewithcytokines.de/cope.cgi?key=mesangial%20cells]
comment: Do all of these cells really develop from some mesenchymal stem cell?
synonym: "kidney mesangial cell" EXACT []
xref: BTO:0000853
xref: CALOHA:TS-0617
xref: FMA:70972
is_a: CARO:0000000
is_a: CL:0000669 ! pericyte cell
relationship: develops_from CL:0000134 ! mesenchymal stem cell

[Term]
id: CL:0000651
name: mucous neck cell
namespace: cell
def: "A mucus-secreting cell, with numerous apical secretory vesicles containing mucins; nucleus are basally displaced; numerous at the neck of mucus secreting glands" [GOC:tfm]
synonym: "neck cell" BROAD []
is_a: CL:0000150 ! glandular epithelial cell
is_a: CL:0000319 ! mucus secreting cell

[Term]
id: CL:0000652
name: pinealocyte
namespace: cell
def: "This cell type produces and secretes melatonin and forms the pineal parenchyma. Extending from each cell body, which has a spherical, oval or lobulated mucleus, are one or more tortuous basophilic processes, containing parallel microtubules known as synaptic ribbons. These processes end in expanded terminal buds near capillaries or less, frequently, ependymal cells of the pineal recess. The terminal buds contain granular endoplasmic reticulum, mitochondria and electron-dense cored vesicles, which store monoamines and polypeptide hormones, release of which appears to require sympathetic innervation." [GOC:tfm, http://en.wikipedia.org/wiki/Pinealocyte, ISBN:0517223651, PMID:16687276]
xref: BTO:0001068
xref: FMA:83417
is_a: CL:0000163 ! endocrine cell
is_a: CL:0000710 ! neurecto-epithelial cell
is_a: CL:0002319 ! neural cell
relationship: capable_of GO:0030187 ! melatonin biosynthetic process
relationship: part_of UBERON:0001905 ! pineal body

[Term]
id: CL:0000653
name: glomerular visceral epithelial cell
namespace: cell
def: "A glomerular visceral epithelial cell is a specialized kidney epithelial cell that contains \"feet\" that interdigitate with the \"feet\" of other glomerular epithelial cells." [GOC:tfm]
comment: GO has podocyte as a related synonym due to concern this may refer to more than one cell type. However, this did not turn up in my search. If podocyte does refer to more than one cell type, then we should classify the synonym to 'related'[tfm].
synonym: "epithelial cell of visceral layer of glomerular capsule" BROAD [FMA:70967]
synonym: "glomerular podocyte" EXACT [FMA:70967]
synonym: "podocyte" EXACT []
xref: BTO:0002295
xref: FMA:70967
is_a: CL:0002522 ! renal filtration cell
is_a: CL:1000450 ! epithelial cell of glomerular capsule
relationship: part_of UBERON:0005751 ! visceral layer of glomerular capsule

[Term]
id: CL:0000654
name: primary oocyte
namespace: cell
def: "A primary oocyte is an oocyte that has not completed female meosis I." [GOC:tfm, ISBN:0721662544]
synonym: "primary oogonium" RELATED []
xref: BTO:0000512
xref: FMA:18645
is_a: CARO:0000000
is_a: CL:0000023 {is_inferred="true"} ! oocyte
intersection_of: CL:0000023 ! oocyte
intersection_of: has_not_completed GO:0051321 ! meiotic cell cycle
relationship: develops_from CL:0000024 ! oogonial cell
relationship: has_not_completed GO:0051321 ! meiotic cell cycle

[Term]
id: CL:0000655
name: secondary oocyte
namespace: cell
def: "A secondary oocyte is an oocyte that has not completed meiosis II." [GOC:tfm, ISBN:0721662544]
synonym: "primary oogonium" RELATED []
xref: BTO:0003094
xref: FMA:18646
is_a: CARO:0000000
is_a: CL:0000023 {is_inferred="true"} ! oocyte
intersection_of: CL:0000023 ! oocyte
intersection_of: has_not_completed GO:0007147 ! female meiosis II
relationship: develops_from CL:0000654 ! primary oocyte
relationship: has_not_completed GO:0007147 ! female meiosis II

[Term]
id: CL:0000656
name: primary spermatocyte
namespace: cell
def: "A diploid cell that has derived from a spermatogonium and can subsequently begin meiosis and divide into two haploid secondary spermatocytes." [GOC:tfm, ISBN:0721662544]
xref: BTO:0001115
xref: CALOHA:TS-2194
xref: FMA:72292
is_a: CL:0000017 {is_inferred="true"} ! spermatocyte
intersection_of: CL:0000017 ! spermatocyte
intersection_of: bearer_of PATO:0001394 ! diploid
intersection_of: capable_of GO:0007140 ! male meiotic nuclear division
relationship: bearer_of PATO:0001394 ! diploid
relationship: capable_of GO:0007140 ! male meiotic nuclear division

[Term]
id: CL:0000657
name: secondary spermatocyte
namespace: cell
def: "One of the two haploid cells into which a primary spermatocyte divides, and which in turn gives origin to spermatids." [GOC:tfm, ISBN:0721662544]
xref: BTO:0000709
xref: CALOHA:TS-2195
xref: FBbt:00004941
xref: FMA:72293
is_a: CL:0000017 {is_inferred="true"} ! spermatocyte
is_a: CL:0000413 ! haploid cell
intersection_of: CL:0000017 ! spermatocyte
intersection_of: bearer_of PATO:0001375 ! haploid
intersection_of: capable_of GO:0007142 ! male meiosis II
relationship: capable_of GO:0007142 ! male meiosis II
relationship: develops_from CL:0000656 ! primary spermatocyte

[Term]
id: CL:0000658
name: cuticle secreting cell
namespace: cell
def: "An epithelial cell that secretes cuticle." [GOC:tfm]
is_a: CL:0000066 ! epithelial cell
is_a: CL:0000327 ! extracellular matrix secreting cell

[Term]
id: CL:0000659
name: eggshell secreting cell
namespace: cell
def: "An extracellular matrix secreting cell that secretes eggshell." [GOC:tfm]
is_a: CL:0000327 ! extracellular matrix secreting cell
is_a: CL:0000500 ! follicular epithelial cell

[Term]
id: CL:0000660
name: glycocalyx secreting cell
namespace: cell
def: "An extracellular matrix secreting cell that secretes glycocalyx." [GOC:tfm]
is_a: CL:0000327 ! extracellular matrix secreting cell

[Term]
id: CL:0000661
name: distal tip cell (sensu Nematoda)
namespace: cell
is_a: CL:0000422 ! mitogenic signaling cell

[Term]
id: CL:0000662
name: neuroglioblast (sensu Nematoda)
namespace: cell
is_a: CL:0000468 ! neuroglioblast (sensu Nematoda and Protostomia)

[Term]
id: CL:0000663
name: valve cell
namespace: cell
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000664
name: closable valve cell
namespace: cell
is_a: CL:0000185 ! myoepithelial cell
is_a: CL:0000663 ! valve cell

[Term]
id: CL:0000665
name: permanently open valve cell
namespace: cell
is_a: CL:0000663 ! valve cell

[Term]
id: CL:0000666
name: fenestrated cell
namespace: cell
synonym: "window cell" EXACT []
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000667
name: collagen secreting cell
namespace: cell
def: "An extracellular matrix secreting cell that secretes collagen." [GOC:tfm]
is_a: CL:0000327 ! extracellular matrix secreting cell

[Term]
id: CL:0000668
name: obsolete parenchymal cell
namespace: cell
def: "OBSOLETE: The cell characteristic of an organ, as distinguished from associated connective or supporting tissues." [ISBN:0471245208]
comment: OBSOLETE: Term was made obsolete to avoid confusion with plant parenchymal cell. Cell type has a similar but slightly different meaning in botany (plants): see PO:0000074.
xref: BTO:0002174
xref: FMA:84638
is_obsolete: true

[Term]
id: CL:0000669
name: pericyte cell
namespace: cell
alt_id: CL:0000184
def: "An elongated, contractile cell found wrapped about precapillary arterioles outside the basement membrane. Pericytes are present in capillaries where proper adventitia and muscle layer are missing (thus distingushing this cell type from adventitial cells). They are relatively undifferentiated and may become fibroblasts, macrophages, or smooth muscle cells." [GOC:dsd, GOC:tfm, ISBN:0721662544, MESH:D020286, PMID:16807374, PMID:17986482, PMID:20024907]
comment: Pericytes are CD10-positive, CD13-positive, CD31-negative, CD45-negative, CD106-positive, CD117-negative, CD140-positive, CD144-negative, CD146-positive, CD271-positive, CD325-positive, NG2-positive, RGS5-positive, SMA-positive, and desmin-positive. A subpopulation is CD248-positive. They are also capable of producing angiopoietin 1, CXCL12, TGF-beta, and VEGF-A.
synonym: "adventitial cell" RELATED []
synonym: "adventitial reticular cell" EXACT []
synonym: "ARC" EXACT [PMID:17986482]
synonym: "cell of Rouget" EXACT []
synonym: "pericyte" EXACT []
synonym: "pericyte of Rouget" EXACT []
xref: BTO:0002441
xref: FMA:63174
is_a: CL:0000183 ! contractile cell
is_a: CL:0000630 ! supporting cell
is_a: CL:0002320 ! connective tissue cell
is_a: CL:0008034 ! mural cell

[Term]
id: CL:0000670
name: primordial germ cell
namespace: cell
def: "A primordial germ cell is a diploid germ cell precursors that transiently exist in the embryo before they enter into close association with the somatic cells of the gonad and become irreversibly committed as germ cells." [GOC:tfm, PMID:1381289]
synonym: "gonocyte" EXACT []
synonym: "primitive germ cell" EXACT []
xref: FMA:70567
is_a: CL:0000039 {is_inferred="true"} ! germ line cell
is_a: CL:0000219 {is_inferred="true"} ! motile cell
intersection_of: CL:0000039 ! germ line cell
intersection_of: capable_of GO:0048870 ! cell motility
intersection_of: part_of UBERON:0000922 ! embryo
relationship: part_of UBERON:0000922 ! embryo

[Term]
id: CL:0000671
name: centripetally migrating follicle cell
namespace: cell
xref: FBbt:00004906
is_a: CL:0000477 ! ovarian follicle cell

[Term]
id: CL:0000672
name: obsolete tracheary element
namespace: cell
def: "Obsolete. Use PO:0000290 from Plant Ontology instead. A water conducting cell, tracheid or vessel member." [ISBN:0471245208]
comment: replaced_by: PO:0000290
is_obsolete: true

[Term]
id: CL:0000673
name: Kenyon cell
namespace: cell
is_a: CL:0000028 ! CNS neuron (sensu Nematoda and Protostomia)

[Term]
id: CL:0000674
name: interfollicle cell
namespace: cell
synonym: "fly stalk cell" EXACT []
xref: FBbt:00004910
is_a: CL:0000075 ! columnar/cuboidal epithelial cell

[Term]
id: CL:0000675
name: female gamete
namespace: cell
def: "A mature sexual reproductive cell of the female germline." [GOC:tfm]
is_a: CL:0000021 {is_inferred="true"} ! female germ cell
is_a: CL:0000300 ! gamete

[Term]
id: CL:0000676
name: cap cell
namespace: cell
xref: BTO:0001033
is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000677
name: gut absorptive cell
namespace: cell
def: "Cell of the intestinal epithelium with a brush border made up of many parallel packed microvilli; associated with absorption, particularly of macromolecules." [JB:jb]
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000212 ! absorptive cell
relationship: part_of UBERON:0001277 ! intestinal epithelium

[Term]
id: CL:0000678
name: commissural neuron
namespace: cell
is_a: CL:0000540 ! neuron

[Term]
id: CL:0000679
name: glutamatergic neuron
namespace: cell
xref: WBbt:0006829
is_a: CL:0000151 ! secretory cell
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0061535 ! glutamate secretion, neurotransmission
relationship: capable_of GO:0061535 ! glutamate secretion, neurotransmission

[Term]
id: CL:0000680
name: muscle precursor cell
namespace: cell
def: "A non-terminally differentiated cell that is capable of developing into a muscle cell." [GOC:add]
is_a: CARO:0000000
is_a: CL:0000055 ! non-terminally differentiated cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0011115 ! precursor cell
intersection_of: develops_into CL:0000187 ! muscle cell
relationship: develops_from CL:0000222 ! mesodermal cell
relationship: develops_into CL:0000187 ! muscle cell

[Term]
id: CL:0000681
name: radial glial cell
namespace: cell
def: "A cell present in the developing CNS. Functions as both a precursor cell and as a scaffold to support neuronal migration." [GOC:dph]
comment: Unlike that of mammals, the brain of adult teleost fish exhibits an intense and widespread neurogenic activity as a result of the persistence of\nradial glial cells acting as neural progenitors throughout life.
synonym: "forebrain radial glial cell" NARROW []
is_a: CL:0000125 ! glial cell
relationship: develops_from CL:0000710 ! neurecto-epithelial cell

[Term]
id: CL:0000682
name: M cell of gut
namespace: cell
def: "An absorptive cell of the gut epithelium that endocytoses microorganisms and intact macromolecules from the gut lumen and transports them to the subepithelial space where they are presented to antigen-presenting cells and lymphocytes." [GOC:jb, GOC:tfm]
comment: Should double check and see if M cells are particular to a specific region.
synonym: "M cell" BROAD []
synonym: "M-cell" EXACT []
synonym: "microfold cell" EXACT []
xref: BTO:0003600
xref: FMA:62929
is_a: CL:0000473 ! defensive cell
is_a: CL:0000627 ! transporting cell
is_a: CL:0002251 ! epithelial cell of alimentary canal
relationship: part_of UBERON:0003929 ! digestive tract epithelium

[Term]
id: CL:0000683
name: ependymoglial cell
namespace: cell
def: "A cell that transports hormones from neurosecretory cells. This nerve cell is characterized by bipolar shape and endfeet that contact a basal lamina around blood vessels, and/or the pia mater or vitreous body of the eye and additionally contact the ventricular surface or sub-retinal space." [http://neurolex.org/wiki/Category\:Ependymoglial_Cell, JB:jb]
synonym: "ependymal astrocyte" EXACT []
is_a: CL:0000127 ! astrocyte

[Term]
id: CL:0000684
name: littoral cell of liver
namespace: cell
is_a: CL:0000077 ! mesothelial cell
relationship: part_of UBERON:0002107 ! liver

[Term]
id: CL:0000685
name: obsolete meristematic cell
namespace: cell
def: "Obsolete. Use PO:0004010 from Plant Ontology instead. A cell synthesizing protoplasm and producing new cells by division and with only a primary cell wall." [PO:0004010]
comment: replaced_by: PO:0004010
is_obsolete: true

[Term]
id: CL:0000686
name: cerebrospinal fluid secreting cell
namespace: cell
def: "A columnar/cuboidal epithelial cell that secretes cerebrospinal fluid." [GOC:tfm]
is_a: CL:0000151 {is_inferred="true"} ! secretory cell
is_a: CL:0000710 ! neurecto-epithelial cell
intersection_of: CL:0000151 ! secretory cell
intersection_of: capable_of GO:0033326 ! cerebrospinal fluid secretion
relationship: capable_of GO:0033326 ! cerebrospinal fluid secretion
relationship: develops_from CL:0000333 ! migratory neural crest cell

[Term]
id: CL:0000687
name: R1 photoreceptor cell
namespace: cell
synonym: "R1 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000688
name: perijunctional fibroblast
namespace: cell
def: "A fibroblast-like cell that provides support at neuromuscular junctions in vertebrates and are localized outside the synaptic basal lamina." [JB:jb]
is_a: CL:0000057 ! fibroblast
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000689
name: myoendocrine cell
namespace: cell
def: "A cell with both myofibrils and secretory granules." [JB:jb]
is_a: CL:0000163 ! endocrine cell

[Term]
id: CL:0000690
name: R2 photoreceptor cell
namespace: cell
synonym: "R2 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000691
name: stellate interneuron
namespace: cell
subset: BDS_subset
is_a: CL:0000099 ! interneuron
is_a: CL:0000104 ! multipolar neuron
intersection_of: CL:0000099 ! interneuron
intersection_of: bearer_of PATO:0070010 ! stellate morphology
relationship: bearer_of PATO:0070010 ! stellate morphology

[Term]
id: CL:0000692
name: terminal Schwann cell
namespace: cell
def: "A neuroglial cell of the peripheral nervous system inside the basal lamina of the neuromuscular junction providing chemical and physical support to the synapse." [JB:jb, PMID:16136171]
synonym: "Schwann cell" BROAD []
is_a: CL:0000630 ! supporting cell
is_a: CL:0002376 ! non-myelinating Schwann cell

[Term]
id: CL:0000693
name: neurogliaform cell
namespace: cell
def: "An interneuron that has spider-like appearance with a small round soma, a large number (7-10) of short, smooth, or slightly beaded primary dendrites that give rise to only a few secondary branches, and a branched axon that establishes a dense axonal mesh with thin shafts." [JB:jb, PMID:17122314]
subset: BDS_subset
synonym: "neuroglioform cell" EXACT [PMID:3235828]
synonym: "NGF cell" EXACT [PMID:18568015]
synonym: "spiderweb cell" EXACT []
is_a: CL:0000099 ! interneuron
is_a: CL:0000104 ! multipolar neuron
intersection_of: CL:0000099 ! interneuron
intersection_of: bearer_of PATO:0070001 ! neurogliaform morphology
relationship: bearer_of PATO:0070001 ! neurogliaform morphology

[Term]
id: CL:0000694
name: R3 photoreceptor cell
namespace: cell
synonym: "R3 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000695
name: Cajal-Retzius cell
namespace: cell
def: "A neuron of the human embryonic marginal zone which display, as a salient feature, radial ascending processes that contact the pial surface, and a horizontal axon plexus located in the deep marginal zone. One feature of these cells in mammals is that they express the Reelin gene." [PMID:10600995, PMID:9728912]
comment: While previously called 'pioneer neurons' of the marginal zone, Cajal-Retzius cells are differentiated from pioneer neurons (which are Reln-negative) by their Reln-immunoreactivity. {xref="PMID:10600995"}
synonym: "CR cells" EXACT [WikipediaVersioned:Cajal–Retzius_cell&oldid=1032081753]
synonym: "Horizontal cells of Cajal" EXACT [WikipediaVersioned:Cajal–Retzius_cell&oldid=1032081753]
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)
is_a: CL:2000029 ! central nervous system neuron
relationship: bearer_of PATO:0070006 ! cortical bipolar morphology
relationship: RO:0002100 UBERON:0010403 ! has soma location brain marginal zone
property_value: dc-contributor https://orcid.org/0000-0001-7258-9596 xsd:string

[Term]
id: CL:0000696
name: PP cell
namespace: cell
def: "A cell that stores and secretes pancreatic polypeptide hormone." [GOC:tfm, JB:jb, PMID:15153415]
synonym: "type F enteroendocrine cell" EXACT []
xref: FMA:62938
xref: FMA:83409
is_a: CL:0000164 ! enteroendocrine cell
is_a: CL:0000167 ! peptide hormone secreting cell

[Term]
id: CL:0000697
name: R4 photoreceptor cell
namespace: cell
synonym: "R4 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000698
name: obsolete paraganglial cell
namespace: cell
is_obsolete: true

[Term]
id: CL:0000699
name: paraganglial type 1 cell
namespace: cell
def: "A type of glomus or chief cell, is sensitive to hypoxia and produce catecholamines." [GOC:tfm]
is_a: CL:0000165 ! neuroendocrine cell

[Term]
id: CL:0000700
name: dopaminergic neuron
namespace: cell
def: "A neuron that releases dopamine as a neurotransmitter." [GOC:dhill]
synonym: "dopaminergic cell" EXACT []
xref: BTO:0004032
xref: FMA:84787
xref: WBbt:0006746
is_a: CL:0000151 ! secretory cell
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0061527 ! dopamine secretion, neurotransmission
relationship: capable_of GO:0061527 ! dopamine secretion, neurotransmission

[Term]
id: CL:0000701
name: paraganglia type 2 cell
namespace: cell
def: "Supports paraganglial type 1 cell." [JB:jb]
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000702
name: R5 photoreceptor cell
namespace: cell
synonym: "R5 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000703
name: sustentacular cell
namespace: cell
def: "Cell that provides some or all mechanical, nutritional and phagocytic support to their neighbors." [JB:jb]
xref: BTO:0002315
is_a: CL:0000630 ! supporting cell

[Term]
id: CL:0000704
name: endothelial tip cell
namespace: cell
def: "A specialized endothelial cell that senses extracellular signals and guides the directed growth of blood vessels." [PMID:15376331]
is_a: CL:0000071 ! blood vessel endothelial cell

[Term]
id: CL:0000705
name: R6 photoreceptor cell
namespace: cell
synonym: "R6 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000706
name: choroid plexus epithelial cell
namespace: cell
alt_id: CL:1000430
def: "Specialized ependymal cell that produces the cerebrospinal fluid from the blood and secretes it into the lumen of the brain and spinal chord." [GOC:add, GOC:tfm, JB:jb, PMID:9550134]
synonym: "epithelial cell of choroid plexus" EXACT []
xref: FMA:70549
is_a: CL:0000065 ! ependymal cell
is_a: CL:0000627 ! transporting cell
is_a: CL:0002319 ! neural cell
intersection_of: CL:0000065 ! ependymal cell
intersection_of: part_of UBERON:0001886 ! choroid plexus
relationship: part_of UBERON:0001886 ! choroid plexus

[Term]
id: CL:0000707
name: R7 photoreceptor cell
namespace: cell
synonym: "R7 cell" EXACT []
is_a: CL:0000287 ! eye photoreceptor cell
is_a: CL:0000494 ! UV sensitive photoreceptor cell

[Term]
id: CL:0000708
name: leptomeningeal cell
namespace: cell
def: "Stromal cell that forms the internal covering of the vertebrate brain and produces ECM for this and the choroid plexus." [JB:jb]
synonym: "leptomemingeal cell" RELATED []
is_a: CL:0000327 {is_inferred="true"} ! extracellular matrix secreting cell
is_a: CL:0002319 ! neural cell
intersection_of: CL:0000327 ! extracellular matrix secreting cell
intersection_of: part_of UBERON:0003210 ! blood-cerebrospinal fluid barrier
relationship: part_of UBERON:0003210 ! blood-cerebrospinal fluid barrier

[Term]
id: CL:0000709
name: R8 photoreceptor cell
namespace: cell
synonym: "R8 cell" EXACT []
is_a: CL:0000488 ! visible light photoreceptor cell
is_a: CL:2000019 ! compound eye photoreceptor cell
relationship: part_of UBERON:0000971 ! ommatidium

[Term]
id: CL:0000710
name: neurecto-epithelial cell
namespace: cell
def: "Epithelial cells derived from neural plate and neural crest." [GOC:tfm]
comment: The term "neuroepithelial cell" is used to describe both this cell type and sensory epithelial cell (CL:0000098).
synonym: "neuroepithelial cell" BROAD []
xref: BTO:0004301
xref: FMA:70557
is_a: CL:0000075 ! columnar/cuboidal epithelial cell
is_a: CL:0002077 ! ecto-epithelial cell
intersection_of: CL:0002077 ! ecto-epithelial cell
intersection_of: develops_from CL:0000133 ! neurectodermal cell
relationship: develops_from CL:0000133 ! neurectodermal cell

[Term]
id: CL:0000711
name: cumulus cell
namespace: cell
def: "Cumulus cell is a specialized granulosa cell that surrounds and nourishes the oocyte. This cell-type surrounds the fully-grown oocyte to form a cumulus-oocyte complex (abbr. COC). The terms cumulus oophorus cells, cumulus granulosa cells, cumulus oophorous granulosa cells, granulosa-cumulus cells are used to make a distinction between this cell and the other functionally different subpopulation of granulosa cells at the wall of the Graafian follicle." [GOC:tfm, http://www.copewithcytokines.org/cope.cgi?key=cumulus%20cells]
xref: BTO:0002236
is_a: CL:0000154 ! protein secreting cell
is_a: CL:0002174 ! follicular cell of ovary
relationship: develops_from CL:0000501 ! granulosa cell

[Term]
id: CL:0000712
name: stratum granulosum cell
namespace: cell
is_a: CL:0000362 ! epidermal cell
intersection_of: CL:0000362 ! epidermal cell
intersection_of: part_of UBERON:0002069 ! stratum granulosum of epidermis
relationship: part_of UBERON:0002069 ! stratum granulosum of epidermis

[Term]
id: CL:0000713
name: corona radiata cell
namespace: cell
is_a: CL:0000711 ! cumulus cell

[Term]
id: CL:0000715
name: embryonic crystal cell
namespace: cell
is_a: CL:0000392 ! crystal cell
is_a: CL:0000736 ! embryonic gland hemocyte

[Term]
id: CL:0000716
name: lymph gland crystal cell
namespace: cell
is_a: CL:0000392 ! crystal cell
is_a: CL:0000735 ! lymph gland hemocyte

[Term]
id: CL:0000717
name: obsolete fusimotor neuron
namespace: cell
def: "OBSOLETE. A subset of motor neurons that innervates intrafusal muscle fibers and has small diameter axons." [PMID:15582775]
comment: Term merged into CL:0008037. Refer to https://github.com/obophenotype/cell-ontology/issues/1364
is_obsolete: true
replaced_by: CL:0008037

[Term]
id: CL:0000718
name: compound eye cone cell
namespace: cell
synonym: "cone cell (sensu Endopterygota)" RELATED []
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000306 ! crystallin accumulating cell
relationship: part_of UBERON:0000018 ! compound eye

[Term]
id: CL:0000719
name: posterior cone cell (sensu Endopterygota)
namespace: cell
is_a: CL:0000718 ! compound eye cone cell

[Term]
id: CL:0000720
name: anterior cone cell (sensu Endopterygota)
namespace: cell
is_a: CL:0000718 ! compound eye cone cell

[Term]
id: CL:0000721
name: equatorial cone cell (sensu Endopterygota)
namespace: cell
is_a: CL:0000718 ! compound eye cone cell

[Term]
id: CL:0000722
name: cystoblast
namespace: cell
is_a: CL:0000548 ! animal cell
is_a: CL:0000586 ! germ cell
relationship: only_in_taxon NCBITaxon:6656 ! Arthropoda

[Term]
id: CL:0000723
name: somatic stem cell
namespace: cell
def: "A stem cell that can give rise to cell types of the body other than those of the germ-line." [GO:0048103]
xref: CALOHA:TS-2086
xref: FMA:63368
is_a: CL:0000034 {is_inferred="true"} ! stem cell
is_a: CL:0002371 ! somatic cell
intersection_of: CL:0000034 ! stem cell
intersection_of: capable_of GO:0048103 ! somatic stem cell division
relationship: capable_of GO:0048103 ! somatic stem cell division

[Term]
id: CL:0000724
name: heterocyst
namespace: cell
def: "A differentiated cell that functions as a site of nitrogen fixation under aerobic conditions." [MA:ma]
xref: BTO:0000600
is_a: CL:0000520 ! prokaryotic cell
is_a: CL:0000725 ! nitrogen fixing cell

[Term]
id: CL:0000725
name: nitrogen fixing cell
namespace: cell
is_a: BFO:0000040 ! material entity
is_a: CL:0000003 ! native cell
intersection_of: CL:0000003 ! native cell
intersection_of: capable_of GO:0009399 ! nitrogen fixation
relationship: capable_of GO:0009399 ! nitrogen fixation

[Term]
id: CL:0000726
name: chlamydospore
namespace: cell
def: "An asexual 1-celled spore (primarily for perennation, not dissemination). Originates endogenously and singly within part of a pre-existing cell by the contraction of the protoplast. Possesses an inner secondary and often thickened hyaline or brown wall, usually impregnated with hydrophobic material." [GOC:tfm, ISBN:085199377X]
comment: Considering obsoleting as sometimes used to refer to protozoans too. But reference indicates term was intended for fungus.
is_a: CL:0000605 ! fungal asexual spore

[Term]
id: CL:0000727
name: primary pigment cell
namespace: cell
is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000728
name: secondary pigment cell
namespace: cell
is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000729
name: tertiary pigment cell
namespace: cell
is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia)

[Term]
id: CL:0000730
name: leading edge cell
namespace: cell
def: "A cell at the front of a migrating epithelial sheet." [MA:ma]
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000731
name: urothelial cell
namespace: cell
def: "A cell of a layer of transitional epithelium in the wall of the bladder, ureter, and renal pelvis, external to the lamina propria." [GOC:tfm, MA:ma]
synonym: "bladder transitional cell" NARROW []
synonym: "transitional epithelial cell of urinary bladder" NARROW []
synonym: "urinary tract transitional epithelial cell" NARROW []
xref: FMA:84127
is_a: CL:0000244 {is_inferred="true"} ! transitional epithelial cell
intersection_of: CL:0000244 ! transitional epithelial cell
intersection_of: part_of UBERON:0000365 ! urothelium
relationship: part_of UBERON:0000365 ! urothelium

[Term]
id: CL:0000732
name: amoeboid cell
namespace: cell
is_a: CL:0000219 ! motile cell

[Term]
id: CL:0000733
name: lymph gland plasmatocyte
namespace: cell
is_a: CL:0000394 ! plasmatocyte
is_a: CL:0000735 ! lymph gland hemocyte

[Term]
id: CL:0000734
name: embryonic gland plasmatocyte
namespace: cell
is_a: CL:0000394 ! plasmatocyte
is_a: CL:0000736 ! embryonic gland hemocyte

[Term]
id: CL:0000735
name: lymph gland hemocyte
namespace: cell
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)

[Term]
id: CL:0000736
name: embryonic gland hemocyte
namespace: cell
is_a: CL:0000387 ! hemocyte (sensu Arthropoda)

[Term]
id: CL:0000737
name: striated muscle cell
namespace: cell
def: "Muscle cell which has as its direct parts myofilaments organized into sarcomeres." [GOC:tfm, ISBN:0721662544]
xref: BTO:0002916
xref: CALOHA:TS-2157
xref: FMA:86936
is_a: CL:0000187 ! muscle cell
intersection_of: CL:0000187 ! muscle cell
intersection_of: bearer_of PATO:0001410 ! striated
intersection_of: has_part GO:0030017 ! sarcomere
disjoint_from: CL:0008000 ! non-striated muscle cell
relationship: bearer_of PATO:0001410 ! striated
relationship: has_part GO:0030017 ! sarcomere

[Term]
id: CL:0000738
name: leukocyte
namespace: cell
def: "An achromatic cell of the myeloid or lymphoid lineages capable of ameboid movement, found in blood or other tissue." [GOC:add, GOC:tfm, ISBN:978-0-323-05290-0]
synonym: "immune cell" EXACT []
synonym: "leucocyte" EXACT []
synonym: "white blood cell" EXACT []
xref: BTO:0000751
xref: CALOHA:TS-0549
xref: FMA:62852
is_a: CARO:0000000
is_a: CL:0000219 ! motile cell
is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell
is_a: CL:0002242 ! nucleate cell
intersection_of: CL:0000988 ! hematopoietic cell
intersection_of: bearer_of PATO:0002505 ! nucleated
intersection_of: capable_of GO:0001667 ! ameboidal-type cell migration
relationship: capable_of GO:0001667 ! ameboidal-type cell migration
relationship: develops_from CL:0000037 ! hematopoietic stem cell
relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata <vertebrates>
relationship: part_of UBERON:0002405 ! immune system

[Term]
id: CL:0000740
name: retinal ganglion cell
namespace: cell
def: "The set of neurons that receives neural inputs via bipolar, horizontal and amacrine cells. The axons of these cells make up the optic nerve." [GOC:dph]
synonym: "gangliocyte" EXACT []
synonym: "ganglion cell of retina" EXACT []
synonym: "RGC" EXACT []
xref: BTO:0001800
xref: FMA:67765
is_a: CL:0000117 ! CNS neuron (sensu Vertebrata)
relationship: RO:0002100 UBERON:0000966 ! has soma location retina

[Term]
id: CL:0000741
name: spinal accessory motor neuron
namespace: cell
def: "A motor neuron that is located in the cervical region of the spinal cord and selectively innervates the sternocleidmastoid or trapezius muscle. Unlike other motor neurons, they extend axons dorsally along lateral margins of the spinal cord." [PMID:16267219]
synonym: "SACMN" EXACT []
is_a: CL:0008039 ! lower motor neuron

[Term]
id: CL:0000742
name: periarticular chondrocyte
namespace: cell
def: "A round chondrocyte that first differentiates in the late embryonic growth plate of bone." [PMID:15951842]
is_a: CL:1001607 ! articular chondrocyte

[Term]
id: CL:0000743
name: hypertrophic chondrocyte
namespace: cell
def: "Chondrocyte that is terminally differentiated, produces type X collagen, is large in size, and often associated with the replacement of cartilage by bone (endochondral ossification)." [GO_REF:0000034, PMID:15951842]
comment: is hypertrophic pathological or normal? and can it be described using a pato term?
is_a: CL:0000138 ! chondrocyte

[Term]
id: CL:0000744
name: columnar chondrocyte
namespace: cell
def: "A columnar chondrocyte that differentiates in the late embryonic growth plate of bone. Columnar chondrocytes vigorously proliferate and form columns in the growth plate." [PMID:15951842]
is_a: CL:0000138 ! chondrocyte

[Term]
id: CL:0000745
name: retina horizontal cell
namespace: cell
def: "A neuron that laterally connects other neurons in the inner nuclear layer of the retina." [ISBN:0195088433]
synonym: "horizontal cell" EXACT []
xref: BTO:0004120
is_a: CARO:0000000
is_a: CL:0000099 ! interneuron
is_a: CL:0009004 ! retinal cell
relationship: part_of UBERON:0003902 ! retinal neural layer

[Term]
id: CL:0000746
name: cardiac muscle cell
namespace: cell
alt_id: FMA:83808
def: "Cardiac muscle cells are striated muscle cells that are responsible for heart contraction. In mammals, the contractile fiber resembles those of skeletal muscle but are only one third as large in diameter, are richer in sarcoplasm, and contain centrally located instead of peripheral nuclei." [GOC:mtg_cardiacconduct_nov11, GOC:tfm, ISBN:0323052908, PMID:22426062, PMID:4711263]
comment: This class encompasses the muscle cells responsible for heart* contraction in both vertebrates and arthropods.  The ultrastucture of a wide range of arthropod heart cells has been examined including spiders, horseshoe crabs, crustaceans (see Sherman, 1973 and refs therein) and insects (see Lehmacher et al (2012) and refs therein).  According to these refs, the cells participating in heart contraction in all cases are transversely striated.  Insects hearts additionally contain ostial cells, also transversely striated muscle cells, but which do not participate in heart contraction.
synonym: "cardiac muscle fiber" EXACT [GO:0048739]
synonym: "cardiac myocyte" EXACT []
synonym: "cardiocyte" BROAD []
synonym: "cardiomyocyte" EXACT []
synonym: "heart muscle cell" EXACT []
xref: BTO:0001539
xref: CALOHA:TS-0115
xref: FMA:14067
is_a: CL:0000737 ! striated muscle cell
is_a: CL:0002494 ! cardiocyte
intersection_of: CL:0000187 ! muscle cell
intersection_of: bearer_of PATO:0002478 ! transversely striated
intersection_of: has_part GO:0030017 ! sarcomere
intersection_of: part_of UBERON:0007100 ! primary circulatory organ
intersection_of: participates_in GO:0060047 ! heart contraction
relationship: bearer_of PATO:0002478 ! transversely striated
relationship: develops_from CL:0000513 ! cardiac muscle myoblast
relationship: participates_in GO:0060047 ! heart contraction

[Term]
id: CL:0000747
name: cyanophore
namespace: cell
def: "A pigment cell derived from the neural crest. Contains blue pigment of unknown chemical composition in fibrous organelles termed cyanosomes. This gives a blue appearance." [SANBI:mhl]
synonym: "blue chromatophore" RELATED []
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000147 ! pigment cell
relationship: develops_from CL:0005005 ! cyanoblast

[Term]
id: CL:0000748
name: retinal bipolar neuron
def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the inner plexiform layer." [PMID:14689473]
is_a: CARO:0000000
is_a: CL:0000103 ! bipolar neuron
is_a: CL:0000679 ! glutamatergic neuron
is_a: CL:0008028 ! visual system neuron
is_a: CL:0008030 ! excitatory neuron
is_a: CL:0009004 ! retinal cell
intersection_of: CL:0000103 ! bipolar neuron
intersection_of: part_of UBERON:0000966 ! retina
relationship: part_of UBERON:0000966 ! retina

[Term]
id: CL:0000749
name: ON-bipolar cell
namespace: cell
def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the inner half of the inner plexiform layer. These cells depolarize in response to light stimulation of their corresponding photoreceptors." [PMID:14689473]
is_a: CL:0000748 ! retinal bipolar neuron

[Term]
id: CL:0000750
name: OFF-bipolar cell
namespace: cell
def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the outer half of the inner plexiform layer. These cells depolatize in response to light to dark transition." [PMID:14689473]
is_a: CL:0000748 ! retinal bipolar neuron

[Term]
id: CL:0000751
name: rod bipolar cell
namespace: cell
def: "A bipolar neuron found in the retina that is synapsed by rod photoreceptor cells but not by cone photoreceptor cells.  These neurons depolarize in response to light." [GOC:tfm, PMID:14689473]
xref: FMA:67750
is_a: CL:0000748 ! retinal bipolar neuron
relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4
relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5
relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell

[Term]
id: CL:0000752
name: cone retinal bipolar cell
namespace: cell
def: "A bipolar neuron found in the retina and having connections with cone photoreceptor cells and neurons in the inner plexiform layer." [PMID:14689473]
is_a: CL:0000748 ! retinal bipolar neuron
intersection_of: CL:0000748 ! retinal bipolar neuron
intersection_of: RO:0002103 CL:0000573 ! synapsed by retinal cone cell
relationship: RO:0002103 CL:0000573 ! synapsed by retinal cone cell

[Term]
id: CL:0000753
name: type 1 cone bipolar cell (sensu Mus)
def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The cell body of these cells is in the middle of the inner plexiform layer. The dendritic tree is stout and the axon terminates in sublamina 1. The axonal terminal is wide and has only a few varicosities." [PMID:14689473]
synonym: "DB1 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008922 ! axon synapses in sublaminar layer S1

[Term]
id: CL:0000754
name: type 2 cone bipolar cell (sensu Mus)
namespace: cell
def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The dendritic tree is not well filled and the dendrites are more delicate than in type 1 cells. The axon terminal is bushier and exhibits a dense plexus of varicosities in the inner part of sublamina 1 (Ghosh et al., 2004).  It can be differentiated from other retinal bipolar neurons by its expression of marker genes: Neto1, Lhx3 and Irx-6 (Shekhar, 2016)." [PMID:14689473, PMID:27565351]
synonym: "FMB cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
intersection_of: CL:0000748 {xref="PMID:27565351"} ! retinal bipolar neuron
intersection_of: RO:0002292 PR:P50481 {xref="PMID:27565351"} ! expresses LIM/homeobox protein Lhx3 (mouse)
intersection_of: RO:0002292 PR:Q8R4I7 {xref="PMID:27565351"} ! expresses neuropilin and tolloid-like protein 1 (mouse)
intersection_of: RO:0002292 PR:Q9ER75 {xref="PMID:27565351"} ! expresses iroquois-class homeodomain protein IRX-6 (mouse)
relationship: RO:0002102 UBERON:0008922 ! axon synapses in sublaminar layer S1
relationship: RO:0002292 PR:P50481 ! expresses LIM/homeobox protein Lhx3 (mouse)
relationship: RO:0002292 PR:Q8R4I7 ! expresses neuropilin and tolloid-like protein 1 (mouse)
relationship: RO:0002292 PR:Q9ER75 ! expresses iroquois-class homeodomain protein IRX-6 (mouse)

[Term]
id: CL:0000755
name: type 3 cone bipolar cell (sensu Mus)
namespace: cell
def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The dendritic tree is delicate and the dendritic tips appear small when compared with type 1 cells. The axon terminal is stratified and restricted to sublamina 2 of the inner plexiform layer." [PMID:14689473]
synonym: "DB2 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008923 ! axon synapses in sublaminar layer S2
relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell

[Term]
id: CL:0000756
name: type 4 cone bipolar cell (sensu Mus)
namespace: cell
def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The cell has a diffuse axon terminal with varicosities in sublaminae 1 and 2 of the inner plexiform layer." [PMID:14689473]
synonym: "DB3 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008923 ! axon synapses in sublaminar layer S2
relationship: RO:0002102 UBERON:0008924 ! axon synapses in sublaminar layer S3
relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell

[Term]
id: CL:0000757
name: type 5 cone bipolar cell (sensu Mus)
namespace: cell
def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The axon terminal is restricted to sublamina 3 of the inner plexiform layer. It is narrowly stratified and branched. The dendritic tree has many delicate branches." [PMID:14689473]
synonym: "DB4 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008924 ! axon synapses in sublaminar layer S3

[Term]
id: CL:0000758
name: type 6 cone bipolar cell (sensu Mus)
namespace: cell
def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The cell has a loose, delicate axon terminal that opens in sublamina 3 of the inner plexiform layer and descends into sublamina 4." [PMID:14689473]
synonym: "DB5 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4

[Term]
id: CL:0000759
name: type 7 cone bipolar cell (sensu Mus)
namespace: cell
def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The axon terminal is narrowly stratified and are found just below a calretinin-expressing band in sublamina 4 of the inner plexiform layer." [PMID:14689473]
synonym: "IMB cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4

[Term]
id: CL:0000760
name: type 8 cone bipolar cell (sensu Mus)
namespace: cell
def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. This cell has the widest dendritic field and the widest axon terminal of all retinal bipolar cells. The axon terminal is delicate and stratified through sublaminae 4 and 5 of the inner plexiform layer." [PMID:14689473]
synonym: "DB6 cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4
relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5

[Term]
id: CL:0000761
name: type 9 cone bipolar cell (sensu Mus)
namespace: cell
def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The dendritic tree is wide and the dendritic convergence indicates cone selectivity. The axon terminal is sparsely branched and terminates in sublamina 5 of the inner plexiform layer." [PMID:14689473]
synonym: "BB cone bipolar cell" EXACT []
is_a: CL:0000752 ! cone retinal bipolar cell
relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5

[Term]
id: CL:0000762
name: nucleated thrombocyte
namespace: cell
def: "A nucleated blood cell involved in coagulation, typically seen in birds and other non-mammalian vertebrates." [GOC:add, GOC:tfm, PMID:16360205]
comment: Note that this is a non-mammalian cell type. Use platelet ; CL:0000233 for thrombocytes (platelets) in mammals.
is_a: BFO:0000040 ! material entity
is_a: CL:0000226 ! single nucleate cell
is_a: CL:0000763 {is_inferred="true"} ! myeloid cell
intersection_of: CL:0000763 ! myeloid cell
intersection_of: bearer_of PATO:0001407 ! mononucleate
intersection_of: capable_of GO:0007596 ! blood coagulation
relationship: capable_of GO:0007596 ! blood coagulation
relationship: develops_from CL:0000828 ! thromboblast

[Term]
id: CL:0000763
name: myeloid cell
namespace: cell
def: "A cell of the monocyte, granulocyte, mast cell, megakaryocyte, or erythroid lineage." [GOC:add]
xref: BTO:0001441
xref: CALOHA:TS-0647
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell
intersection_of: CL:0000988 ! hematopoietic cell
intersection_of: develops_from CL:0000049 ! common myeloid progenitor
relationship: develops_from CL:0000049 ! common myeloid progenitor

[Term]
id: CL:0000764
name: erythroid lineage cell
namespace: cell
alt_id: CL:0002156
def: "A immature or mature cell in the lineage leading to and including erythrocytes." [GOC:add, GOC:tfm]
comment: Note that in FMA erythropoietic cells are types of nucleated erythrocytes and thus don't include erythrocytes.
synonym: "erythropoietic cell" EXACT []
xref: CALOHA:TS-0290
xref: FMA:62845
xref: FMA:83516
is_a: CL:0000763 ! myeloid cell

[Term]
id: CL:0000765
name: erythroblast
namespace: cell
def: "A nucleated precursor of an erythrocyte that lacks hematopoietic lineage markers." [GOC:add, ISBN:0721601464, PMID:18174176]
synonym: "normoblast" EXACT []
xref: BTO:0001571
xref: CALOHA:TS-0289
xref: FMA:83504
is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000764 ! erythroid lineage cell
intersection_of: capable_of GO:0030218 ! erythrocyte differentiation
intersection_of: has_part GO:0005634 ! nucleus
intersection_of: lacks_part GO:0005730 ! nucleolus
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: capable_of GO:0030218 ! erythrocyte differentiation
relationship: develops_from CL:0000547 ! proerythroblast
relationship: has_part GO:0005634 ! nucleus
relationship: lacks_part GO:0005730 ! nucleolus
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G

[Term]
id: CL:0000766
name: myeloid leukocyte
namespace: cell
def: "A cell of the monocyte, granulocyte, or mast cell lineage." [GOC:add]
is_a: CL:0000738 {is_inferred="true"} ! leukocyte
is_a: CL:0000763 ! myeloid cell
intersection_of: CL:0000738 ! leukocyte
intersection_of: develops_from CL:0000049 ! common myeloid progenitor

[Term]
id: CL:0000767
name: basophil
namespace: cell
def: "Any of the immature or mature forms of a granular leukocyte that in its mature form has an irregularly shaped, pale-staining nucleus that is partially constricted into two lobes, and with cytoplasm that contains coarse, bluish-black granules of variable size. Basophils contain vasoactive amines such as histamine and serotonin, which are released on appropriate stimulation. A basophil is CD123-positive, CD193-positive, CD203c-positive, and FceRIa-positive." [GOC:add, GOC:amm, GOC:dsd, GOC:tfm, ISBN:0721601464, MESH:D001491, PMCID:PMC2626675, PMID:11927641, PMID:19741522, PMID:21236338, PMID:9933081]
comment: Matures in the bone marrow and account for <1% of leukocytes in the peripheral blood, spleen, and bone marrow. Basophils are described as being CD11a-positive, CD11b-positive, CD13-positive, CD15-positive, CD18-positive, CD21-positive, CD25-positive, CD29-positive, CD35-positive, CD40-positive, CD40L-positive, CD44-positive, CD45R-negative, CD46-positive, CD49a-positive, CD49b-positive, CD49d-positive, CD55-positive, CD59-positive, CD62L-positive, CD63-positive, CD69-positive, CD90-negative, CD116-positive, CD117-negative, CD124-positive, CD125-positive, CD131-positive, CD161-positive, CD184-positive, CD191-positive, CD192-positive, CD197-positive, CD200R3-positive, CD218-positive, CD282-positive, CD284-positive, CD289-positive, CD290-positive, CD294-positive, natural killer cell receptor 2B4-positive, smad1-positive, CD3-negative, CD4-negative, CD7-negative, CD8-negative, CD14-negative, CD15-negative, CD16-negative, CD19-negative, CD20-negative, CD34-negative, CD36-negative, CD45R-negative, CD56-negative, CD57-negative, CD235a-negative, and GR1-negative. Transcription factors- GATA1-positive, PU.1-positive.
synonym: "basophilic leucocyte" EXACT []
synonym: "basophilic leukocyte" EXACT []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
xref: BTO:0000129
xref: CALOHA:TS-0073
xref: FMA:62862
is_a: CL:0000094 {is_inferred="true"} ! granulocyte
intersection_of: CL:0000094 ! granulocyte
intersection_of: has_high_plasma_membrane_amount PR:000001255 ! C-C chemokine receptor type 3
intersection_of: has_high_plasma_membrane_amount PR:000001865 ! interleukin-3 receptor class 2 alpha chain
intersection_of: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
intersection_of: RO:0002104 PR:000001344 ! has plasma membrane part ectonucleotide pyrophosphatase/phosphodiesterase family member 3
intersection_of: RO:0002104 PR:000001950 ! has plasma membrane part tumor necrosis factor ligand superfamily member 5
relationship: has_high_plasma_membrane_amount PR:000001255 ! C-C chemokine receptor type 3
relationship: has_high_plasma_membrane_amount PR:000001865 ! interleukin-3 receptor class 2 alpha chain
relationship: has_high_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
relationship: RO:0002104 PR:000001344 ! has plasma membrane part ectonucleotide pyrophosphatase/phosphodiesterase family member 3
relationship: RO:0002104 PR:000001950 ! has plasma membrane part tumor necrosis factor ligand superfamily member 5

[Term]
id: CL:0000768
name: immature basophil
namespace: cell
def: "Any of the immature forms of a basophil, in which basophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464]
synonym: "immature basophilic leucocyte" EXACT []
synonym: "immature basophilic leukocyte" EXACT []
is_a: CL:0000767 {is_inferred="true"} ! basophil
intersection_of: CL:0000767 ! basophil
intersection_of: has_part CL:0017509 ! alobate nucleus
relationship: develops_from CL:0000830 ! basophilic promyelocyte
relationship: has_part CL:0017509 ! alobate nucleus

[Term]
id: CL:0000769
name: basophilic metamyelocyte
namespace: cell
def: "A basophil precursor in the granulocytic series, being a cell intermediate in development between a basophilic myelocyte and a band form basophil. The nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare. Markers are CD11b-positive, CD15-positive, CD16-positive, CD24-positive, CD33-positive, and CD13-positive." [GOC:tfm, ISBN:0721601464, PMID:18466030]
xref: FMA:84198
is_a: CL:0000768 {is_inferred="true"} ! immature basophil
is_a: CL:0002192 ! metamyelocyte
intersection_of: CL:0000768 ! immature basophil
intersection_of: has_part CL:0017507 ! reniform nucleus
intersection_of: has_part GO:0000792 ! heterochromatin
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: has_part GO:0070820 ! tertiary granule
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: develops_from CL:0000614 ! basophilic myelocyte
relationship: has_part CL:0017507 ! reniform nucleus
relationship: has_part GO:0000792 ! heterochromatin
relationship: has_part GO:0042582 ! azurophil granule
relationship: has_part GO:0070820 ! tertiary granule
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000770
name: band form basophil
namespace: cell
def: "A late basophilic metamyelocyte in which the nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature basophil." [GOC:add, http://www.cap.org, ISBN:0721601464, PMID:18466030]
is_a: CL:0000768 {is_inferred="true"} ! immature basophil
intersection_of: CL:0000768 ! immature basophil
intersection_of: has_part CL:0017506 ! banded nucleus
relationship: develops_from CL:0000769 ! basophilic metamyelocyte
relationship: has_part CL:0017506 ! banded nucleus

[Term]
id: CL:0000771
name: eosinophil
namespace: cell
def: "Any of the immature or mature forms of a granular leukocyte with a nucleus that usually has two lobes connected by one or more slender threads of chromatin, and cytoplasm containing coarse, round granules that are uniform in size and which can be stained by the dye eosin. Eosinophils are CD9-positive, CD191-positive, and CD193-positive." [GOC:add, GOC:amm, GOC:dsd, GOC:tfm, ISBN:0721601464, PMCID:PMC2626675, PMID:10914487, PMID:1662676]
comment: Eosinophils are also CD14-negative, CD32-positive, CD44-positive, CD48-positive, CD69-positive, CD192-negative, MBP1-positive, MBP2-positive, TLR2-negative, TLR4-negative, and lineage-negative (B220, CD2, CD14, CD19, CD56, CD71, CD117, CD123, CD235a (glycophorin A), and TER119). The cytokines IL-3, IL-5, and GM-CSF are involved in their development and differentiation. Usually considered CD16-negative, CD16 is observed on eosinophilic metamyelocyte.
synonym: "eosinocyte" EXACT []
synonym: "eosinophilic granulocyte" EXACT []
synonym: "eosinophilic leucocyte" EXACT []
synonym: "eosinophilic leukocyte" EXACT []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
xref: BTO:0000399
xref: CALOHA:TS-0279
xref: FMA:62861
is_a: CL:0000094 {is_inferred="true"} ! granulocyte
intersection_of: CL:0000094 ! granulocyte
intersection_of: RO:0002104 PR:000001254 ! has plasma membrane part C-C chemokine receptor type 1
intersection_of: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3
intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
intersection_of: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule
relationship: RO:0002104 PR:000001254 ! has plasma membrane part C-C chemokine receptor type 1
relationship: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3
relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule

[Term]
id: CL:0000772
name: immature eosinophil
namespace: cell
def: "Any of the immature forms of an eosinophil, in which eosinophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464]
synonym: "immature eosinocyte" EXACT []
synonym: "immature eosinophilic leucocyte" EXACT []
synonym: "immature eosinophilic leukocyte" EXACT []
is_a: CL:0000771 {is_inferred="true"} ! eosinophil
intersection_of: CL:0000771 ! eosinophil
intersection_of: has_part CL:0017509 ! alobate nucleus
relationship: develops_from CL:0000833 ! eosinophilic promyelocyte
relationship: has_part CL:0017509 ! alobate nucleus

[Term]
id: CL:0000773
name: eosinophilic metamyelocyte
namespace: cell
def: "A eosinophil precursor in the granulocytic series, being a cell intermediate in development between a eosinophilic myelocyte and a band form eosinophil. The nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare. Markers are integrin alpha-M-positive, fucosyltransferase FUT4-positive, low affinity immunoglobulin gamma Fc region receptor III-positive, CD33-positive, CD24-positive and aminopeptidase N-negative." [GOC:add, GOC:tfm, ISBN:0721601464, PMID:19622087]
is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil
is_a: CL:0002192 ! metamyelocyte
intersection_of: CL:0000772 ! immature eosinophil
intersection_of: has_part CL:0017502 ! acidophilic cytoplasm
intersection_of: has_part CL:0017507 ! reniform nucleus
intersection_of: has_part GO:0000792 ! heterochromatin
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: has_part GO:0070820 ! tertiary granule
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N
relationship: develops_from CL:0000612 ! eosinophilic myelocyte
relationship: has_part CL:0017502 ! acidophilic cytoplasm
relationship: has_part CL:0017507 ! reniform nucleus
relationship: has_part GO:0000792 ! heterochromatin
relationship: has_part GO:0042582 ! azurophil granule
relationship: has_part GO:0070820 ! tertiary granule
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24
relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N

[Term]
id: CL:0000774
name: band form eosinophil
namespace: cell
def: "A late eosinophilic metamyelocyte in which the nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature eosinophil." [GOC:add, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:19622087]
is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil
intersection_of: CL:0000772 ! immature eosinophil
intersection_of: has_part CL:0017506 ! banded nucleus
relationship: develops_from CL:0000773 ! eosinophilic metamyelocyte
relationship: has_part CL:0017506 ! banded nucleus

[Term]
id: CL:0000775
name: neutrophil
namespace: cell
def: "Any of the immature or mature forms of a granular leukocyte that in its mature form has a nucleus with three to five lobes connected by slender threads of chromatin, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes." [GOC:add, GOC:amm, GOC:tfm, ISBN:0721601464]
synonym: "neutrocyte" EXACT []
synonym: "neutrophil leucocyte" EXACT []
synonym: "neutrophil leukocyte" EXACT []
synonym: "neutrophilic leucocyte" EXACT []
synonym: "neutrophilic leukocyte" EXACT []
synonym: "PMN" BROAD []
synonym: "poly" BROAD []
synonym: "polymorphonuclear leucocyte" BROAD []
synonym: "polymorphonuclear leukocyte" BROAD []
synonym: "polymorphonuclear neutrophil" BROAD []
synonym: "polynuclear neutrophilic leucocyte" BROAD []
synonym: "polynuclear neutrophilic leukocyte" BROAD []
xref: BTO:0000130
xref: CALOHA:TS-0688
xref: FMA:62860
is_a: CL:0000094 {is_inferred="true"} ! granulocyte
intersection_of: CL:0000094 ! granulocyte
intersection_of: RO:0002104 PR:000001479 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor II
intersection_of: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin
relationship: RO:0002104 PR:000001479 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor II
relationship: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin

[Term]
id: CL:0000776
name: immature neutrophil
namespace: cell
def: "Any of the immature forms of a neutrophil in which neutrophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464]
synonym: "immatuer neutrophilic leukocyte" EXACT []
synonym: "immature neutrocyte" EXACT []
synonym: "immature neutrophil leucocyte" EXACT []
synonym: "immature neutrophil leukocyte" EXACT []
synonym: "immature neutrophilic leucocyte" EXACT []
is_a: CL:0000775 {is_inferred="true"} ! neutrophil
intersection_of: CL:0000775 ! neutrophil
intersection_of: has_part CL:0017509 ! alobate nucleus
relationship: develops_from CL:0000564 ! neutrophilic promyelocyte
relationship: has_part CL:0017509 ! alobate nucleus

[Term]
id: CL:0000777
name: mesangial phagocyte
namespace: cell
def: "A tissue-resident macrophage of the renal glomerular mesangium involved in the disposal and degradation of filtration residues, presentation of antigen to T cells and in tissue remodeling." [GOC:add, GOC:tfm, ISBN:0702022918, ISBN:3540536663, PMID:1600140, PMID:16146841]
synonym: "mesangial cell" BROAD []
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: capable_of GO:0019882 ! antigen processing and presentation
intersection_of: capable_of GO:0048771 ! tissue remodeling
intersection_of: located_in UBERON:0002320 ! glomerular mesangium
relationship: capable_of GO:0048771 ! tissue remodeling
relationship: located_in UBERON:0002320 ! glomerular mesangium

[Term]
id: CL:0000778
name: mononuclear osteoclast
namespace: cell
def: "A specialized mononuclear osteoclast associated with the absorption and removal of bone, precursor of multinuclear osteoclasts." [GOC:add, GOC:tfm, PMID:12713016, PMID:15055519, PMID:17380158, PMID:9415452]
comment: Morphology: mononuclear, highly vesicular.
is_a: CL:0000092 {is_inferred="true"} ! osteoclast
is_a: CL:0000842 ! mononuclear cell
intersection_of: CL:0000092 ! osteoclast
intersection_of: bearer_of PATO:0001407 ! mononucleate

[Term]
id: CL:0000779
name: multinuclear osteoclast
namespace: cell
def: "A specialized multinuclear osteoclast associated with the absorption and removal of bone." [GOC:add, PMID:12713016, PMID:9415452]
comment: Morphology: multinucleated, highly vesicular.
synonym: "multinucleated osteoclast" EXACT []
is_a: CL:0000092 {is_inferred="true"} ! osteoclast
is_a: CL:0000228 ! multinucleate cell
intersection_of: CL:0000092 ! osteoclast
intersection_of: bearer_of PATO:0001908 ! multinucleate
relationship: develops_from CL:0000778 ! mononuclear osteoclast

[Term]
id: CL:0000780
name: multinuclear odontoclast
namespace: cell
def: "A specialized multinuclear osteoclast associated with the absorption and removal of cementum." [GOC:add, PMID:9415452]
comment: Morphology: multinucleated, highly vesicular; location: roots of deciduous (milk) teeth.
synonym: "multinucleated odontoclast" EXACT []
is_a: CL:0000588 {is_inferred="true"} ! odontoclast
is_a: CL:0000779 ! multinuclear osteoclast
intersection_of: CL:0000588 ! odontoclast
intersection_of: bearer_of PATO:0001908 ! multinucleate
relationship: develops_from CL:0000781 ! mononuclear odontoclast

[Term]
id: CL:0000781
name: mononuclear odontoclast
namespace: cell
def: "A specialized mononuclear osteoclast associated with the absorption and removal of cementum." [GOC:add, PMID:9415452]
comment: Morphology: Mononuclear, highly vesicular; location: roots of deciduous (milk) teeth.
is_a: CL:0000588 {is_inferred="true"} ! odontoclast
is_a: CL:0000778 {is_inferred="true"} ! mononuclear osteoclast
intersection_of: CL:0000588 ! odontoclast
intersection_of: bearer_of PATO:0001407 ! mononucleate

[Term]
id: CL:0000782
name: myeloid dendritic cell
namespace: cell
def: "A dendritic cell of the myeloid lineage." [GOC:add, PMID:10449155, PMID:17332250, PMID:9521319]
comment: These cells are CD1a-negative, CD1b-positive, CD11a-positive, CD11c-positive, CD13-positive, CD14-negative, CD20-negative, CD21-negative, CD33-positive, CD40-negative, CD50-positive, CD54-positive, CD58-positive, CD68-negative, CD80-negative, CD83-negative, CD85j-positive, CD86-positive, CD89-negative, CD95-positive, CD120a-negative, CD120b-positive, CD123-negative, CD178-negative, CD206-negative, CD207-negative, CD209-negative, and TNF-alpha-negative. Upon TLR stimulation, they are capable of producing high levels of TNF-alpha, IL-6, CXCL8 (IL-8).
synonym: "CD11c+CD123- DC" EXACT []
synonym: "interdigitating cell" BROAD []
synonym: "mDC" EXACT []
synonym: "veiled cell" BROAD []
xref: BTO:0004721
is_a: CL:0000766 ! myeloid leukocyte
is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell
intersection_of: CL:0000990 ! conventional dendritic cell
intersection_of: develops_from CL:0000763 ! myeloid cell
intersection_of: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain
relationship: develops_from CL:0000763 ! myeloid cell
relationship: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain

[Term]
id: CL:0000783
name: multinucleated phagocyte
namespace: cell
def: "A phagocyte formed by the fusion of mononuclear phagocytes." [GOC:add, GOC:tfm]
is_a: CL:0000228 ! multinucleate cell
is_a: CL:0000518 {is_inferred="true"} ! phagocyte (sensu Vertebrata)
intersection_of: CL:0000518 ! phagocyte (sensu Vertebrata)
intersection_of: bearer_of PATO:0001908 ! multinucleate

[Term]
id: CL:0000784
name: plasmacytoid dendritic cell
namespace: cell
def: "A dendritic cell type of distinct morphology, localization, and surface marker expression (CD123-positive) from other dendritic cell types and associated with early stage immune responses, particularly the release of physiologically abundant amounts of type I interferons in response to infection." [GOC:add, GOC:dsd, PMCID:PMC2118448, PMCID:PMC538703, PMID:15549123, PMID:17332250, PMID:17850486, PMID:20304825]
synonym: "DC2" EXACT []
synonym: "interferon-producing cell" EXACT []
synonym: "IPC" EXACT []
synonym: "lymphoid dendritic cell" EXACT []
synonym: "pDC" EXACT []
synonym: "plasmacytoid monocyte" EXACT []
synonym: "plasmacytoid T cell" EXACT []
synonym: "T-associated plasma cell" EXACT []
synonym: "type 2 DC" EXACT []
xref: BTO:0004625
is_a: CL:0000451 {is_inferred="true"} ! dendritic cell
intersection_of: CL:0000451 ! dendritic cell
intersection_of: capable_of GO:0032606 ! type I interferon production
relationship: capable_of GO:0032606 ! type I interferon production

[Term]
id: CL:0000785
name: mature B cell
namespace: cell
def: "A B cell that is mature, having left the bone marrow. Initially, these cells are IgM-positive and IgD-positive, and they can be activated by antigen." [GOC:add, GOC:dsd, ISBN:0781735149]
comment: Mature B cells are also reportedly CD10-negative, CD19-positive, CD22-positive, CD34-negative, CD48-positive, CD79a-positive, CD84-positive, CD127-negative, CD352-positive, RAG-negative, TdT-negative, Vpre-B-negative, and pre-BCR-negative. Transcription factors expressed: Pax5-positive.
synonym: "mature B lymphocyte" EXACT []
synonym: "mature B-cell" EXACT []
synonym: "mature B-lymphocyte" EXACT []
is_a: CL:0000145 ! professional antigen presenting cell
is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive
intersection_of: CL:0001201 ! B cell, CD19-positive
intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II
intersection_of: capable_of GO:0042113 ! B cell activation
intersection_of: has_completed GO:0002335 ! mature B cell differentiation
disjoint_from: CL:0000816 ! immature B cell
disjoint_from: CL:0000817 ! precursor B cell
disjoint_from: CL:0000818 ! transitional stage B cell
relationship: capable_of GO:0042113 ! B cell activation
relationship: develops_from CL:0000818 ! transitional stage B cell
relationship: has_completed GO:0002335 ! mature B cell differentiation

[Term]
id: CL:0000786
name: plasma cell
namespace: cell
def: "A terminally differentiated, post-mitotic, antibody secreting cell of the B cell lineage with the phenotype CD138-positive, surface immunonoglobulin-negative, and MHC Class II-negative. Plasma cells are oval or round with extensive rough endoplasmic reticulum, a well-developed Golgi apparatus, and a round nucleus having a characteristic cartwheel heterochromatin pattern and are devoted to producing large amounts of immunoglobulin." [GO_REF:0000031, GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Plasma_cell, ISBN:0721601464, ISBN:0781735149, PMID:19447676, PMID:20081059, PMID:20839338, PMID:20951740]
comment: Plasma cells develop in the spleen and migrate to the bone marrow. Plasma cells are also reportedly CD5-negative, CD10-negative, CD19-positive, CD20-negative, CD21-negative, CD22-negative, CD23-negative, CD24-negative, CD25-negative, CD27-positive, CD34-negative, CD38-positive, CD40-positive, CD43-positive, CD45-positive, CD48-positive, CD53-low, CD80-negative, CD81-positive, CD86-positive, CD95-positive, CD196-negative, CD229-positive, CD270-positive, CD352-positive, CD361-positive, and IgD-negative. Transcription factors: BLIMP1-positive, IRF4-positive, PAX5-negative, SpiB-negative, Ets1-negative, and XBP1-positive.
synonym: "effector B cell" RELATED []
synonym: "effector B-cell" RELATED []
synonym: "plasma B cell" EXACT []
synonym: "plasma B-cell" EXACT []
synonym: "plasmacyte" EXACT []
synonym: "plasmocyte" EXACT []
xref: BTO:0000392
xref: FMA:70574
is_a: CARO:0000006
is_a: CL:0000946 {is_inferred="true"} ! antibody secreting cell
intersection_of: CL:0000946 ! antibody secreting cell
intersection_of: has_part CL:0017508 ! cartwheel heterochromatin
intersection_of: has_part GO:0005794 ! Golgi apparatus
intersection_of: lacks_plasma_membrane_part GO:0019814 ! immunoglobulin complex
intersection_of: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: RO:0002104 PR:000001935 ! has plasma membrane part syndecan-1
relationship: develops_from CL:0000980 ! plasmablast
relationship: has_part CL:0017508 ! cartwheel heterochromatin
relationship: has_part GO:0005794 ! Golgi apparatus
relationship: lacks_plasma_membrane_part GO:0019814 ! immunoglobulin complex
relationship: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: RO:0002104 PR:000001935 ! has plasma membrane part syndecan-1

[Term]
id: CL:0000787
name: memory B cell
namespace: cell
def: "A memory B cell is a mature B cell that is long-lived, readily activated upon re-encounter of its antigenic determinant, and has been selected for expression of higher affinity immunoglobulin. This cell type has the phenotype CD19-positive, CD20-positive, MHC Class II-positive, and CD138-negative." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, http://en.wikipedia.org/wiki/Memory_B_cell, ISBN:0781735149, PMID:20081059, PMID:20839338]
comment: Memory B-cells are also reportedly CD5-negative, CD10-negative, CD21-positive, CD22-positive, CD23-negative, CD24-positive, CD25-positive, CD27-positive, CD34-negative, CD38-negative, CD40-positive, CD43-negative, CD44-positive, CD45-positive, CD53-positive, CD80-negative, CD81-negative, CD86-positive, and CD196/CCR6-positive.
synonym: "memory B lymphocyte" EXACT []
synonym: "memory B-cell" EXACT []
synonym: "memory B-lymphocyte" EXACT []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: has_completed GO:0002344 ! B cell affinity maturation
intersection_of: lacks_plasma_membrane_part PR:000001935 ! syndecan-1
intersection_of: RO:0002104 GO:0042613 ! has plasma membrane part MHC class II protein complex
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: has_completed GO:0002344 ! B cell affinity maturation
relationship: lacks_plasma_membrane_part PR:000001935 ! syndecan-1
relationship: RO:0002104 GO:0042613 ! has plasma membrane part MHC class II protein complex
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000788
name: naive B cell
namespace: cell
def: "A naive B cell is a mature B cell that has the phenotype surface IgD-positive, surface IgM-positive, CD20-positive, CD27-negative and that has not yet been activated by antigen in the periphery." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, ISBN:0781765196, PMID:19447676, PMID:20081059, PMID:20839338, PMID:20933013, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'naive B cell'. Per DSD: Naive B cells are also reportedly CD10-negative, CD19-positive, CD20-positive, CD21-positive, CD22-positive, CD25-negative, CD27-negative, CD34-negative, CD40-positive, CD43-negative, CD45-positive, CD48-positive, CD53-positive, CD80-negative, CD81-positive, CD84-positive, CD86-negative, CD95-negative, CD138-negative, CD150-positive, CD184/CXCR4-positive, CD185/CXCR5-positive, CD196/CCR6-positive, CD200-positive, CD229-positive, CD243-positive, CD289-positive, CD290-positive, CD352-positive, MHCII/HLA-DR-positive, cadherin 9-positive, and sIgH-positive, Transcription factors: Pax5-positive, ETS1-positive, FOXO1A-positive, KLF4-positive, KLF9-positive, MiTF-positive, OBF1-positive, PLZF-positive, and SpiB-positive.
synonym: "naive B lymphocyte" EXACT []
synonym: "naive B-cell" EXACT []
synonym: "naive B-lymphocyte" EXACT []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: has_not_completed GO:0002344 ! B cell affinity maturation
intersection_of: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: has_not_completed GO:0002344 ! B cell affinity maturation
relationship: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000789
name: alpha-beta T cell
namespace: cell
def: "A T cell that expresses an alpha-beta T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "alpha-beta T lymphocyte" EXACT []
synonym: "alpha-beta T-cell" EXACT []
synonym: "alpha-beta T-lymphocyte" EXACT []
is_a: CARO:0000006
is_a: CL:0000084 {is_inferred="true"} ! T cell
intersection_of: CL:0000084 ! T cell
intersection_of: RO:0002104 GO:0042105 ! has plasma membrane part alpha-beta T cell receptor complex
disjoint_from: CL:0000798 ! gamma-delta T cell
relationship: RO:0002104 GO:0042105 ! has plasma membrane part alpha-beta T cell receptor complex

[Term]
id: CL:0000790
name: immature alpha-beta T cell
namespace: cell
def: "An alpha-beta T cell that has an immature phenotype and has not completed T cell selection." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "immature alpha-beta T lymphocyte" EXACT []
synonym: "immature alpha-beta T-cell" EXACT []
synonym: "immature alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000789 {is_inferred="true"} ! alpha-beta T cell
is_a: CL:0002420 ! immature T cell
intersection_of: CL:0000789 ! alpha-beta T cell
intersection_of: has_not_completed GO:0045058 ! T cell selection

[Term]
id: CL:0000791
name: mature alpha-beta T cell
namespace: cell
def: "A alpha-beta T cell that has a mature phenotype." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "mature alpha-beta T lymphocyte" EXACT []
synonym: "mature alpha-beta T-cell" EXACT []
synonym: "mature alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000789 {is_inferred="true"} ! alpha-beta T cell
is_a: CL:0002419 ! mature T cell
intersection_of: CL:0000789 ! alpha-beta T cell
intersection_of: has_completed GO:0045058 ! T cell selection
relationship: develops_from CL:0000790 ! immature alpha-beta T cell

[Term]
id: CL:0000792
name: CD4-positive, CD25-positive, alpha-beta regulatory T cell
namespace: cell
def: "A CD4-positive, CD25-positive, alpha-beta T cell that regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GOC:add, GOC:tfm, ISBN:0781735149, PMID:19464985, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'Treg'.  The inclusion of CD127lo in the logical definition is compatible with both human and mouse T cells of this subtype.
synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T lymphocyte" EXACT []
synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T-cell" EXACT []
synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T-lymphocyte" EXACT []
synonym: "suppressor T cell" BROAD []
synonym: "suppressor T lymphocyte" BROAD []
synonym: "suppressor T-cell" BROAD []
synonym: "suppressor T-lymphocyte" BROAD []
synonym: "Treg" BROAD [PMID:22343568]
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
is_a: CL:0000815 ! regulatory T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: capable_of GO:0050777 ! negative regulation of immune response
intersection_of: has_low_plasma_membrane_amount PR:000001869 ! interleukin-7 receptor subunit alpha
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: has_low_plasma_membrane_amount PR:000001869 ! interleukin-7 receptor subunit alpha
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000793
name: CD4-positive, alpha-beta intraepithelial T cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that is found in the columnar epithelium of the gastrointestinal tract." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD4-positive, alpha-beta intraepithelial T lymphocyte" EXACT []
synonym: "CD4-positive, alpha-beta intraepithelial T-cell" EXACT []
synonym: "CD4-positive, alpha-beta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
is_a: CL:0000797 ! alpha-beta intraepithelial T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: capable_of GO:0002385 ! mucosal immune response
intersection_of: located_in UBERON:0001277 ! intestinal epithelium
relationship: develops_from CL:0000810 ! CD4-positive, alpha-beta thymocyte

[Term]
id: CL:0000794
name: CD8-positive, alpha-beta cytotoxic T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell that is capable of killing target cells in an antigen specific manner with the phenotype perforin-positive and granzyme B-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149]
comment: Note that while T cells of this subset are loosely referred to 'cytotoxic T cells,' as many other T cell types, including CD4-positive, alpha-beta T cells and gamma-delta T cells exhibit cytotoxicity in vitro and in vivo.
synonym: "CD8-positive, alpha-beta cytotoxic T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta cytotoxic T-cell" EXACT []
synonym: "CD8-positive, alpha-beta cytotoxic T-lymphocyte" EXACT []
synonym: "cytotoxic T cell" BROAD []
synonym: "cytotoxic T lymphocyte" BROAD []
synonym: "cytotoxic T-cell" BROAD []
synonym: "cytotoxic T-lymphocyte" BROAD []
synonym: "killer T cell" BROAD []
synonym: "killer T lymphocyte" BROAD []
synonym: "killer T-cell" BROAD []
synonym: "killer T-lymphocyte" BROAD []
xref: CALOHA:TS-0190
xref: FMA:70573
is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: capable_of GO:0001913 ! T cell mediated cytotoxicity
intersection_of: capable_of GO:0033380 ! granzyme B localization to T cell secretory granule
intersection_of: has_completed GO:0030217 ! T cell differentiation
intersection_of: has_part PR:000003466 ! perforin-1
intersection_of: has_part PR:000003499 ! granzyme B
relationship: capable_of GO:0001913 ! T cell mediated cytotoxicity
relationship: capable_of GO:0033380 ! granzyme B localization to T cell secretory granule
relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell
relationship: has_completed GO:0030217 ! T cell differentiation
relationship: has_part PR:000003466 ! perforin-1
relationship: has_part PR:000003499 ! granzyme B

[Term]
id: CL:0000795
name: CD8-positive, alpha-beta regulatory T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell that regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD8+ regulatory T cell" EXACT []
synonym: "CD8+ T(reg)" EXACT []
synonym: "CD8+ Treg" EXACT []
synonym: "CD8-positive T(reg)" EXACT []
synonym: "CD8-positive Treg" EXACT []
synonym: "CD8-positive, alpha-beta regulatory T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta regulatory T-cell" EXACT []
synonym: "CD8-positive, alpha-beta regulatory T-lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta Treg" EXACT []
synonym: "suppressor T cell" BROAD []
synonym: "suppressor T lymphocyte" BROAD []
synonym: "suppressor T-cell" BROAD []
synonym: "suppressor T-lymphocyte" BROAD []
is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell
is_a: CL:0000815 ! regulatory T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: capable_of GO:0050777 ! negative regulation of immune response

[Term]
id: CL:0000796
name: CD8-alpha-beta-positive, alpha-beta intraepithelial T cell
namespace: cell
def: "A alpha-beta intraepithelial T cell found in the columnar epithelium of the gastrointestinal tract. Intraepithelial T cells often have distinct developmental pathways and activation requirements." [GOC:add, ISBN:0781735149]
synonym: "CD8-positive, alpha-beta intraepithelial T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta intraepithelial T-cell" EXACT []
synonym: "CD8-positive, alpha-beta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000797 {is_inferred="true"} ! alpha-beta intraepithelial T cell
intersection_of: CL:0000797 ! alpha-beta intraepithelial T cell
intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8
relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8

[Term]
id: CL:0000797
name: alpha-beta intraepithelial T cell
namespace: cell
def: "A mature alpha-beta T cell of the columnar epithelium of the gastrointestinal tract. Intraepithelial T cells often have distinct developmental pathways and activation requirements." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "alpha-beta intraepithelial T lymphocyte" EXACT []
synonym: "alpha-beta intraepithelial T-cell" EXACT []
synonym: "alpha-beta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell
is_a: CL:0002496 ! intraepithelial lymphocyte
intersection_of: CL:0000791 ! mature alpha-beta T cell
intersection_of: capable_of GO:0002385 ! mucosal immune response
intersection_of: located_in UBERON:0001277 ! intestinal epithelium

[Term]
id: CL:0000798
name: gamma-delta T cell
namespace: cell
def: "A T cell that expresses a gamma-delta T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149]
comment: Note that gamma-delta T cells have both thymic and extrathymic differentiation pathways.
synonym: "gamma-delta T lymphocyte" EXACT []
synonym: "gamma-delta T-cell" EXACT []
synonym: "gamma-delta T-lymphocyte" EXACT []
synonym: "gammadelta T cell" EXACT []
synonym: "gd T cell" RELATED []
is_a: CARO:0000006
is_a: CL:0000084 {is_inferred="true"} ! T cell
intersection_of: CL:0000084 ! T cell
intersection_of: RO:0002104 GO:0042106 ! has plasma membrane part gamma-delta T cell receptor complex
relationship: RO:0002104 GO:0042106 ! has plasma membrane part gamma-delta T cell receptor complex

[Term]
id: CL:0000799
name: immature gamma-delta T cell
namespace: cell
def: "A gamma-delta T cell that has an immature phenotype." [GOC:add, ISBN:0781735149]
comment: Note that gamma-delta T cells have both thymic and extrathymic differentiation pathways.
synonym: "immature gamma-delta T lymphocyte" EXACT []
synonym: "immature gamma-delta T-cell" EXACT []
synonym: "immature gamma-delta T-lymphocyte" EXACT []
is_a: CL:0000798 {is_inferred="true"} ! gamma-delta T cell
is_a: CL:0002420 ! immature T cell
intersection_of: CL:0000798 ! gamma-delta T cell
intersection_of: has_not_completed GO:0042492 ! gamma-delta T cell differentiation
intersection_of: has_not_completed GO:0045058 ! T cell selection
relationship: develops_from CL:0000807 ! DN3 thymocyte
relationship: has_not_completed GO:0042492 ! gamma-delta T cell differentiation

[Term]
id: CL:0000800
name: mature gamma-delta T cell
namespace: cell
def: "A gamma-delta T cell that has a mature phenotype. These cells can be found in tissues and circulation where they express unique TCR repertoire depending on their location." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "mature gamma-delta T lymphocyte" EXACT []
synonym: "mature gamma-delta T-cell" EXACT []
synonym: "mature gamma-delta T-lymphocyte" EXACT []
is_a: CL:0000798 {is_inferred="true"} ! gamma-delta T cell
is_a: CL:0002419 ! mature T cell
intersection_of: CL:0000798 ! gamma-delta T cell
intersection_of: has_completed GO:0045058 ! T cell selection
relationship: develops_from CL:0000799 ! immature gamma-delta T cell

[Term]
id: CL:0000801
name: gamma-delta intraepithelial T cell
namespace: cell
def: "A mature gamma-delta T cell that is found in the columnar epithelium of the gastrointestinal tract. These cells participate in mucosal immune responses." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "gamma-delta intraepithelial T lymphocyte" EXACT []
synonym: "gamma-delta intraepithelial T-cell" EXACT []
synonym: "gamma-delta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000800 {is_inferred="true"} ! mature gamma-delta T cell
is_a: CL:0002496 ! intraepithelial lymphocyte
intersection_of: CL:0000800 ! mature gamma-delta T cell
intersection_of: capable_of GO:0002385 ! mucosal immune response
intersection_of: located_in UBERON:0001277 ! intestinal epithelium

[Term]
id: CL:0000802
name: CD8-alpha alpha positive, gamma-delta intraepithelial T cell
namespace: cell
def: "A gamma-delta intraepithelial T cell that has the phenotype CD8-alpha alpha-positive." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD8-positive, gamma-delta intraepithelial T lymphocyte" EXACT []
synonym: "CD8-positive, gamma-delta intraepithelial T-cell" EXACT []
synonym: "CD8-positive, gamma-delta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000801 {is_inferred="true"} ! gamma-delta intraepithelial T cell
intersection_of: CL:0000801 ! gamma-delta intraepithelial T cell
intersection_of: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain
relationship: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain

[Term]
id: CL:0000803
name: CD4-negative CD8-negative gamma-delta intraepithelial T cell
namespace: cell
def: "A gamma-delta intraepithelial T cell that has the phenotype CD4-negative and CD8-negative." [GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD4-positive, gamma-delta intraepithelial T lymphocyte" EXACT []
synonym: "CD4-positive, gamma-delta intraepithelial T-cell" EXACT []
synonym: "CD4-positive, gamma-delta intraepithelial T-lymphocyte" EXACT []
synonym: "IEL" BROAD []
synonym: "intraepithelial lymphocyte" BROAD []
is_a: CL:0000801 {is_inferred="true"} ! gamma-delta intraepithelial T cell
intersection_of: CL:0000801 ! gamma-delta intraepithelial T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain

[Term]
id: CL:0000805
name: immature single positive thymocyte
namespace: cell
def: "A thymocyte that has the phenotype CD4-negative, CD8-positive, CD44-negative, CD25-negative, and pre-TCR-positive." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, ISBN:0781735149]
comment: Note that this type of thymocyte has passed the beta-selection checkpoint and is rapidly proliferating and rearranging the T cell receptor alpha chain and expressing the CD8 coreceptor. This stage comes between the DN4 and DP stages.
synonym: "immature single positive T cell" EXACT []
synonym: "immature single positive T lymphocyte" EXACT []
synonym: "immature single positive T-lymphocyte" EXACT []
synonym: "ISP" EXACT []
synonym: "T.ISP.th" EXACT []
is_a: CARO:0000006
is_a: CL:0000893 {is_inferred="true"} ! thymocyte
intersection_of: CL:0000893 ! thymocyte
intersection_of: has_high_plasma_membrane_amount PR:000001932 ! signal transducer CD24
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex
intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8
relationship: develops_from CL:0000808 ! DN4 thymocyte
relationship: has_high_plasma_membrane_amount PR:000001932 ! signal transducer CD24
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex
relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8

[Term]
id: CL:0000806
name: DN2 thymocyte
namespace: cell
def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-positive, and CD25-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
comment: Note that this type of thymocyte is at the earliest stage of T cell receptor rearrangement of the beta, gamma, and delta T cell receptor chains. Also, there is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'.
synonym: "DN2 alpha-beta immature T lymphocyte" EXACT []
synonym: "DN2 alpha-beta immature T-cell" EXACT []
synonym: "DN2 alpha-beta immature T-lymphocyte" EXACT []
synonym: "DN2 cell" EXACT []
synonym: "DN2 immature T cell" EXACT []
synonym: "double negative 2" EXACT []
synonym: "preT.DN2.Th" EXACT []
synonym: "TN2 cell" EXACT []
synonym: "TN2 thymocyte" EXACT []
is_a: CARO:0000006
is_a: CL:0002489 ! double negative thymocyte
intersection_of: CL:0000893 ! thymocyte
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8
intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: develops_from CL:0000894 ! DN1 thymic pro-T cell
relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000807
name: DN3 thymocyte
namespace: cell
def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-negative, and CD25-positive and expressing the T cell receptor beta-chain in complex with the pre-T cell receptor alpha chain." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
comment: There is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'.
synonym: "DN3 alpha-beta immature T lymphocyte" EXACT []
synonym: "DN3 alpha-beta immature T-cell" EXACT []
synonym: "DN3 alpha-beta immature T-lymphocyte" EXACT []
synonym: "DN3 cell" EXACT []
synonym: "DN3 immature T cell" EXACT []
synonym: "double negative 3" EXACT []
synonym: "early cortical thymocyte" BROAD []
synonym: "preT.DN3.Th" EXACT []
synonym: "TN3 cell" EXACT []
synonym: "TN3 thymocyte" EXACT []
is_a: CARO:0000006
is_a: CL:0002489 ! double negative thymocyte
intersection_of: CL:0000893 ! thymocyte
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8
intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: develops_from CL:0000806 ! DN2 thymocyte
relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000808
name: DN4 thymocyte
namespace: cell
def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-negative, CD25-negative, and pre-TCR-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
comment: Note that this type of thymocyte has passed the beta-selection checkpoint and is rapidly proliferating and beginning to rearrange the T cell receptor alpha chain. There is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'.
synonym: "DN4 alpha-beta immature T lymphocyte" EXACT []
synonym: "DN4 alpha-beta immature T-lymphocyte" EXACT []
synonym: "DN4 cell" EXACT []
synonym: "DN4 immature T cell" EXACT []
synonym: "DN4 immature T-cell" EXACT []
synonym: "double negative 4" EXACT []
synonym: "early cortical thymocyte" BROAD []
synonym: "T.DN4.th" EXACT []
is_a: CARO:0000006
is_a: CL:0002489 ! double negative thymocyte
intersection_of: CL:0000893 ! thymocyte
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8
intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex
relationship: develops_from CL:0000807 ! DN3 thymocyte
relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule
relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex

[Term]
id: CL:0000809
name: double-positive, alpha-beta thymocyte
namespace: cell
def: "A thymocyte expressing the alpha-beta T cell receptor complex as well as both the CD4 and CD8 coreceptors." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
comment: Thymocytes of this stage are undergoing positive and negative selection.
synonym: "double-positive, alpha-beta immature T lymphocyte" EXACT []
synonym: "DP cell" EXACT []
synonym: "DP thymocyte" EXACT []
synonym: "late cortical thymocyte" BROAD []
is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell
is_a: CL:0000893 ! thymocyte
intersection_of: CL:0000790 ! immature alpha-beta T cell
intersection_of: part_of UBERON:0002370 ! thymus
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8
relationship: develops_from CL:0000805 ! immature single positive thymocyte
relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8

[Term]
id: CL:0000810
name: CD4-positive, alpha-beta thymocyte
namespace: cell
def: "An immature alpha-beta T cell that is located in the thymus and is CD4-positive and CD8-negative." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD4-positive, alpha-beta immature T lymphocyte" EXACT []
synonym: "CD4-positive, alpha-beta immature T-cell" EXACT []
synonym: "CD4-positive, alpha-beta immature T-lymphocyte" EXACT []
synonym: "SP CD4 cell" EXACT []
is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell
is_a: CL:0000893 ! thymocyte
intersection_of: CL:0000790 ! immature alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: part_of UBERON:0002370 ! thymus
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule

[Term]
id: CL:0000811
name: CD8-positive, alpha-beta thymocyte
namespace: cell
def: "An immature alpha-beta T cell that is located in the thymus and is CD8-positive and CD4-negative." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149]
synonym: "CD8-positive, alpha-beta immature T cell" RELATED []
synonym: "CD8-positive, alpha-beta immature T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta immature T-cell" EXACT []
synonym: "CD8-positive, alpha-beta immature T-lymphocyte" EXACT []
synonym: "SP CD8 cell" EXACT []
is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell
is_a: CL:0000893 ! thymocyte
intersection_of: CL:0000790 ! immature alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: part_of UBERON:0002370 ! thymus
intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8
relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8

[Term]
id: CL:0000813
name: memory T cell
namespace: cell
def: "A long-lived, antigen-experienced T cell that has acquired a memory phenotype including distinct surface markers and the ability to differentiate into an effector T cell upon antigen reexposure." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149]
synonym: "memory T lymphocyte" EXACT []
synonym: "memory T-cell" EXACT []
synonym: "memory T-lymphocyte" EXACT []
xref: BTO:0003435
is_a: CL:0002419 {is_inferred="true"} ! mature T cell
intersection_of: CL:0002419 ! mature T cell
intersection_of: bearer_of PATO:0001603 ! increased life span
intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response
intersection_of: has_completed GO:0043379 ! memory T cell differentiation
disjoint_from: CL:0000898 ! naive T cell
relationship: bearer_of PATO:0001603 ! increased life span
relationship: has_completed GO:0043379 ! memory T cell differentiation

[Term]
id: CL:0000814
name: mature NK T cell
namespace: cell
def: "A mature alpha-beta T cell of a distinct lineage that bears natural killer markers and a T cell receptor specific for a limited set of ligands. NK T cells have activation and regulatory roles particularly early in an immune response." [GOC:add, ISBN:0781735149]
synonym: "mature natural killer T cell" EXACT []
synonym: "mature natural killer T lymphocyte" EXACT []
synonym: "mature natural killer T-cell" EXACT []
synonym: "mature natural killer T-lymphocyte" EXACT []
synonym: "mature NK T lymphocyte" EXACT []
synonym: "mature NK T-cell" EXACT []
synonym: "mature NK T-lymphocyte" EXACT []
synonym: "mature NKT cell" EXACT []
is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell
intersection_of: CL:0000791 ! mature alpha-beta T cell
intersection_of: capable_of GO:0032394 ! MHC class Ib receptor activity
intersection_of: capable_of GO:0045087 ! innate immune response
intersection_of: has_completed GO:0030217 ! T cell differentiation
intersection_of: RO:0002104 PR:000001874 ! has plasma membrane part KLRB1-like protein
relationship: capable_of GO:0032394 ! MHC class Ib receptor activity
relationship: capable_of GO:0045087 ! innate immune response
relationship: develops_from CL:0002042 ! immature NK T cell stage IV
relationship: has_completed GO:0030217 ! T cell differentiation
relationship: RO:0002104 PR:000001874 ! has plasma membrane part KLRB1-like protein

[Term]
id: CL:0000815
name: regulatory T cell
namespace: cell
def: "A T cell which regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GO_REF:0000031, GOC:add]
comment: This cell type may express FoxP3 and CD25 and secretes IL-10 and TGF-beta.
synonym: "regulatory T lymphocyte" EXACT []
synonym: "regulatory T-cell" EXACT []
synonym: "regulatory T-lymphocyte" EXACT []
synonym: "suppressor T cell" BROAD []
synonym: "suppressor T lymphocyte" BROAD []
synonym: "suppressor T-cell" BROAD []
synonym: "suppressor T-lymphocyte" BROAD []
synonym: "Treg" EXACT []
xref: BTO:0004520
xref: FMA:84070
is_a: CL:0002419 {is_inferred="true"} ! mature T cell
intersection_of: CL:0002419 ! mature T cell
intersection_of: capable_of GO:0050777 ! negative regulation of immune response
relationship: capable_of GO:0050777 ! negative regulation of immune response

[Term]
id: CL:0000816
name: immature B cell
namespace: cell
def: "An immature B cell is a B cell that has the phenotype surface IgM-positive and surface IgD-negative, and have not undergone class immunoglobulin class switching or peripheral encounter with antigen and activation." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, GOC:tfm, ISBN:0781735149, PMID:20081059, PMID:20839338]
comment: Immature B cells are also reportedly CD5-positive, CD10-positive, CD19-positive, CD20-positive, CD21-positive, CD22-positive, CD24-positive, CD25-negative, CD27-negative, CD34-negative, CD38-positive, CD40-positive, CD43-negative, CD45-positive, CD48-positive, CD53-positive, CD79a-positive, CD80-negative, CD81-positive, CD86-negative, CD95-negative, CD127-negative, CD138-negative, CD185-positive, CD196-positive, MHCII/HLA-DR-positive, RAG-positive, TdT-negative, Vpre-B-negative, and preBCR-negative. Transcription factors expressed: Pax5-positive.
synonym: "immature B lymphocyte" EXACT []
synonym: "immature B-cell" EXACT []
synonym: "immature B-lymphocyte" EXACT []
synonym: "newly formed B cell" EXACT [ISBN:781735149]
is_a: CL:0001201 ! B cell, CD19-positive
intersection_of: CL:0001201 ! B cell, CD19-positive
intersection_of: has_not_completed GO:0045190 ! isotype switching
intersection_of: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: develops_from CL:0000954 ! small pre-B-II cell
relationship: has_not_completed GO:0045190 ! isotype switching
relationship: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000817
name: precursor B cell
namespace: cell
def: "A precursor B cell is a B cell with the phenotype CD10-positive." [GO_REF:0000031, GOC:rhs, GOC:tfm]
synonym: "pre-B cell" RELATED []
xref: BTO:0001133
xref: CALOHA:TS-0819
is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive
intersection_of: CL:0001201 ! B cell, CD19-positive
intersection_of: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin
disjoint_from: CL:0000826 ! pro-B cell
relationship: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex
relationship: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin

[Term]
id: CL:0000818
name: transitional stage B cell
namespace: cell
def: "An immature B cell of an intermediate stage between the pre-B cell stage and the mature naive stage with the phenotype surface IgM-positive and CD19-positive, and are subject to the process of B cell selection. A transitional B cell migrates from the bone marrow into the peripheral circulation, and then to the spleen." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:12810111, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'transitional B cell'.
synonym: "T1 B cell" NARROW []
synonym: "T2 B cell" NARROW []
synonym: "T3 B cell" NARROW []
synonym: "transitional B cell" EXACT [PMID:22343568]
synonym: "transitional stage B lymphocyte" EXACT []
synonym: "transitional stage B-cell" EXACT []
synonym: "transitional stage B-lymphocyte" EXACT []
is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive
intersection_of: CL:0001201 ! B cell, CD19-positive
intersection_of: has_high_plasma_membrane_amount PR:000001408 ! ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
intersection_of: has_high_plasma_membrane_amount PR:000001932 ! signal transducer CD24
intersection_of: has_not_completed GO:0002335 ! mature B cell differentiation
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: develops_from CL:0000816 ! immature B cell
relationship: has_high_plasma_membrane_amount PR:000001408 ! ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: has_high_plasma_membrane_amount PR:000001932 ! signal transducer CD24
relationship: has_not_completed GO:0002335 ! mature B cell differentiation
relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000819
name: B-1 B cell
namespace: cell
def: "A B cell of distinct lineage and surface marker expression. B-1 B cells are thought to be the primary source of natural IgM immunoglobulin, that is, IgM produced in large quantities without prior antigenic stimulation and generally reactive against various microorganisms, as well as the source of T-independent IgA immunoglobulin in the mucosal areas. These cells are CD43-positive." [GO_REF:0000031, GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/B-1_cell, PMID:11861604, PMID:20933013, PMID:21220451]
comment: There are small numbers of B-1 cells found in the lymph nodes and spleen, while larger numbers can be found in the peritoneal and pleural cavities. B-1 B cells are reportedly CD11b-positive, CD20-positive, CD21-positive, CD27-positive, CD44-positive, CD45RB-positive, CD48-positive, CD70-negative, CD150-positive, CD244-negative, CD352-positive, sIgM-positive, and sIgD-low.
synonym: "B-1 B lymphocyte" EXACT []
synonym: "B-1 B-cell" EXACT []
synonym: "B-1 B-lymphocyte" EXACT []
synonym: "B-1 cell" EXACT []
synonym: "B1 B cell" EXACT []
synonym: "B1 B lymphocyte" EXACT []
synonym: "B1 B-cell" EXACT []
synonym: "B1 B-lymphocyte" EXACT []
synonym: "B1 cell" EXACT []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: capable_of GO:0045087 ! innate immune response
intersection_of: has_high_plasma_membrane_amount GO:0071753 ! IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
intersection_of: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin
relationship: capable_of GO:0045087 ! innate immune response
relationship: has_high_plasma_membrane_amount GO:0071753 ! IgM immunoglobulin complex
relationship: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin

[Term]
id: CL:0000820
name: B-1a B cell
namespace: cell
def: "A B-1 B cell that has the phenotype CD5-positive." [GOC:add, PMID:11861604]
synonym: "B-1a B lymphocyte" EXACT []
synonym: "B-1a B-cell" EXACT []
synonym: "B-1a B-lymphocyte" EXACT []
synonym: "B1a B cell" EXACT []
synonym: "B1a B lymphocyte" EXACT []
synonym: "B1a B-cell" EXACT []
synonym: "B1a B-lymphocyte" EXACT []
synonym: "B1a cell" EXACT []
synonym: "CD5(+) B1 cell" EXACT []
synonym: "CD5+ B1 cell" EXACT []
synonym: "CD5-positive B1 cell" EXACT []
is_a: CL:0000819 {is_inferred="true"} ! B-1 B cell
intersection_of: CL:0000819 ! B-1 B cell
intersection_of: RO:0002104 PR:000001839 ! has plasma membrane part T-cell surface glycoprotein CD5
relationship: RO:0002104 PR:000001839 ! has plasma membrane part T-cell surface glycoprotein CD5

[Term]
id: CL:0000821
name: B-1b B cell
namespace: cell
def: "A B-1 B cell that has the phenotype CD5-negative, but having other phenotypic attributes of a B-1 B cell." [GOC:add, PMID:11861604]
synonym: "B-1b B lymphocyte" EXACT []
synonym: "B-1b B-cell" EXACT []
synonym: "B-1b B-lymphocyte" EXACT []
synonym: "B1b B cell" EXACT []
synonym: "B1b B lymphocyte" EXACT []
synonym: "B1b B-cell" EXACT []
synonym: "B1b B-lymphocyte" EXACT []
synonym: "B1b cell" EXACT []
is_a: CL:0000819 {is_inferred="true"} ! B-1 B cell
intersection_of: CL:0000819 ! B-1 B cell
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5

[Term]
id: CL:0000822
name: B-2 B cell
namespace: cell
def: "A conventional B cell subject to antigenic stimulation and dependent on T cell help and with a distinct surface marker expression pattern from B-1 B cells. These cells are CD43-negative." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0781735149, PMID:11861604, PMID:20933013]
comment: B-2 B cells are reportedly CD48-positive, CD244-negative, and CD352-positive.
synonym: "B-0 B cell" RELATED []
synonym: "B-2 B lymphocyte" EXACT []
synonym: "B-2 B-cell" EXACT []
synonym: "B-2 B-lymphocyte" EXACT []
synonym: "B2 B cell" EXACT []
synonym: "B2 B lymphocyte" EXACT []
synonym: "B2 B-cell" EXACT []
synonym: "B2 B-lymphocyte" EXACT []
synonym: "B2 cell" EXACT []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: lacks_plasma_membrane_part PR:000001879 ! leukosialin
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001879 ! leukosialin
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000823
name: immature natural killer cell
namespace: cell
def: "A natural killer cell that is developmentally immature and expresses natural killer cell receptors (NKR)." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:12457618]
comment: In mouse the NKR are Ly49 molecules and in human these cells express KIR molecules.
synonym: "immature NK cell" EXACT []
synonym: "p-NK" RELATED [PMID:12457618]
is_a: CL:0000623 ! natural killer cell
is_a: CL:0001082 ! immature innate lymphoid cell
intersection_of: CL:0000623 ! natural killer cell
intersection_of: bearer_of PATO:0001501 ! immature
disjoint_from: CL:0000824 ! mature natural killer cell
disjoint_from: CL:0000937 ! pre-natural killer cell
relationship: develops_from CL:0000937 ! pre-natural killer cell

[Term]
id: CL:0000824
name: mature natural killer cell
namespace: cell
def: "A natural killer cell that is developmentally mature and expresses a variety of inhibitory and activating receptors that recognize MHC class I and other stress related molecules." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:14685782]
synonym: "LAK cell" BROAD [PMID:14685782]
synonym: "lymphokine activated killer cell" BROAD [PMID:14685782]
synonym: "mature NK cell" EXACT []
is_a: CL:0000623 ! natural killer cell
relationship: develops_from CL:0000823 ! immature natural killer cell

[Term]
id: CL:0000825
name: pro-NK cell
namespace: cell
def: "A lymphoid progenitor cell that is committed to the natural killer cell lineage, expressing CD122 (IL-15) receptor, but lacking many of the phenotypic characteristics of later stages of natural killer cell development such as expression of NK activating and inhibitory molecules. In human this cell has the phenotype CD34-positive, CD45RA-positive, CD10-positive, CD117-negative, and CD161 negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:11532393, PMID:12457618, PMID:15032583, PMID:15766674]
comment: Most markers only described for human pro NK cells.
synonym: "natural killer cell progenitor" EXACT []
synonym: "NKP" EXACT [PMID:12457618, PMID:15032583, PMID:15766674]
synonym: "null cell" RELATED [PMID:11532393]
synonym: "preNK cell" RELATED [PMID:11532393]
synonym: "pro-natural killer cell" EXACT []
is_a: CARO:0000006
is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell
intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell
intersection_of: lacks_plasma_membrane_part PR:000001874 ! KLRB1-like protein
intersection_of: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor
intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta
intersection_of: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin
relationship: develops_from CL:0000051 ! common lymphoid progenitor
relationship: lacks_plasma_membrane_part PR:000001874 ! KLRB1-like protein
relationship: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor
relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
relationship: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta
relationship: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin

[Term]
id: CL:0000826
name: pro-B cell
namespace: cell
def: "A progenitor cell of the B cell lineage, with some lineage specific activity such as early stages of recombination of B cell receptor genes, but not yet fully committed to the B cell lineage until the expression of PAX5 occurs." [GOC:add, GOC:dsd, ISBN:0781735149, PMID:12633665, PMID:16551251, PMID:18432934]
comment: Human pro-B cells are reportedly CD10-positive, CD22-positive, CD34-positive, CD38-positive, CD45-low, CD48-positive, CD79a-positive, CD127-positive, CD184-positive, RAG-positive, TdT-positive, Vpre-B-positive, pre-BCR-negative, IgD-negative, and IgM-negative. Transcription factors expressed: Pax5-positive, EBF-positive, E2A-negative, Ikaros-negative, and PU.1-negative.
synonym: "pre-B cell (Philadelphia nomenclature)" RELATED [PMID:11244048]
synonym: "pre-pro B cell" BROAD [PMID:17582343]
synonym: "pro-B lymphocyte" EXACT []
synonym: "pro-B-cell" EXACT []
synonym: "pro-B-lymphocyte" EXACT []
synonym: "progenitor B cell" EXACT []
synonym: "progenitor B lymphocyte" EXACT []
synonym: "progenitor B-cell" EXACT []
synonym: "progenitor B-lymphocyte" EXACT []
xref: BTO:0003104
is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell
intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell
intersection_of: has_part PR:000001903 ! paired box protein PAX-5
intersection_of: has_part PR:000006611 ! DNA nucleotidylexotransferase
intersection_of: participates_in GO:0033152 ! immunoglobulin V(D)J recombination
relationship: develops_from CL:0000051 ! common lymphoid progenitor
relationship: has_part PR:000001903 ! paired box protein PAX-5
relationship: has_part PR:000006611 ! DNA nucleotidylexotransferase
relationship: participates_in GO:0033152 ! immunoglobulin V(D)J recombination

[Term]
id: CL:0000827
name: pro-T cell
namespace: cell
def: "A lymphoid progenitor cell of the T cell lineage, with some lineage specific marker expression, but not yet fully committed to the T cell lineage." [GOC:add, ISBN:0781735149]
synonym: "DN1 cell" NARROW []
synonym: "DN1 thymocyte" NARROW []
synonym: "pro-T lymphocyte" EXACT []
synonym: "progenitor T cell" EXACT []
synonym: "TN1 cell" NARROW []
is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell
intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell
intersection_of: capable_of GO:0030217 ! T cell differentiation
relationship: capable_of GO:0030217 ! T cell differentiation
relationship: develops_from CL:0000051 ! common lymphoid progenitor

[Term]
id: CL:0000828
name: thromboblast
namespace: cell
def: "A progenitor cell of the thrombocyte, a nucleated blood cell involved in coagulation typically seen in birds and other non-mammalian vertebrates." [GOC:add, GOC:tfm, PMID:7758949]
comment: Note that this is a non-mammalian cell type.
is_a: CL:0000226 ! single nucleate cell
is_a: CL:0000763 ! myeloid cell
is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell
intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell
intersection_of: bearer_of PATO:0001407 ! mononucleate
intersection_of: capable_of GO:0002574 ! thrombocyte differentiation
relationship: capable_of GO:0002574 ! thrombocyte differentiation
relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell

[Term]
id: CL:0000829
name: basophilic myeloblast
namespace: cell
def: "A myeloblast committed to the basophil lineage." [GOC:add, ISBN:0721601464]
is_a: CL:0000835 {is_inferred="true"} ! myeloblast
intersection_of: CL:0000835 ! myeloblast
intersection_of: capable_of GO:0030221 ! basophil differentiation
relationship: capable_of GO:0030221 ! basophil differentiation
relationship: develops_from CL:0000613 ! basophil progenitor cell

[Term]
id: CL:0000830
name: basophilic promyelocyte
namespace: cell
def: "A promyelocyte committed to the basophil lineage." [GOC:add, ISBN:0721601464]
xref: FMA:84208
is_a: CL:0000836 {is_inferred="true"} ! promyelocyte
intersection_of: CL:0000836 ! promyelocyte
intersection_of: capable_of GO:0030221 ! basophil differentiation
relationship: capable_of GO:0030221 ! basophil differentiation
relationship: develops_from CL:0000829 ! basophilic myeloblast

[Term]
id: CL:0000831
name: mast cell progenitor
namespace: cell
def: "A progenitor cell of the mast cell lineage. Markers for this cell are FceRIa-low, CD117-positive, CD9-positive, T1/ST2-positive, SCA1-negative, and lineage-negative." [GOC:add, GOC:dsd, http://www.copewithcytokines.de, PMCID:PMC1183570, PMCID:PMC1312421, PMID:8629001, PMID:9354811]
comment: MCP are CD16-positive, CD32-positive, CD34-positive, CD45-positive, integrin beta-7-positive, and lin-negative (CD2, CD3e, CD4, CD5, CD8a, CD14, CD19, CD20, CD27, integrin alpha-M, ly6c, ly6g, NCAM-1, and ter119). These cells also express the transcription factors GATA-1, GATA-2, and MITF, but not C/EBPa.
synonym: "CFU-Mast" RELATED []
synonym: "CFU-MC" RELATED []
synonym: "colony forming unit mast cell" RELATED []
synonym: "MCP" EXACT []
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell
intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell
intersection_of: capable_of GO:0060374 ! mast cell differentiation
intersection_of: has_high_plasma_membrane_amount PR:000009143 ! integrin beta-7
intersection_of: has_low_plasma_membrane_amount PR:000002065 ! mast/stem cell growth factor receptor
intersection_of: has_low_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
intersection_of: has_part PR:000007857 ! erythroid transcription factor
intersection_of: has_part PR:000007858 ! endothelial transcription factor GATA-2
intersection_of: lacks_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002979 ! lymphocyte antigen 6A-2/6E-1
intersection_of: lacks_plasma_membrane_part PR:000002980 ! lymphocyte antigen 6C2
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
intersection_of: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule
intersection_of: RO:0002104 PR:000016401 ! has plasma membrane part transmembrane emp24 domain-containing protein 1
relationship: capable_of GO:0060374 ! mast cell differentiation
relationship: develops_from CL:0002028 ! basophil mast progenitor cell
relationship: has_high_plasma_membrane_amount PR:000009143 ! integrin beta-7
relationship: has_low_plasma_membrane_amount PR:000002065 ! mast/stem cell growth factor receptor
relationship: has_low_plasma_membrane_amount PR:000007431 ! high affinity immunoglobulin epsilon receptor subunit alpha
relationship: has_part PR:000007857 ! erythroid transcription factor
relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2
relationship: lacks_part PR:000005307 ! CCAAT/enhancer-binding protein alpha
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002979 ! lymphocyte antigen 6A-2/6E-1
relationship: lacks_plasma_membrane_part PR:000002980 ! lymphocyte antigen 6C2
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule
relationship: RO:0002104 PR:000016401 ! has plasma membrane part transmembrane emp24 domain-containing protein 1

[Term]
id: CL:0000832
name: eosinophilic myeloblast
namespace: cell
def: "A myeloblast committed to the eosinophil lineage." [GOC:add, ISBN:0721601464]
is_a: CL:0000835 {is_inferred="true"} ! myeloblast
intersection_of: CL:0000835 ! myeloblast
intersection_of: capable_of GO:0030222 ! eosinophil differentiation
relationship: capable_of GO:0030222 ! eosinophil differentiation
relationship: develops_from CL:0000611 ! eosinophil progenitor cell

[Term]
id: CL:0000833
name: eosinophilic promyelocyte
namespace: cell
def: "A promyelocyte committed to the eosinophil lineage." [GOC:add, ISBN:0721601464]
xref: FMA:84199
is_a: CL:0000836 {is_inferred="true"} ! promyelocyte
intersection_of: CL:0000836 ! promyelocyte
intersection_of: capable_of GO:0030222 ! eosinophil differentiation
relationship: capable_of GO:0030222 ! eosinophil differentiation
relationship: develops_from CL:0000832 ! eosinophilic myeloblast

[Term]
id: CL:0000834
name: neutrophil progenitor cell
namespace: cell
def: "A progenitor cell of the neutrophil lineage." [GOC:add, GOC:tfm, ISBN:0721601464]
synonym: "neutrophil stem cell" RELATED []
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell
intersection_of: CL:0002191 ! granulocytopoietic cell
intersection_of: capable_of GO:0030223 ! neutrophil differentiation
relationship: capable_of GO:0030223 ! neutrophil differentiation
relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell

[Term]
id: CL:0000835
name: myeloblast
namespace: cell
def: "The most primitive precursor in the granulocytic series, having fine, evenly distributed chromatin, several nucleoli, a high nuclear-to-cytoplasmic ration (5:1-7:1), and a nongranular basophilic cytoplasm. They reside in the bone marrow." [GOC:add, http://en.wikipedia.org/wiki/Myeloblast, http://www.cap.org, ISBN:0721601464]
xref: BTO:0000187
xref: FMA:83524
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell
intersection_of: CL:0002191 ! granulocytopoietic cell
intersection_of: has_part CL:0017503 ! basophilic cytoplasm
intersection_of: has_part CL:0017505 ! increased nucleus size
intersection_of: has_part GO:0000791 ! euchromatin
intersection_of: lacks_part GO:0042582 ! azurophil granule
relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell
relationship: has_part CL:0017503 ! basophilic cytoplasm
relationship: has_part CL:0017505 ! increased nucleus size
relationship: has_part GO:0000791 ! euchromatin
relationship: lacks_part GO:0042582 ! azurophil granule

[Term]
id: CL:0000836
name: promyelocyte
namespace: cell
def: "A precursor in the granulocytic series, being a cell intermediate in development between a myeloblast and myelocyte, that has distinct nucleoli, a nuclear-to-cytoplasmic ratio of 5:1 to 3:1, and containing a few primary cytoplasmic granules. Markers for this cell are fucosyltransferase FUT4-positive, CD33-positive, integrin alpha-M-negative, low affinity immunoglobulin gamma Fc region receptor III-negative, and CD24-negative." [GOC:add, GOC:amm, GOC:tfm, http://www.cap.org, ISBN:0721601464]
xref: CALOHA:TS-0825
xref: FMA:83530
is_a: CARO:0000006
is_a: CL:0000763 ! myeloid cell
is_a: CL:0002191 ! granulocytopoietic cell
intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell
intersection_of: has_part CL:0017503 ! basophilic cytoplasm
intersection_of: has_part CL:0017505 ! increased nucleus size
intersection_of: has_part GO:0005730 ! nucleolus
intersection_of: has_part GO:0042582 ! azurophil granule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
intersection_of: lacks_plasma_membrane_part PR:000001932 ! signal transducer CD24
intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule
relationship: develops_from CL:0000835 ! myeloblast
relationship: has_part CL:0017503 ! basophilic cytoplasm
relationship: has_part CL:0017505 ! increased nucleus size
relationship: has_part GO:0005730 ! nucleolus
relationship: has_part GO:0042582 ! azurophil granule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
relationship: lacks_plasma_membrane_part PR:000001932 ! signal transducer CD24
relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4
relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule

[Term]
id: CL:0000837
name: hematopoietic multipotent progenitor cell
namespace: cell
def: "A hematopoietic multipotent progenitor cell is multipotent, but not capable of long-term self-renewal. These cells are characterized as lacking lineage cell surface markers and being CD34-positive in both mice and humans." [GOC:add, GOC:tfm, PMID:19022770]
comment: Markers differ between mouse and human.
synonym: "hemopoietic progenitor cell" EXACT []
synonym: "MPP" EXACT []
xref: BTO:0000725
xref: CALOHA:TS-0448
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CARO:0000006
is_a: CL:0008001 ! hematopoietic precursor cell
intersection_of: CL:0000988 ! hematopoietic cell
intersection_of: bearer_of PATO:0001402 ! multipotent
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
disjoint_from: CL:0002032 ! hematopoietic oligopotent progenitor cell
relationship: bearer_of PATO:0001402 ! multipotent
relationship: develops_from CL:0000037 ! hematopoietic stem cell
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule
relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G
relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse)
relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule

[Term]
id: CL:0000838
name: lymphoid lineage restricted progenitor cell
namespace: cell
def: "A progenitor cell restricted to the lymphoid lineage." [GOC:add, GOC:tfm]
comment: Note that this is a class of cell types, not an identified single cell type.
synonym: "lymphoid progenitor cell" BROAD []
xref: BTO:0004731
xref: CALOHA:TS-2025
xref: FMA:70338
is_a: CL:0002031 {is_inferred="true"} ! hematopoietic lineage restricted progenitor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0002031 ! hematopoietic lineage restricted progenitor cell
intersection_of: capable_of GO:0030098 ! lymphocyte differentiation
disjoint_from: CL:0000839 ! myeloid lineage restricted progenitor cell
relationship: capable_of GO:0030098 ! lymphocyte differentiation

[Term]
id: CL:0000839
name: myeloid lineage restricted progenitor cell
namespace: cell
def: "A progenitor cell restricted to the myeloid lineage." [GOC:add, GOC:tfm, PMID:19022770]
comment: Note that this is a class of cell types, not an identified single cell type.
synonym: "myeloid progenitor cell" BROAD []
xref: BTO:0004730
xref: CALOHA:TS-2099
xref: FMA:70339
is_a: CL:0002031 {is_inferred="true"} ! hematopoietic lineage restricted progenitor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0002031 ! hematopoietic lineage restricted progenitor cell
intersection_of: capable_of GO:0030099 ! myeloid cell differentiation
relationship: capable_of GO:0030099 ! myeloid cell differentiation

[Term]
id: CL:0000840
name: immature conventional dendritic cell
namespace: cell
def: "An immature cell of the conventional dendritic cell lineage, characterized by high levels of antigen uptake via endocytosis, macropinocytosis, and phagocytosis, and typically found resident in the tissues. Markers for this cell are CD80-low, CD86-low, and MHC-II-low." [GOC:add, GOC:tfm, PMID:9521319]
synonym: "immature myeloid dendritic cell" NARROW []
is_a: CL:0000766 ! myeloid leukocyte
is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell
intersection_of: CL:0000990 ! conventional dendritic cell
intersection_of: has_low_plasma_membrane_amount GO:0042613 ! MHC class II protein complex
intersection_of: has_low_plasma_membrane_amount PR:000001412 ! CD86 molecule
intersection_of: has_low_plasma_membrane_amount PR:000001438 ! CD80 molecule
relationship: develops_from CL:0001029 ! common dendritic progenitor
relationship: has_low_plasma_membrane_amount GO:0042613 ! MHC class II protein complex
relationship: has_low_plasma_membrane_amount PR:000001412 ! CD86 molecule
relationship: has_low_plasma_membrane_amount PR:000001438 ! CD80 molecule

[Term]
id: CL:0000841
name: mature conventional dendritic cell
namespace: cell
def: "A mature cell of the conventional dendritic cell lineage, characterized by a high capacity for antigen presentation and typically found in a lymph node." [GOC:add, GOC:tfm, PMID:9521319]
synonym: "mature dendritic cell" BROAD [GOC:add]
synonym: "mature myeloid dendritic cell" NARROW []
xref: FMA:83038
is_a: CL:0000766 ! myeloid leukocyte
is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell
intersection_of: CL:0000990 ! conventional dendritic cell
intersection_of: has_high_plasma_membrane_amount GO:0042613 ! MHC class II protein complex
intersection_of: has_high_plasma_membrane_amount PR:000001412 ! CD86 molecule
intersection_of: has_high_plasma_membrane_amount PR:000001438 ! CD80 molecule
intersection_of: RO:0002104 PR:000001310 ! has plasma membrane part CD83 molecule
relationship: develops_from CL:0000840 ! immature conventional dendritic cell
relationship: has_high_plasma_membrane_amount GO:0042613 ! MHC class II protein complex
relationship: has_high_plasma_membrane_amount PR:000001412 ! CD86 molecule
relationship: has_high_plasma_membrane_amount PR:000001438 ! CD80 molecule
relationship: RO:0002104 PR:000001310 ! has plasma membrane part CD83 molecule

[Term]
id: CL:0000842
name: mononuclear cell
namespace: cell
def: "A leukocyte with a single non-segmented nucleus in the mature form." [GOC:add]
synonym: "mononuclear leukocyte" EXACT []
synonym: "peripheral blood mononuclear cell" NARROW []
xref: BTO:0000878
xref: CALOHA:TS-0768
xref: FMA:86713
is_a: CL:0000226 ! single nucleate cell
is_a: CL:0000738 {is_inferred="true"} ! leukocyte
intersection_of: CL:0000738 ! leukocyte
intersection_of: bearer_of PATO:0001407 ! mononucleate

[Term]
id: CL:0000843
name: follicular B cell
namespace: cell
def: "A resting mature B cell that has the phenotype IgM-positive, IgD-positive, CD23-positive and CD21-positive, and found in the B cell follicles of the white pulp of the spleen or the corticol areas of the peripheral lymph nodes. This cell type is also described as being CD19-positive, B220-positive, AA4-negative, CD43-negative, and CD5-negative." [GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Follicular_B_Cells, ISBN:0781735149, PMCID:PMC2193793, PMID:20933013]
comment: Follicular B cells are also reportedly CD48-positive, CD84-positive, CD229-positive, and CD352-positive.
synonym: "Fo B cell" EXACT []
synonym: "Fo B-cell" EXACT []
synonym: "follicular B lymphocyte" EXACT []
synonym: "follicular B-cell" EXACT []
synonym: "follicular B-lymphocyte" EXACT []
is_a: CL:0000822 ! B-2 B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: lacks_plasma_membrane_part PR:000001879 ! leukosialin
intersection_of: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
relationship: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC
relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2

[Term]
id: CL:0000844
name: germinal center B cell
namespace: cell
def: "A rapidly cycling mature B cell that has distinct phenotypic characteristics and is involved in T-dependent immune responses and located typically in the germinal centers of lymph nodes. This cell type expresses Ly77 after activation." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0781735149, PMID:19447676, PMID:20933013]
comment: Germinal center B cells are also reportedly CD10-positive, CD19-positive, CD20-positive, CD38-positive, CD44-low, CD45-positive, CD48-positive, CD95-positive, CD352-positive, and HLA-DR-positive. Transcription factors: BCL6-positive, Ets1-positive, IRF8-positive, MTA3-positive, OBF1-positive, PAX5-positive, SpiB-positive, and STAT3-positive.
synonym: "GC B cell" EXACT []
synonym: "GC B lymphocyte" EXACT []
synonym: "GC B-cell" EXACT []
synonym: "GC B-lymphocyte" EXACT []
synonym: "germinal center B lymphocyte" EXACT []
synonym: "germinal center B-cell" EXACT []
synonym: "germinal center B-lymphocyte" EXACT []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
intersection_of: CL:0000785 ! mature B cell
intersection_of: part_of UBERON:0001745 ! secondary nodular lymphoid tissue
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: develops_from CL:0000843 ! follicular B cell
relationship: part_of UBERON:0001745 ! secondary nodular lymphoid tissue
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000845
name: marginal zone B cell of spleen
namespace: cell
def: "A mature B cell that is located in the marginal zone of the spleen with the phenotype CD23-negative and CD21-positive and expressing a B cell receptor usually reactive to bacterial cell wall components or senescent self components such as oxidized-LDL. This cell type is also described as being CD19-positive, B220-positive, IgM-high, AA4-negative, CD35-high." [GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Marginal-zone_B_cell, ISBN:0781735149, PMID:10933592, PMID:20933013]
comment: MZ B cells are reportedly CD1-positive (mice), CD20-positive, CD48-positive, CD84-positive, CD150-positive, CD229-positive, and CD352-positive.
synonym: "B cell of marginal zone of spleen" EXACT []
synonym: "marginal zone B cell" BROAD []
synonym: "marginal zone B lymphocyte" BROAD []
synonym: "marginal zone B-cell" BROAD []
synonym: "marginal zone B-lymphocyte" BROAD []
synonym: "marginal zone of spleen B cell" EXACT []
synonym: "MZ B cell" BROAD []
synonym: "MZ B lymphocyte" BROAD []
synonym: "MZ B-cell" BROAD []
synonym: "MZ B-lymphocyte" BROAD []
is_a: CL:0000785 {is_inferred="true"} ! mature B cell
is_a: CL:2000074 ! splenocyte
intersection_of: CL:0000785 ! mature B cell
intersection_of: capable_of GO:0042742 ! defense response to bacterium
intersection_of: has_high_plasma_membrane_amount GO:0071753 ! IgM immunoglobulin complex
intersection_of: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
intersection_of: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor
intersection_of: part_of UBERON:0001251 ! marginal zone of spleen
intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
relationship: capable_of GO:0042742 ! defense response to bacterium
relationship: has_high_plasma_membrane_amount GO:0071753 ! IgM immunoglobulin complex
relationship: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
relationship: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor
relationship: part_of UBERON:0001251 ! marginal zone of spleen
relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1
relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2

[Term]
id: CL:0000846
name: vestibular dark cell
namespace: cell
def: "An epithelial cell of the vestibular sensory organ that is characterized by intense enzymatic activities and numerous basal membrane infoldings." [PMID:11223304]
is_a: CL:0000066 ! epithelial cell
is_a: CL:0002371 ! somatic cell

[Term]
id: CL:0000847
name: ciliated olfactory receptor neuron
namespace: cell
def: "An olfactory receptor cell in which the apical ending of the dendrite is a pronounced ciliated olfactory knob." [PMID:16841163]
synonym: "ciliated olfactory sensory neuron" EXACT []
synonym: "ciliated sensory neuron" EXACT []
is_a: CL:0000064 ! ciliated cell
is_a: CL:0000207 ! olfactory receptor cell
intersection_of: CL:0000207 ! olfactory receptor cell
intersection_of: has_part GO:0005929 ! cilium

[Term]
id: CL:0000848
name: microvillous olfactory receptor neuron
namespace: cell
def: "An olfactory receptor cell in which the apical ending of the dendrite is a knob that bears numerous microvilli." [PMID:16841163]
synonym: "microvillous olfactory sensory neuron" EXACT []
synonym: "microvillous sensory neuron" RELATED []
is_a: CL:0000207 ! olfactory receptor cell

[Term]
id: CL:0000849
name: crypt olfactory receptor neuron
namespace: cell
def: "An olfactory receptor cell with short cilia growing in an invagination bordered by microvilli." [PMID:16841163]
synonym: "crypt cell" EXACT []
synonym: "crypt olfactory sensory neuron" EXACT []
synonym: "crypt sensory neuron" EXACT []
is_a: CL:0000207 ! olfactory receptor cell

[Term]
id: CL:0000850
name: serotonergic neuron
namespace: cell
alt_id: CL:0000403
def: "A neuron that releases serotonin as a neurotransmitter." [SANBI:mhl]
synonym: "5-HT neuron" EXACT []
synonym: "5-hydroxytryptamine neuron" EXACT []
synonym: "serotinergic neuron" RELATED []
xref: FBbt:00005133
xref: WBbt:0006837
is_a: CL:0000458 ! serotonin secreting cell
is_a: CL:0000540 ! neuron
intersection_of: CL:0000540 ! neuron
intersection_of: capable_of GO:0060096 ! serotonin secretion, neurotransmission
relationship: capable_of GO:0060096 ! serotonin secretion, neurotransmission

[Term]
id: CL:0000851
name: neuromast mantle cell
namespace: cell
def: "Neuromast mantle cell is a non-sensory cell. Neuromast mantle cells surround the neuromast support cells and neuromast hair cells, separating the neuromast from the epidermis, and secrete cupula in which the ciliary bundles of all the hair cells are embedded." [ISBN:0125296509]
is_a: CL:0000151 ! secretory cell
disjoint_from: CL:0000855 ! sensory hair cell
relationship: part_of UBERON:0008904 ! neuromast

[Term]
id: CL:0000852
name: neuromast supporting cell
namespace: cell
def: "Neuromast support cell is a non-sensory cell of the neuromast that extend between the sensory hair cells from the basement membrane to the apical surface; neuromast support cells are surrounded by neuromast mantle cells." [ISBN:0125296509]
synonym: "neuromast support cell" EXACT []
is_a: BFO:0000004 ! independent continuant
is_a: CL:0000630 ! supporting cell
disjoint_from: CL:0000855 ! sensory hair cell
relationship: part_of UBERON:0008904 ! neuromast

[Term]
id: CL:0000853
name: olfactory epithelial supporting cell
namespace: cell
def: "Olfactory epithelial support cell is a columnar cell that extends from the epithelial free margin to the basement membrane of the olfactory epithelium. This cell type has a large, vertically, elongate, euchromatic nucleus, along with other nuclei, forms a layer superficial to the cell body of the receptor cell; sends long somewhat irregular microvilli into the mucus layer; at the base, with expanded end-feet containing numerous lamellated dense bodies resembling lipofuscin of neurons." [GOC:tfm, ISBN:0517223651, SANBI:mhl]
synonym: "olfactory epithelial support cell" EXACT []
synonym: "olfactory sustentacular cell" EXACT []
synonym: "supporting cell of olfactory epithelium" EXACT []
synonym: "sustentaculocyte of olfactory epithelium" EXACT []
xref: FMA:62302
is_a: CL:0000630 ! supporting cell
is_a: CL:0002169 ! basal cell of olfactory epithelium
intersection_of: CL:0000630 ! supporting cell
intersection_of: part_of UBERON:0001997 ! olfactory epithelium

[Term]
id: CL:0000854
name: interneuromast cell
namespace: cell
def: "Interneuromast cell is a neuroectodermal cell deposited by the migrating lateral line primordium between the neuromasts. Interneuromast cells proliferate and migrate to form additional neuromasts." [SANBI:mhl]
is_a: CARO:0000000
is_a: CL:0000133 ! neurectodermal cell
relationship: develops_from CL:0000032 ! neuroplacodal cell

[Term]
id: CL:0000855
name: sensory hair cell
namespace: cell
def: "Hair cell is a mechanoreceptor cell that is sensitive to movement of the hair-like projections (stereocilia and kinocilia) which relay the information centrally in the nervous system." [SANBI:mhl]
synonym: "hair cell" BROAD []
xref: BTO:0004744
is_a: CL:0000199 ! mechanoreceptor cell

[Term]
id: CL:0000856
name: neuromast hair cell
namespace: cell
def: "Neuromast hair cell is a hair cell that acts as a sensory receptor of the neuromast; it is morphologically polarized as a result of the relative position of the single kinocilium and the clusters of stereocilia on its apical surface." [SANBI:mhl]
is_a: CARO:0000000
is_a: CL:0000006 ! neuronal receptor cell
is_a: CL:0000855 ! sensory hair cell
intersection_of: CL:0000855 ! sensory hair cell
intersection_of: part_of UBERON:0008904 ! neuromast
relationship: part_of UBERON:0008904 ! neuromast

[Term]
id: CL:0000857
name: slow muscle myoblast
namespace: cell
def: "A skeletal muscle myoblast that differentiates into slow muscle fibers." [SANBI:mhl]
is_a: CL:0000515 ! skeletal muscle myoblast
intersection_of: CL:0000056 ! myoblast
intersection_of: develops_into CL:0000189 ! slow muscle cell
relationship: develops_into CL:0000189 ! slow muscle cell

[Term]
id: CL:0000858
name: fast muscle myoblast
namespace: cell
def: "A skeletal muscle myoblast that differentiates into fast muscle fibers." [SANBI:mhl]
is_a: CL:0000515 ! skeletal muscle myoblast
intersection_of: CL:0000056 ! myoblast
intersection_of: develops_into CL:0000190 ! fast muscle cell
relationship: develops_into CL:0000190 ! fast muscle cell

[Term]
id: CL:0000860
name: classical monocyte
namespace: cell
def: "A monocyte that responds rapidly to microbial stimuli by secreting cytokines and antimicrobial factors and which is characterized by high expression of CCR2 in both rodents and humans, negative for the lineage markers CD3, CD19, and CD20, and of larger size than non-classical monocytes." [GO_REF:0000031, GOC:add, PMID:16322748, PMID:18303997, PMID:20628149, PMID:20870168]
comment: Markers: CCR2+CXCCR1<low> (human, mouse, rat).
synonym: "inflammatory monocyte" EXACT []
is_a: CARO:0000006
is_a: CL:0000234 ! phagocyte
is_a: CL:0000576 {is_inferred="true"} ! monocyte
intersection_of: CL:0000576 ! monocyte
intersection_of: capable_of GO:0002548 ! monocyte chemotaxis
intersection_of: capable_of GO:0006909 ! phagocytosis
intersection_of: capable_of GO:0006954 ! inflammatory response
intersection_of: has_high_plasma_membrane_amount PR:000001199 ! C-C chemokine receptor type 2
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: capable_of GO:0002548 ! monocyte chemotaxis
relationship: capable_of GO:0006954 ! inflammatory response
relationship: has_high_plasma_membrane_amount PR:000001199 ! C-C chemokine receptor type 2
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000861
name: elicited macrophage
namespace: cell
def: "A macrophage which develops from an inflammatory monocyte and is recruited into the tissues in response to injury and infection as part of an inflammatory response. Markers include CD11b-positive, CD68-positive, and F4/80-positive." [GO_REF:0000031, GOC:add, GOC:ana, GOC:tfm, PMID:15771589]
comment: Markers: CD11b+, CD68+; Mouse: F4/80+; role or process: immune, inflammation (inflammatory response).
synonym: "free macrophage" EXACT []
synonym: "wandering histiocyte" EXACT []
xref: FMA:84643
xref: FMA:84645
is_a: CARO:0000006
is_a: CL:0000235 {is_inferred="true"} ! macrophage
intersection_of: CL:0000235 ! macrophage
intersection_of: participates_in GO:0006954 ! inflammatory response
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: develops_from CL:0000860 ! classical monocyte
relationship: participates_in GO:0006954 ! inflammatory response
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin

[Term]
id: CL:0000862
name: suppressor macrophage
namespace: cell
def: "A macrophage that suppresses immune responses." [GOC:add, GOC:tfm, PMID:20402419]
comment: Markers: May express: IL10, TGFbeta.
is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage
intersection_of: CL:0000861 ! elicited macrophage
intersection_of: capable_of GO:0050777 ! negative regulation of immune response
relationship: capable_of GO:0050777 ! negative regulation of immune response

[Term]
id: CL:0000863
name: inflammatory macrophage
namespace: cell
def: "An elicited macrophage that is recruited into the tissues in response to injury and infection as part of an inflammatory response, expresses high levels of pro-inflammatory cytokines, ROS and NO, and shows potent microbicidal activity." [GO_REF:0000031, GOC:ana, PMID:19132917]
comment: Markers: Express: TNFa, IL1b, IL6, iNOS, NADPH-oxidase; produce: reactive oxygen species, nitric oxide; role or process: immune, inflammation (inflammatory response).
synonym: "classically activated macrophage" EXACT []
synonym: "M1 macrophage" RELATED []
is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage
intersection_of: CL:0000861 ! elicited macrophage
intersection_of: capable_of GO:0032611 ! interleukin-1 beta production
intersection_of: capable_of GO:0032635 ! interleukin-6 production
intersection_of: capable_of GO:0032640 ! tumor necrosis factor production
intersection_of: capable_of GO:0042554 ! superoxide anion generation
intersection_of: capable_of GO:0042742 ! defense response to bacterium
intersection_of: capable_of GO:0051767 ! nitric-oxide synthase biosynthetic process
relationship: capable_of GO:0032611 ! interleukin-1 beta production
relationship: capable_of GO:0032635 ! interleukin-6 production
relationship: capable_of GO:0032640 ! tumor necrosis factor production
relationship: capable_of GO:0042554 ! superoxide anion generation
relationship: capable_of GO:0042742 ! defense response to bacterium
relationship: capable_of GO:0051767 ! nitric-oxide synthase biosynthetic process

[Term]
id: CL:0000864
name: tissue-resident macrophage
namespace: cell
def: "A macrophage constitutively resident in a particular tissue under non-inflammatory conditions, and capable of phagocytosing a variety of extracellular particulate material, including immune complexes, microorganisms, and dead cells." [GO_REF:0000031, GOC:ana, PMID:19770654]
synonym: "fixed macrophage" EXACT []
synonym: "resting histiocyte" EXACT []
xref: FMA:84642
xref: FMA:84644
is_a: CL:0000235 {is_inferred="true"} ! macrophage
intersection_of: CL:0000235 ! macrophage
intersection_of: part_of UBERON:0000479 ! tissue
relationship: part_of UBERON:0000479 ! tissue

[Term]
id: CL:0000865
name: gastrointestinal tract (lamina propria) macrophage
namespace: cell
def: "A gut-associated lymphoid tissue macrophage found in lamina propria of the gut." [GO_REF:0000031, GOC:ana, GOC:tfm, https://orcid.org/0000-0002-2825-0621]
synonym: "gastrointestinal system (lamina propria) macrophage" EXACT []
synonym: "macrophage of gastrointestinal system (lamina propria)" EXACT []
synonym: "macrophage of gastrointestinal tract (lamina propria)" EXACT []
is_a: CL:0000885 ! gut-associated lymphoid tissue macrophage
intersection_of: CL:0000885 ! gut-associated lymphoid tissue macrophage
intersection_of: part_of UBERON:0004780 ! gastrointestinal system lamina propria
relationship: part_of UBERON:0004780 ! gastrointestinal system lamina propria

[Term]
id: CL:0000866
name: thymic macrophage
namespace: cell
def: "A tissue-resident macrophage resident found in the thymus, involved in the clearance of apoptotic thymocytes." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:9048205]
comment: Role or process: immune, clearance of apoptotic thymocytes, antigen-presentation.
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: capable_of GO:0043277 ! apoptotic cell clearance
intersection_of: part_of UBERON:0002370 ! thymus
relationship: capable_of GO:0043277 ! apoptotic cell clearance
relationship: part_of UBERON:0002370 ! thymus

[Term]
id: CL:0000867
name: secondary lymphoid organ macrophage
namespace: cell
def: "A tissue-resident macrophage found in a secondary lymphoid organ." [GO_REF:0000031, GOC:ana, GOC:tfm]
is_a: CL:0000864 ! tissue-resident macrophage

[Term]
id: CL:0000868
name: lymph node macrophage
namespace: cell
def: "A secondary lymphoid organ macrophage found in a lymph node. This cell is CD169-high." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:11971865]
comment: Marker was observed on rat cells.
synonym: "MF.LN" EXACT []
is_a: CARO:0000006
is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage
intersection_of: CL:0000867 ! secondary lymphoid organ macrophage
intersection_of: has_high_plasma_membrane_amount PR:000001931 ! sialoadhesin
intersection_of: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
intersection_of: has_low_plasma_membrane_amount PR:000001813 ! adhesion G protein-coupled receptor E1
intersection_of: part_of UBERON:0000029 ! lymph node
relationship: has_high_plasma_membrane_amount PR:000001931 ! sialoadhesin
relationship: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
relationship: has_low_plasma_membrane_amount PR:000001813 ! adhesion G protein-coupled receptor E1
relationship: part_of UBERON:0000029 ! lymph node

[Term]
id: CL:0000869
name: tonsillar macrophage
namespace: cell
def: "A gut-associated lymphoid tissue macrophage found in tonsils." [GO_REF:0000031, GOC:ana, PMID:16048540]
is_a: CL:0000885 ! gut-associated lymphoid tissue macrophage
intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage
intersection_of: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue
intersection_of: part_of UBERON:0002372 ! tonsil
relationship: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue
relationship: part_of UBERON:0002372 ! tonsil

[Term]
id: CL:0000870
name: Peyer's patch macrophage
namespace: cell
def: "A gut-associated lymphoid tissue macrophage found in the Peyer's patches." [GO_REF:0000031, GOC:ana, GOC:tfm]
is_a: CL:0000885 {is_inferred="true"} ! gut-associated lymphoid tissue macrophage
intersection_of: CL:0000885 ! gut-associated lymphoid tissue macrophage
intersection_of: part_of UBERON:0001211 ! Peyer's patch
relationship: part_of UBERON:0001211 ! Peyer's patch

[Term]
id: CL:0000871
name: splenic macrophage
namespace: cell
def: "A secondary lymphoid organ macrophage found in the spleen." [GO_REF:0000031, PMID:15771589, PMID:16322748]
comment: Role or process: immune, clearance of apoptotic and senescent cells.
xref: FMA:83026
is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage
is_a: CL:2000074 ! splenocyte
intersection_of: CL:0000867 ! secondary lymphoid organ macrophage
intersection_of: capable_of GO:0034102 ! erythrocyte clearance
intersection_of: part_of UBERON:0002106 ! spleen
relationship: capable_of GO:0034102 ! erythrocyte clearance

[Term]
id: CL:0000872
name: splenic marginal zone macrophage
namespace: cell
def: "A splenic macrophage found in the marginal zone of the spleen, involved in recognition and clearance of particulate material from the splenic circulation. Markers include F4/80-negative, MARCO-positive, SR-A-positive, SIGN-R1-positive, and Dectin2-positive." [GO_REF:0000031, GOC:ana, PMID:16861066]
comment: Markers: Mouse: F4/80-, MARCO+, SR-A+, SIGN-R1+, Dectin2+.
is_a: CARO:0000006
is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage
intersection_of: CL:0000871 ! splenic macrophage
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: part_of UBERON:0001251 ! marginal zone of spleen
intersection_of: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A
intersection_of: RO:0002104 PR:000001884 ! has plasma membrane part macrophage receptor MARCO
intersection_of: RO:0002104 PR:000001885 ! has plasma membrane part macrophage scavenger receptor types I and II
intersection_of: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: part_of UBERON:0001251 ! marginal zone of spleen
relationship: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A
relationship: RO:0002104 PR:000001884 ! has plasma membrane part macrophage receptor MARCO
relationship: RO:0002104 PR:000001885 ! has plasma membrane part macrophage scavenger receptor types I and II
relationship: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B

[Term]
id: CL:0000873
name: splenic metallophillic macrophage
namespace: cell
def: "A splenic macrophage found in the areas surrounding the white pulp of the spleen, adjacent to the marginal sinus. Markers include F4/80-negative, Dectin2-low, sialoadhesin-positive." [GO_REF:0000031, GOC:ana, PMID:20018690]
comment: Markers: Mouse: F4/80-, Dectin2-low, sialoadhesin+.
is_a: CARO:0000006
is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage
intersection_of: CL:0000871 ! splenic macrophage
intersection_of: adjacent_to UBERON:0001959 ! white pulp of spleen
intersection_of: has_low_plasma_membrane_amount PR:000001806 ! C-type lectin domain family 6 member A
intersection_of: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1
intersection_of: part_of UBERON:0001251 ! marginal zone of spleen
intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin
relationship: adjacent_to UBERON:0001959 ! white pulp of spleen
relationship: has_low_plasma_membrane_amount PR:000001806 ! C-type lectin domain family 6 member A
relationship: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1
relationship: part_of UBERON:0001251 ! marginal zone of spleen
relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin

[Term]
id: CL:0000874
name: splenic red pulp macrophage
namespace: cell
def: "A splenic macrophage found in the red-pulp of the spleen, and involved in immune responses to blood-borne pathogens and in the clearance of senescent erythrocytes. Markers include F4/80-positive, CD68-positive, MR-positive, Dectin2-positive, macrosialin-positive, and sialoadhesin-low." [GO_REF:0000031, GOC:ana, PMID:19644016]
comment: Markers: Mouse: F4/80+, CD68+, MR+, Dectin2+, macrosialin+, sialoadhesin-low; role or process: immune, clearance of senescent erythrocytes.
is_a: CARO:0000006
is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage
intersection_of: CL:0000871 ! splenic macrophage
intersection_of: capable_of GO:0006955 ! immune response
intersection_of: capable_of GO:0034102 ! erythrocyte clearance
intersection_of: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
intersection_of: has_low_plasma_membrane_amount PR:000001931 ! sialoadhesin
intersection_of: lacks_plasma_membrane_part PR:000001013 ! integrin alpha-X
intersection_of: part_of UBERON:0001250 ! red pulp of spleen
intersection_of: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A
intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
intersection_of: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1
relationship: capable_of GO:0006955 ! immune response
relationship: has_low_plasma_membrane_amount PR:000001012 ! integrin alpha-M
relationship: has_low_plasma_membrane_amount PR:000001931 ! sialoadhesin
relationship: lacks_plasma_membrane_part PR:000001013 ! integrin alpha-X
relationship: part_of UBERON:0001250 ! red pulp of spleen
relationship: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A
relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1

[Term]
id: CL:0000875
name: non-classical monocyte
namespace: cell
def: "A type of monocyte characterized by low expression of CCR2, low responsiveness to monocyte chemoattractant CCL2/MCP1, low phagocytic activity, and decrease size relative to classical monocytes, but increased co-stimulatory activity. May also play a role in tissue repair." [GO_REF:0000031, GOC:add, PMID:16322748, PMID:18303997, PMID:20628149, PMID:20870168]
comment: Markers: CCR2-CX3CCR1+ (human, mouse, rat); human: CD16+, CCR5+, CD32/FcgRII-high, MHCII+, CD86+; mouse: CD62L-Ly6C-.
synonym: "patrolling monocyte" EXACT []
synonym: "resident monocyte" EXACT []
is_a: CARO:0000006
is_a: CL:0000576 {is_inferred="true"} ! monocyte
intersection_of: CL:0000576 ! monocyte
intersection_of: bearer_of PATO:0000587 ! decreased size
intersection_of: capable_of GO:0031294 ! lymphocyte costimulation
intersection_of: has_completed GO:0030224 ! monocyte differentiation
intersection_of: has_high_plasma_membrane_amount PR:000001206 ! CX3C chemokine receptor 1
intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1
relationship: bearer_of PATO:0000587 ! decreased size
relationship: capable_of GO:0031294 ! lymphocyte costimulation
relationship: develops_from CL:0002393 ! intermediate monocyte
relationship: has_completed GO:0030224 ! monocyte differentiation
relationship: has_high_plasma_membrane_amount PR:000001206 ! CX3C chemokine receptor 1
relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule
relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon
relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1

[Term]
id: CL:0000876
name: splenic white pulp macrophage
namespace: cell
def: "A splenic macrophage found in the white pulp of the spleen. Markers include F4/80-negative, CD68-positive, and macrosialin-positive." [GO_REF:0000031, GOC:ana, PMID:11207597]
comment: Markers: Mouse: F4/80-, CD68+, macrosialin+.
is_a: CARO:0000006
is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage
intersection_of: CL:0000871 ! splenic macrophage
intersection_of: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1
intersection_of: part_of UBERON:0001959 ! white pulp of spleen
intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin
relationship: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1
relationship: part_of UBERON:0001959 ! white pulp of spleen
relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin

[Term]
id: CL:0000877
name: splenic tingible body macrophage
namespace: cell
def: "A splenic white pulp macrophage found in and around the germinal centers of the white pulp of the spleen that participates in phagocytosis of apoptotic B cells from the germinal centers. A marker for a cell of this type is Mertk-positive." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19631584]
is_a: CL:0000876 {is_inferred="true"} ! splenic white pulp macrophage
intersection_of: CL:0000876 ! splenic white pulp macrophage
intersection_of: capable_of GO:0043277 ! apoptotic cell clearance
intersection_of: part_of UBERON:0001249 ! spleen lymphoid follicle
intersection_of: RO:0002104 PR:000010329 ! has plasma membrane part tyrosine-protein kinase Mer
relationship: capable_of GO:0043277 ! apoptotic cell clearance
relationship: part_of UBERON:0001249 ! spleen lymphoid follicle
relationship: RO:0002104 PR:000010329 ! has plasma membrane part tyrosine-protein kinase Mer

[Term]
id: CL:0000878
name: central nervous system macrophage
namespace: cell
def: "A tissue-resident macrophage found in the central nervous system." [GO_REF:0000031, PMID:16322748]
synonym: "CNS macrophage" EXACT []
is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage
is_a: CL:0002319 ! neural cell
intersection_of: CL:0000864 ! tissue-resident macrophage
intersection_of: part_of UBERON:0001017 ! central nervous system
relationship: part_of UBERON:0001017 ! central nervous system

[Term]
id: CL:0000879
name: meningeal macrophage
namespace: cell
def: "A central nervous system macrophage found in the meninges (the three membranes that surround the brain). This macrophage types is highly phagocytic and expresses scavenger receptors." [GO_REF:0000031, GOC:ana, PMID:11591794]
is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage
intersection_of: CL:0000878 ! central nervous system macrophage
intersection_of: capable_of GO:0005044 ! scavenger receptor activity
intersection_of: part_of UBERON:0002360 ! meninx
relationship: capable_of GO:0005044 ! scavenger receptor activity
relationship: part_of UBERON:0002360 ! meninx

[Term]
id: CL:0000880
name: choroid-plexus macrophage
namespace: cell
def: "A central nervous system macrophage found at the interface between the blood and the cerebrospinal fluid in the brain. This cell expresses scavenger receptors." [GO_REF:0000031, GOC:ana, PMID:9550136]
is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage
intersection_of: CL:0000878 ! central nervous system macrophage
intersection_of: capable_of GO:0005044 ! scavenger receptor activity
intersection_of: located_in UBERON:0001886 ! choroid plexus
relationship: capable_of GO:0005044 ! scavenger receptor activity
relationship: located_in UBERON:0001886 ! choroid plexus

[Term]
id: CL:0000881
name: perivascular macrophage
namespace: cell
def: "A central nervous system macrophage found in small blood vessels in the brain. Markers include CD14+CD16+CD163+." [GO_REF:0000031, GOC:tfm, PMID:16507898]
comment: Markers: Human/monkey, mice: CD163. Human: CD14+CD16+CD163+.
is_a: CARO:0000006
is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage
intersection_of: CL:0000878 ! central nervous system macrophage
intersection_of: part_of UBERON:0001981 ! blood vessel
intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
intersection_of: RO:0002104 PR:000001889 ! has plasma membrane part CD14 molecule
intersection_of: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130
relationship: part_of UBERON:0001981 ! blood vessel
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: RO:0002104 PR:000001889 ! has plasma membrane part CD14 molecule
relationship: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130

[Term]
id: CL:0000882
name: thymic medullary macrophage
namespace: cell
def: "A thymic macrophage found in the thymic medulla." [GO_REF:0000031, GOC:ana, PMID:9048205]
is_a: CL:0000866 {is_inferred="true"} ! thymic macrophage
intersection_of: CL:0000866 ! thymic macrophage
intersection_of: part_of UBERON:0002124 ! medulla of thymus
relationship: part_of UBERON:0002124 ! medulla of thymus

[Term]
id: CL:0000883
name: thymic cortical macrophage
namespace: cell
def: "A thymic macrophage found in the thymic cortex." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:9048205]
is_a: CL:0000866 {is_inferred="true"} ! thymic macrophage
intersection_of: CL:0000866 ! thymic macrophage
intersection_of: part_of UBERON:0002123 ! cortex of thymus
relationship: part_of UBERON:0002123 ! cortex of thymus

[Term]
id: CL:0000884
name: mucosa-associated lymphoid tissue macrophage
namespace: cell
def: "A tissue-resident macrophage found in the mucosa associated lymphoid tissue." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19906191]
is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage
intersection_of: CL:0000867 ! secondary lymphoid organ macrophage
intersection_of: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue
relationship: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue

[Term]
id: CL:0000885
name: gut-associated lymphoid tissue macrophage
namespace: cell
def: "A mucosa-associated lymphoid tissue macrophage found in the mucosa-associated lymphoid tissues of the gut." [GO_REF:0000031, GOC:ana, PMID:19906191]
is_a: CL:0000884 {is_inferred="true"} ! mucosa-associated lymphoid tissue macrophage
intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage
intersection_of: capable_of GO:0002387 ! immune response in gut-associated lymphoid tissue
intersection_of: part_of UBERON:0001962 ! gut-associated lymphoid tissue
relationship: capable_of GO:0002387 ! immune response in gut-associated lymphoid tissue
relationship: part_of UBERON:0001962 ! gut-associated lymphoid tissue

[Term]
id: CL:0000886
name: nasal and broncial associated lymphoid tissue macrophage
namespace: cell
def: "A mucosa-associated lymphoid tissue macrophage found in the nasal and bronchial mucosa-associated lymphoid tissues." [GO_REF:0000031, GOC:ana, PMID:16048540]
is_a: CL:0000884 {is_inferred="true"} ! mucosa-associated lymphoid tissue macrophage
intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage
intersection_of: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue
intersection_of: part_of UBERON:0001963 ! bronchial-associated lymphoid tissue
relationship: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue
relationship: part_of UBERON:0001963 ! bronchial-associated lymphoid tissue

[Term]
id: CL:0000887
name: lymph node subcapsular sinus macrophage
namespace: cell
def: "A lymph node macrophage found in the subcapsular sinus of lymph nodes that participates in sensing, clearance, and antigen presentation of lymph-borne particulate antigens. This macrophage is capable of activating invaraint NKT cells and is CD169-positive." [GO_REF:0000031, GOC:tfm, PMID:14668803, PMID:17934446, PMID:20228797]
is_a: CL:0000868 {is_inferred="true"} ! lymph node macrophage
intersection_of: CL:0000868 ! lymph node macrophage
intersection_of: adjacent_to UBERON:0002194 ! capsule of lymph node
intersection_of: capable_of GO:0032816 ! positive regulation of natural killer cell activation
intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin
relationship: adjacent_to UBERON:0002194 ! capsule of lymph node
relationship: capable_of GO:0032816 ! positive regulation of natural killer cell activation
relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin

[Term]
id: CL:0000888
name: lymph node tingible body macrophage
namespace: cell
def: "A lymph node macrophage found in the cortex of lymph nodes, in particular in and around the germinal centers, and that participates in phagocytosis of apoptotic B cells from the germinal centers." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19631584]
is_a: CL:0000868 {is_inferred="true"} ! lymph node macrophage
intersection_of: CL:0000868 ! lymph node macrophage
intersection_of: capable_of GO:0002905 ! regulation of mature B cell apoptotic process
intersection_of: capable_of GO:0043277 ! apoptotic cell clearance
intersection_of: part_of UBERON:0002006 ! cortex of lymph node
relationship: capable_of GO:0002905 ! regulation of mature B cell apoptotic process
relationship: capable_of GO:0043277 ! apoptotic cell clearance
relationship: part_of UBERON:0002006 ! cortex of lymph node

[Term]
id: CL:0000889
name: myeloid suppressor cell
namespace: cell
def: "An immature myeloid leukocyte of heterogeneous phenotype found particularly in cancer and sepsis patients that is capable of suppressing activity of T cells in ex vivo assays. This cell type is CD45-positive, CD11b-positive." [GO_REF:0000031, GOC:add, GOC:ana, PMID:16168663, PMID:17016554, PMID:17016559]
comment: Markers: Mouse: CD11b+GR1+CD31+; Human: CD34+ CD33+CD15-CD13+. (According to some reports in humans these cells are iNOS+ARG1+IL13+IFNg+); location: In cancerous tissue; in the blood and lymphoid organs in sepsis.
is_a: CARO:0000006
is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte
intersection_of: CL:0000766 ! myeloid leukocyte
intersection_of: bearer_of PATO:0001501 ! immature
intersection_of: capable_of GO:0050777 ! negative regulation of immune response
intersection_of: RO:0002104 PR:000001006 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C
intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M
relationship: bearer_of PATO:0001501 ! immature
relationship: capable_of GO:0050777 ! negative regulation of immune response
relationship: RO:0002104 PR:000001006 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C
relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M

[Term]
id: CL:0000890
name: alternatively activated macrophage
namespace: cell
def: "An elicited macrophage characterized by low production of pro-inflammatory and Th1 polarizing cytokines and high expression of arginase-1, and associated with tissue remodelling." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:20510870]
comment: Role or process: tissue remodeling.
synonym: "M2 macrophage" RELATED []
is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage
intersection_of: CL:0000861 ! elicited macrophage
intersection_of: capable_of GO:0048771 ! tissue remodeling
intersection_of: has_part PR:000001844 ! arginase-1
relationship: capable_of GO:0048771 ! tissue remodeling
relationship: has_part PR:000001844 ! arginase-1

[Term]
id: CL:0000891
name: foam cell
namespace: cell
def: "A type of cell containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add]
xref: BTO:0003872
xref: FMA:83586
is_a: CL:0000003 ! native cell

[Term]
id: CL:0000892
name: smooth muscle cell derived foam cell
namespace: cell
def: "A type of foam cell derived from a smooth muscle cell containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add]
is_a: BFO:0000004 ! independent continuant
is_a: CARO:0000000
is_a: CL:0000891 ! foam cell
relationship: develops_from CL:0000192 ! smooth muscle cell

[Term]
id: CL:0000893
name: thymocyte
namespace: cell
def: "An immature T cell located in the thymus." [GO_REF:0000031, GOC:add, GOC:tfm, PMID:12415312]
synonym: "immature T cell" BROAD []
synonym: "immature T lymphocyte" BROAD []
synonym: "immature T-cell" BROAD []
synonym: "immature T-lymphocyte" BROAD []
synonym: "thymic lymphocyte" EXACT []
xref: BTO:0001372
xref: CALOHA:TS-1042
xref: FMA:72202
xref: XAO:0003159
is_a: CL:0002420 {is_inferred="true"} ! immature T cell
intersection_of: CL:0000084 ! T cell
intersection_of: has_not_completed GO:0045058 ! T cell selection
intersection_of: part_of UBERON:0002370 ! thymus
relationship: part_of UBERON:0002370 ! thymus

[Term]
id: CL:0000894
name: DN1 thymic pro-T cell
namespace: cell
def: "A pro-T cell that has the phenotype CD4-negative, CD8-negative, CD44-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:tfm]
synonym: "DN1 thymic pro-T lymphocyte" EXACT []
synonym: "DN1 thymic pro-T-cell" EXACT []
synonym: "DN1 thymic pro-T-lymphocyte" EXACT []
synonym: "DN1 thymic progenitor T cell" EXACT []
synonym: "DN1 thymocyte" EXACT []
synonym: "double negative 1" EXACT []
synonym: "preT.DN1.Th" EXACT []
is_a: CARO:0000006
is_a: CL:0000827 {is_inferred="true"} ! pro-T cell
intersection_of: CL:0000827 ! pro-T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: part_of UBERON:0002370 ! thymus
intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule
relationship: develops_from CL:0002425 ! early T lineage precursor
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
relationship: part_of UBERON:0002370 ! thymus
relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule

[Term]
id: CL:0000895
name: naive thymus-derived CD4-positive, alpha-beta T cell
namespace: cell
def: "An antigen inexperienced CD4-positive, alpha-beta T cell with the phenotype CCR7-positive, CD127-positive and CD62L-positive. This cell type develops in the thymus. This cell type is also described as being CD25-negative, CD62L-high, and CD44-low." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, PMID:19100699, PMID:22343568]
comment: These cells have not been exposed to antigen following thymic T-cell selection; found in blood and secondary lymphoid organs. This cell type is compatible with the HIPC Lyoplate markers for 'naive CD4+ T cell', but includes additional markers known to be expressed on naive CD4+ T cells.
synonym: "naive CD4+ T cell" BROAD [PMID:22343568]
synonym: "naive thymus-derived CD4-positive, alpha-beta T lymphocyte" EXACT []
synonym: "naive thymus-derived CD4-positive, alpha-beta T-cell" EXACT []
synonym: "naive thymus-derived CD4-positive, alpha-beta T-lymphocyte" EXACT []
synonym: "T.4Nve.Sp" EXACT []
synonym: "Th0" EXACT [GOC:tfm]
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
is_a: CL:0000898 ! naive T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: has_high_plasma_membrane_amount PR:000001318 ! L-selectin
intersection_of: has_low_plasma_membrane_amount PR:000001307 ! CD44 molecule
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha
relationship: develops_from CL:0002436 ! mature CD4 single-positive thymocyte
relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha

[Term]
id: CL:0000896
name: activated CD4-positive, alpha-beta T cell
namespace: cell
def: "A recently activated CD4-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, and CD25-positive." [GO_REF:0000031, GOC:add, GOC:pam]
synonym: "activated CD4-positive, alpha-beta T lymphocyte" EXACT []
synonym: "activated CD4-positive, alpha-beta T-cell" EXACT []
synonym: "activated CD4-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin
intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: develops_from CL:0000895 ! naive thymus-derived CD4-positive, alpha-beta T cell
relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin
relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000897
name: CD4-positive, alpha-beta memory T cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that has differentiated into a memory T cell." [GOC:add, http://www.immgen.org/index_content.html, ISBN:0781735149]
synonym: "CD4-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "CD4-positive, alpha-beta memory T-cell" EXACT []
synonym: "CD4-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "T4.Mem.Sp" RELATED []
is_a: CL:0000624 ! CD4-positive, alpha-beta T cell
is_a: CL:0000813 ! memory T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: bearer_of PATO:0001603 ! increased life span
intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response
intersection_of: has_completed GO:0043379 ! memory T cell differentiation
property_value: dc-creator https://orcid.org/0000-0001-9990-8331 xsd:string

[Term]
id: CL:0000898
name: naive T cell
namespace: cell
def: "Mature T cell not yet exposed to antigen with the phenotype CCR7-positive, CD45RA-positive, and CD127-positive. This cell type is also described as being CD25-negative, CD62L-high and CD44-low." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19100699]
synonym: "naive T lymphocyte" EXACT []
synonym: "naive T-cell" EXACT []
synonym: "naive T-lymphocyte" EXACT []
is_a: CL:0002419 {is_inferred="true"} ! mature T cell
intersection_of: CL:0002419 ! mature T cell
intersection_of: has_completed GO:0045058 ! T cell selection
intersection_of: has_high_plasma_membrane_amount PR:000001318 ! L-selectin
intersection_of: has_low_plasma_membrane_amount PR:000001307 ! CD44 molecule
intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha
relationship: has_high_plasma_membrane_amount PR:000001318 ! L-selectin
relationship: has_low_plasma_membrane_amount PR:000001307 ! CD44 molecule
relationship: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
relationship: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha

[Term]
id: CL:0000899
name: T-helper 17 cell
namespace: cell
def: "CD4-positive, alpha-beta T cell with the phenotype RORgamma-t-positive, CXCR3-negative, CCR6-positive, and capable of producing IL-17." [GO_REF:0000031, GOC:add, GOC:pam, PMID:20303875, PMID:20969597, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'Th17 CD4+ T cell', but its logical definition includes additional known characteristics of T-helper 17 T cells.
synonym: "helper T cell type 17" EXACT []
synonym: "IL-17-producing CD4+ T helper" EXACT []
synonym: "T helper cells type 17" EXACT []
synonym: "T(H)-17 cell" EXACT []
synonym: "Th17 CD4+ T cell" EXACT [PMID:22343568]
synonym: "Th17 cell" EXACT []
synonym: "Th17 T cell" EXACT []
synonym: "Th17 T lymphocyte" EXACT []
synonym: "Th17 T-cell" EXACT []
synonym: "Th17 T-lymphocyte" EXACT []
is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell
intersection_of: CL:0000492 ! CD4-positive helper T cell
intersection_of: capable_of GO:0032620 ! interleukin-17 production
intersection_of: has_part PR:000003455 ! nuclear receptor ROR-gamma isoform 2
intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3
intersection_of: RO:0002104 PR:000001202 ! has plasma membrane part C-C chemokine receptor type 6
relationship: capable_of GO:0032620 ! interleukin-17 production
relationship: has_part PR:000003455 ! nuclear receptor ROR-gamma isoform 2
relationship: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3
relationship: RO:0002104 PR:000001202 ! has plasma membrane part C-C chemokine receptor type 6

[Term]
id: CL:0000900
name: naive thymus-derived CD8-positive, alpha-beta T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell that has not experienced activation via antigen contact and has the phenotype CD45RA-positive, CCR7-positive and CD127-positive. This cell type is also described as being CD25-negative, CD62L-high and CD44-low." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, ISBN:0781735149, PMID:22343568]
comment: This cell traffics in secondary lymphoid organs and blood.  This cell type is compatible with the HIPC Lyoplate markers for 'naive CD8+ T cell', but includes additional markers known to be expressed on naive CD8+ T cells.
synonym: "naive CD8+ T cell" BROAD [PMID:22343568]
synonym: "naive thymus-dervied CD8-positive, alpha-beta T lymphocyte" EXACT []
synonym: "naive thymus-dervied CD8-positive, alpha-beta T-cell" EXACT []
synonym: "naive thymus-dervied CD8-positive, alpha-beta T-lymphocyte" EXACT []
synonym: "T.8Nve.Sp" NARROW []
is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell
is_a: CL:0000898 ! naive T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: has_high_plasma_membrane_amount PR:000001318 ! L-selectin
intersection_of: has_low_plasma_membrane_amount PR:000001307 ! CD44 molecule
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha
relationship: develops_from CL:0002437 ! mature CD8 single-positive thymocyte
relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha

[Term]
id: CL:0000901
name: Tr1 cell
namespace: cell
def: "CD4-positive alpha-beta T cell with regulatory function that produces IL-10." [GO_REF:0000031, GOC:add, GOC:pam, PMID:16903904]
comment: These cells are reportedly induced by IL-10 and are capable of producing IFN-gamma, IL-5, IL-10, and TGF-beta.)
synonym: "T-regulatory T cell type 1" EXACT []
synonym: "Tr1 T cell" EXACT []
synonym: "Tr1 T lymphocyte" EXACT []
synonym: "Tr1 T-cell" EXACT []
synonym: "Tr1 T-lymphocyte" EXACT []
is_a: CL:0000492 ! CD4-positive helper T cell
is_a: CL:0000815 ! regulatory T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: capable_of GO:0032613 ! interleukin-10 production
intersection_of: capable_of GO:0050777 ! negative regulation of immune response
relationship: capable_of GO:0032613 ! interleukin-10 production

[Term]
id: CL:0000902
name: induced T-regulatory cell
namespace: cell
def: "CD4-positive alpha-beta T cell with the phenotype CD25-positive, CTLA-4-positive, and FoxP3-positive with regulatory function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19464985]
synonym: "adaptive Treg" RELATED []
synonym: "aTreg" RELATED []
synonym: "induced regulatory T cell" EXACT []
synonym: "induced regulatory T lymphocyte" EXACT []
synonym: "induced regulatory T-cell" EXACT []
synonym: "induced regulatory T-lymphocyte" EXACT []
synonym: "induced Treg" EXACT []
synonym: "iTreg" EXACT []
is_a: CL:0000792 {is_inferred="true"} ! CD4-positive, CD25-positive, alpha-beta regulatory T cell
intersection_of: CL:0000792 ! CD4-positive, CD25-positive, alpha-beta regulatory T cell
intersection_of: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell
intersection_of: has_part PR:000001350 ! forkhead box protein P3
intersection_of: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4
relationship: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell
relationship: has_part PR:000001350 ! forkhead box protein P3
relationship: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4

[Term]
id: CL:0000903
name: natural T-regulatory cell
namespace: cell
def: "CD4-positive alpha-beta T cell with the phenotype FoxP3-positive, CD25-positive, CD62L-positive, and CTLA-4 positive with regulatory function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19464985]
synonym: "natural regulatory T cell" EXACT []
synonym: "natural regulatory T lymphocyte" EXACT []
synonym: "natural regulatory T-cell" EXACT []
synonym: "natural regulatory T-lymphocyte" EXACT []
synonym: "natural Treg" EXACT []
synonym: "nTreg" EXACT []
is_a: CL:0000792 {is_inferred="true"} ! CD4-positive, CD25-positive, alpha-beta regulatory T cell
intersection_of: CL:0000792 ! CD4-positive, CD25-positive, alpha-beta regulatory T cell
intersection_of: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte
intersection_of: has_part PR:000001350 ! forkhead box protein P3
intersection_of: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin
intersection_of: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4
relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte
relationship: has_part PR:000001350 ! forkhead box protein P3
relationship: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin
relationship: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4

[Term]
id: CL:0000904
name: central memory CD4-positive, alpha-beta T cell
namespace: cell
def: "CD4-positive, alpha-beta memory T cell with the phenotype CCR7-positive, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'central memory CD4+ T cell', but includes additional markers known to be expressed on central memory CD4+ T cells.
synonym: "central CD4-positive, alpha-beta memory T cell" EXACT []
synonym: "central CD4-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "central CD4-positive, alpha-beta memory T-cell" EXACT []
synonym: "central CD4-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "central memory CD4+ T cell" BROAD [PMID:22343568]
synonym: "central memory CD4-positive, alpha-beta T lymphocyte" EXACT []
synonym: "central memory CD4-positive, alpha-beta T-cell" EXACT []
synonym: "central memory CD4-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0001204 {is_inferred="true"} ! CD4-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: CL:0001204 ! CD4-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7

[Term]
id: CL:0000905
name: effector memory CD4-positive, alpha-beta T cell
namespace: cell
def: "CD4-positive, alpha-beta memory T cell with the phenotype CCR7-negative, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'effector memory CD4+ T cell', but includes additional markers known to be expressed on effector memory CD4+ T cells.
synonym: "effector CD4-positive, alpha-beta memory T cell" EXACT []
synonym: "effector CD4-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "effector CD4-positive, alpha-beta memory T-cell" EXACT []
synonym: "effector CD4-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "effector memory CD4+ T cell" BROAD [PMID:22343568]
synonym: "effector memory CD4-positive, alpha-beta T lymphocyte" EXACT []
synonym: "effector memory CD4-positive, alpha-beta T-cell" EXACT []
synonym: "effector memory CD4-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0001204 {is_inferred="true"} ! CD4-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: CL:0001204 ! CD4-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7

[Term]
id: CL:0000906
name: activated CD8-positive, alpha-beta T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, CD25-positive, and CCR7-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm]
synonym: "activated CD8-positive, alpha-beta T lymphocyte" EXACT []
synonym: "activated CD8-positive, alpha-beta T-cell" EXACT []
synonym: "activated CD8-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7
intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin
intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: develops_from CL:0000900 ! naive thymus-derived CD8-positive, alpha-beta T cell
relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7
relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin
relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000907
name: central memory CD8-positive, alpha-beta T cell
namespace: cell
def: "CD8-positive, alpha-beta memory T cell with the phenotype CCR7-positive, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:20146720, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'central memory CD8+ T cell', but includes additional markers known to be expressed on central memory CD8+ T cells.
synonym: "central CD8-positive, alpha-beta memory T cell" EXACT []
synonym: "central CD8-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "central CD8-positive, alpha-beta memory T-cell" EXACT []
synonym: "central CD8-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "central memory CD8+ T cell" BROAD [PMID:22343568]
synonym: "central memory CD8-positive, alpha-beta T lymphocyte" EXACT []
synonym: "central memory CD8-positive, alpha-beta T-cell" EXACT []
synonym: "central memory CD8-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0001203 {is_inferred="true"} ! CD8-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: CL:0001203 ! CD8-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7
relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7

[Term]
id: CL:0000908
name: CD8-positive, alpha-beta cytokine secreting effector T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, and CD25-positive, that secretes cytokines." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:20146720]
synonym: "CD8-positive, alpha-beta cytokine secreting effector T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta cytokine secreting effector T-cell" EXACT []
synonym: "CD8-positive, alpha-beta cytokine secreting effector T-lymphocyte" EXACT []
is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: capable_of GO:0001816 ! cytokine production
intersection_of: has_completed GO:0030217 ! T cell differentiation
intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin
intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: capable_of GO:0001816 ! cytokine production
relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell
relationship: has_completed GO:0030217 ! T cell differentiation
relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin
relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000909
name: CD8-positive, alpha-beta memory T cell
namespace: cell
def: "A CD8-positive, alpha-beta T cell that has differentiated into a memory T cell." [GOC:add, PMID:20146720]
synonym: "CD8-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "CD8-positive, alpha-beta memory T-cell" EXACT []
synonym: "CD8-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "T.8Mem.Sp" RELATED []
is_a: CL:0000625 ! CD8-positive, alpha-beta T cell
is_a: CL:0000813 ! memory T cell
intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell
intersection_of: bearer_of PATO:0001603 ! increased life span
intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response
intersection_of: has_completed GO:0043379 ! memory T cell differentiation
property_value: dc-creator https://orcid.org/0000-0001-9990-8331 xsd:string

[Term]
id: CL:0000910
name: cytotoxic T cell
namespace: cell
def: "A mature T cell that differentiated and acquired cytotoxic function with the phenotype perforin-positive and granzyme-B positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18395547]
synonym: "cytotoxic T lymphocyte" EXACT []
synonym: "cytotoxic T-cell" EXACT []
synonym: "cytotoxic T-lymphocyte" EXACT []
xref: BTO:0000289
xref: CALOHA:TS-0190
xref: FMA:70573
is_a: CL:0000911 {is_inferred="true"} ! effector T cell
intersection_of: CL:0000911 ! effector T cell
intersection_of: capable_of GO:0001913 ! T cell mediated cytotoxicity
relationship: capable_of GO:0001913 ! T cell mediated cytotoxicity

[Term]
id: CL:0000911
name: effector T cell
namespace: cell
def: "A differentiated T cell with ability to traffic to peripheral tissues and is capable of mounting a specific immune response." [GOC:PAM-ADD, GOC:tfm, ISBN:0877799148, PMID:18395547]
synonym: "effector T lymphocyte" EXACT []
synonym: "effector T-cell" EXACT []
synonym: "effector T-lymphocyte" EXACT []
is_a: CL:0002419 {is_inferred="true"} ! mature T cell
intersection_of: CL:0002419 ! mature T cell
intersection_of: bearer_of PATO:0045026 ! normal life span
intersection_of: has_completed GO:0030217 ! T cell differentiation
intersection_of: has_completed GO:0045058 ! T cell selection
relationship: bearer_of PATO:0045026 ! normal life span
relationship: has_completed GO:0030217 ! T cell differentiation

[Term]
id: CL:0000912
name: helper T cell
namespace: cell
def: "A effector T cell that provides help in the form of secreted cytokines to other immune cells." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18395547]
synonym: "helper T lymphocyte" EXACT []
synonym: "helper T-cell" EXACT []
synonym: "helper T-lymphocyte" EXACT []
synonym: "T-helper cell" EXACT []
xref: BTO:0002417
is_a: CL:0000911 {is_inferred="true"} ! effector T cell
intersection_of: CL:0000911 ! effector T cell
intersection_of: capable_of GO:0001816 ! cytokine production
relationship: capable_of GO:0001816 ! cytokine production

[Term]
id: CL:0000913
name: effector memory CD8-positive, alpha-beta T cell
namespace: cell
def: "CD8-positive, alpha-beta memory T cell with the phenotype CCR7-negative, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:20146720, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'effector memory CD8+ T cell', but includes additional markers known to be expressed on effector memory CD8+ T cells.
synonym: "effector CD8-positive, alpha-beta memory T cell" EXACT []
synonym: "effector CD8-positive, alpha-beta memory T lymphocyte" EXACT []
synonym: "effector CD8-positive, alpha-beta memory T-cell" EXACT []
synonym: "effector CD8-positive, alpha-beta memory T-lymphocyte" EXACT []
synonym: "effector memory CD8+ T cell" BROAD [PMID:22343568]
synonym: "effector memory CD8-positive, alpha-beta T lymphocyte" EXACT []
synonym: "effector memory CD8-positive, alpha-beta T-cell" EXACT []
synonym: "effector memory CD8-positive, alpha-beta T-lymphocyte" EXACT []
is_a: CL:0001203 {is_inferred="true"} ! CD8-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: CL:0001203 ! CD8-positive, alpha-beta memory T cell, CD45RO-positive
intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7
intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha
relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7

[Term]
id: CL:0000914
name: immature NK T cell
namespace: cell
def: "An immature alpha-beta T-cell that express Egr2. These cells give rise to T cells expressing NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17589542, PMID:19169262]
synonym: "immature NK T lymphocyte" EXACT []
synonym: "immature NK T-cell" EXACT []
synonym: "immature NK T-lymphocyte" EXACT []
synonym: "immature NKT cell" EXACT []
is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell
intersection_of: CL:0000790 ! immature alpha-beta T cell
intersection_of: has_part PR:000003469 ! early growth response protein 2
relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte
relationship: has_part PR:000003469 ! early growth response protein 2

[Term]
id: CL:0000915
name: CD8-alpha-alpha-positive, alpha-beta intraepithelial T cell
namespace: cell
def: "An alpha-beta intraepithelial T cell with the phenotype CD8-alpha-alpha-positive located in the columnar epithelium of the gastrointestinal tract. These cells have a memory phenotype of CD2-negative and CD5-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:11685222]
synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T lymphocyte" EXACT []
synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T-cell" EXACT []
synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T-lymphocyte" EXACT []
is_a: CL:0000797 {is_inferred="true"} ! alpha-beta intraepithelial T cell
intersection_of: CL:0000797 ! alpha-beta intraepithelial T cell
intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
intersection_of: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain
relationship: develops_from CL:0000811 ! CD8-positive, alpha-beta thymocyte
relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule
relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5
relationship: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain

[Term]
id: CL:0000916
name: dendritic epidermal T cell
namespace: cell
def: "A mature gamma-delta T cell located in the epidermis that regulates wound healing." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:11976459]
comment: In mice, DETC have an invariant T cell receptor.
synonym: "dendritic epidermal T lymphocyte" EXACT []
synonym: "dendritic epidermal T-cell" EXACT []
synonym: "dendritic epidermal T-lymphocyte" EXACT []
synonym: "DETC" EXACT []
is_a: CL:0000800 {is_inferred="true"} ! mature gamma-delta T cell
intersection_of: CL:0000800 ! mature gamma-delta T cell
intersection_of: capable_of GO:0060054 ! positive regulation of epithelial cell proliferation involved in wound healing
intersection_of: located_in UBERON:0001003 ! skin epidermis
relationship: capable_of GO:0060054 ! positive regulation of epithelial cell proliferation involved in wound healing
relationship: develops_from CL:0002401 ! mature dendritic epithelial T cell precursor
relationship: located_in UBERON:0001003 ! skin epidermis

[Term]
id: CL:0000917
name: Tc1 cell
namespace: cell
def: "A CD8-positive, alpha-beta positive T cell that has the phenotype T-bet-positive, eomesodermin-positive, CXCR3-positive, CCR6-negative, and is capable of producing interferon-gamma." [GO_REF:0000031, GOC:add, GOC:pam, PMID:22343568, PMID:9914231]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'Tc1 CD8+ T cell', but its logical definition includes additional known characteristics of Tc1 T cells.
synonym: "CD8-positive Th1 cell" EXACT []
synonym: "T-cytotoxic T cell type 1" EXACT []
synonym: "Tc1 CD8+ T cell" EXACT [PMID:22343568]
synonym: "Tc1 T cell" EXACT []
synonym: "Tc1 T lymphocyte" EXACT []
synonym: "Tc1 T-cell" EXACT []
synonym: "Tc1 T-lymphocyte" EXACT []
synonym: "Th1 CD8-positive T cell" EXACT []
synonym: "Th1 non-TFH CD8-positive T cell" EXACT []
xref: BTO:0004793
xref: BTO:0004888
xref: FMA:84793
is_a: CL:0000908 {is_inferred="true"} ! CD8-positive, alpha-beta cytokine secreting effector T cell
intersection_of: CL:0000908 ! CD8-positive, alpha-beta cytokine secreting effector T cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: has_part PR:000001835 ! T-box transcription factor TBX21
intersection_of: has_part PR:000003463 ! eomesodermin
intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
intersection_of: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: has_part PR:000001835 ! T-box transcription factor TBX21
relationship: has_part PR:000003463 ! eomesodermin
relationship: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
relationship: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3

[Term]
id: CL:0000918
name: Tc2 cell
namespace: cell
def: "A CD8-positive, alpha-beta positive T cell expressing GATA-3 and secreting IL-4." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:9914231]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'non-Tc1/Tc17 CD8+ T cell' (see CL:0001052), but includes the additional necessary and sufficient conditions to allow classification as a Tc2 T cell.
synonym: "CD8-positive Th2 cell" EXACT []
synonym: "T-cytotoxic T cell type 2" EXACT []
synonym: "Tc2 T cell" EXACT []
synonym: "Tc2 T lymphocyte" EXACT []
synonym: "Tc2 T-cell" EXACT []
synonym: "Tc2 T-lymphocyte" EXACT []
synonym: "Th2 CD8-positive T cell" EXACT []
synonym: "Th2 non-TFH CD8-positive T cell" EXACT []
xref: BTO:0004794
xref: FMA:84794
is_a: CL:0000908 {is_inferred="true"} ! CD8-positive, alpha-beta cytokine secreting effector T cell
is_a: CL:0001052 ! CD8-positive, CXCR3-negative, CCR6-negative, alpha-beta T cell
intersection_of: CL:0000908 ! CD8-positive, alpha-beta cytokine secreting effector T cell
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3
intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6
intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3

[Term]
id: CL:0000919
name: CD8-positive, CD25-positive, alpha-beta regulatory T cell
namespace: cell
def: "A CD8-positive alpha beta-positive T cell with the phenotype FoxP3-positive and having suppressor function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19118505]
synonym: "CD8+CD25+ T cell" EXACT []
synonym: "CD8+CD25+ T lymphocyte" EXACT []
synonym: "CD8+CD25+ T(reg)" EXACT []
synonym: "CD8+CD25+ T-cell" EXACT []
synonym: "CD8+CD25+ T-lymphocyte" EXACT []
synonym: "CD8+CD25+ Treg" EXACT []
synonym: "CD8-positive, CD25-positive Treg" EXACT []
synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T lymphocyte" EXACT []
synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T-cell" EXACT []
synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T-lymphocyte" EXACT []
is_a: CL:0000795 {is_inferred="true"} ! CD8-positive, alpha-beta regulatory T cell
intersection_of: CL:0000795 ! CD8-positive, alpha-beta regulatory T cell
intersection_of: has_part PR:000001350 ! forkhead box protein P3
intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha
relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell
relationship: has_part PR:000001350 ! forkhead box protein P3
relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha

[Term]
id: CL:0000920
name: CD8-positive, CD28-negative, alpha-beta regulatory T cell
namespace: cell
def: "CD8-positive, alpha-beta positive regulatory T cell with the phenotype CD28-negative and FoxP3-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19118505]
synonym: "CD8+CD28- T cell" EXACT []
synonym: "CD8+CD28- T lymphocyte" EXACT []
synonym: "CD8+CD28- T(reg)" EXACT []
synonym: "CD8+CD28- T-cell" EXACT []
synonym: "CD8+CD28- T-lymphocyte" EXACT []
synonym: "CD8+CD28- Treg" EXACT []
synonym: "CD8-positive, CD28-negative T(reg)" EXACT []
synonym: "CD8-positive, CD28-negative Treg" EXACT []
synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T lymphocyte" EXACT []
synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T-cell" EXACT []
synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T-lymphocyte" EXACT []
is_a: CL:0000795 {is_inferred="true"} ! CD8-positive, alpha-beta regulatory T cell
intersection_of: CL:0000795 ! CD8-positive, alpha-beta regulatory T cell
intersection_of: has_part PR:000001350 ! forkhead box protein P3
intersection_of: lacks_plasma_membrane_part PR:000001841 ! T-cell-specific surface glycoprotein CD28
relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell
relationship: has_part PR:000001350 ! forkhead box protein P3
relationship: lacks_plasma_membrane_part PR:000001841 ! T-cell-specific surface glycoprotein CD28

[Term]
id: CL:0000921
name: type I NK T cell
namespace: cell
def: "An alpha-beta T cell expressing NK cell markers that is CD1d restricted and expresses specific V-alpha chains. NK T cells of this type recognize the glycolipid alpha-galactosylceramide in the context of CD1d." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:15039760]
comment: In mouse the canonical TCR is V-alpha-14, and in humans it is V-alpha 24.
synonym: "classical NK T cell" EXACT []
synonym: "invariant NK T cell" RELATED []
synonym: "type I NK T lymphocyte" EXACT []
synonym: "type I NK T-cell" EXACT []
synonym: "type I NK T-lymphocyte" EXACT []
synonym: "type I NKT cell" EXACT []
is_a: CL:0000814 {is_inferred="true"} ! mature NK T cell
intersection_of: CL:0000814 ! mature NK T cell
intersection_of: capable_of GO:0043208 ! glycosphingolipid binding
relationship: capable_of GO:0043208 ! glycosphingolipid binding

[Term]
id: CL:0000922
name: type II NK T cell
namespace: cell
def: "An alpha-beta T cell expressing NK call markers that is CD1d restricted and expresses a diverse TCR repertoire. Type II NKT cells do not become activated by alpha-galactosylceramide when presented by CD1d." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:15039760]
synonym: "type II NK T lymphocyte" EXACT []
synonym: "type II NK T-cell" EXACT []
synonym: "type II NK T-lymphocyte" EXACT []
synonym: "type II NKT cell" EXACT []
is_a: CL:0000814 {is_inferred="true"} ! mature NK T cell
intersection_of: CL:0000814 ! mature NK T cell
intersection_of: capable_of GO:0002288 ! NK T cell activation involved in immune response
relationship: capable_of GO:0002288 ! NK T cell activation involved in immune response

[Term]
id: CL:0000923
name: CD4-positive type I NK T cell
namespace: cell
def: "A type I NK T cell that has the phenotype CD4-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "CD4-positive type I NK T lymphocyte" EXACT []
synonym: "CD4-positive type I NK T-cell" EXACT []
synonym: "CD4-positive type I NK T-lymphocyte" EXACT []
synonym: "CD4-positive type I NKT cell" EXACT []
synonym: "NKT.4+.SP" NARROW []
is_a: CL:0000921 {is_inferred="true"} ! type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule

[Term]
id: CL:0000924
name: CD4-negative, CD8-negative type I NK T cell
namespace: cell
def: "A type I NK T cell that has the phenotype CD4-negative and CD8-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18997862]
synonym: "CD4-negative, CD8-negative type I NK T lymphocyte" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-cell" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-lymphocyte" EXACT []
synonym: "CD4-negative, CD8-negative type I NKT cell" EXACT []
synonym: "NKT.4-.Sp" NARROW []
is_a: CL:0000921 {is_inferred="true"} ! type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain

[Term]
id: CL:0000925
name: activated CD4-positive type I NK T cell
namespace: cell
def: "A type I NK T cell that has been recently activated, secretes interferon-gamma and IL-4, and has the phenotype CD4-positive, CD69-positive, and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "activated CD4-positive type I NK T lymphocyte" EXACT []
synonym: "activated CD4-positive type I NK T-cell" EXACT []
synonym: "activated CD4-positive type I NK T-lymphocyte" EXACT []
synonym: "activated CD4-positive type I NKT cell" EXACT []
is_a: CL:0000923 ! CD4-positive type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: develops_from CL:0000923 ! CD4-positive type I NK T cell
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule

[Term]
id: CL:0000926
name: CD4-positive type I NK T cell secreting interferon-gamma
namespace: cell
def: "A mature NK T cell that secretes interferon-gamma and enhances type 1 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "CD4-positive type I NK T cell secreting IFN-gamma" EXACT []
synonym: "CD4-positive type I NK T lymphocyte secreting interferon-gamma" EXACT []
synonym: "CD4-positive type I NK T-cell secreting interferon-gamma" EXACT []
synonym: "CD4-positive type I NK T-lymphocyte secreting interferon-gamma" EXACT []
synonym: "CD4-positive type I NKT cell secreting interferon-gamma" EXACT []
is_a: CL:0000923 ! CD4-positive type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
relationship: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: develops_from CL:0000925 ! activated CD4-positive type I NK T cell

[Term]
id: CL:0000927
name: CD4-positive type I NK T cell secreting interleukin-4
namespace: cell
def: "A mature NK T cell that predominantly secretes type 2 cytokines such as interleukin-4 and interleukin-13 and enhances type 2 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm]
synonym: "CD4-positive type I NK T cell secreting IL-4" EXACT []
synonym: "CD4-positive type I NK T lymphocyte secreting interleukin-4" EXACT []
synonym: "CD4-positive type I NK T-cell secreting interleukin-4" EXACT []
synonym: "CD4-positive type I NK T-lymphocyte secreting interleukin-4" EXACT []
synonym: "CD4-positive type I NKT cell secreting interleukin-4" EXACT []
is_a: CL:0000923 ! CD4-positive type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0002830 ! positive regulation of type 2 immune response
intersection_of: capable_of GO:0032616 ! interleukin-13 production
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule
relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response
relationship: capable_of GO:0032616 ! interleukin-13 production
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: develops_from CL:0000925 ! activated CD4-positive type I NK T cell

[Term]
id: CL:0000928
name: activated CD4-negative, CD8-negative type I NK T cell
namespace: cell
def: "A type I NK T cell that has been recently activated, secretes interferon-gamma and interleukin-4, and has phenotype CD4-negative, CD8-negative, CD69-positive, and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "activated CD4-negative, CD8-negative type I NK T lymphocyte" EXACT []
synonym: "activated CD4-negative, CD8-negative type I NK T-cell" EXACT []
synonym: "activated CD4-negative, CD8-negative type I NK T-lymphocyte" EXACT []
synonym: "activated CD4-negative, CD8-negative type I NKT cell" EXACT []
is_a: CL:0000924 ! CD4-negative, CD8-negative type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0002369 ! T cell cytokine production
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: capable_of GO:0002369 ! T cell cytokine production
relationship: develops_from CL:0000924 ! CD4-negative, CD8-negative type I NK T cell
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule

[Term]
id: CL:0000929
name: CD4-negative, CD8-negative type I NK T cell secreting interferon-gamma
namespace: cell
def: "A mature NK T cell that secretes interferon-gamma and enhances Th1 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "CD4-negative, CD8-negative type I NK T cell secreting IFN-gamma" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T lymphocyte secreting interferon-gamma" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-cell secreting interferon-gamma" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-lymphocyte secreting interferon-gamma" EXACT []
synonym: "CD4-negative, CD8-negative type I NKT cell secreting interferon-gamma" EXACT []
is_a: CL:0000924 ! CD4-negative, CD8-negative type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: develops_from CL:0000928 ! activated CD4-negative, CD8-negative type I NK T cell

[Term]
id: CL:0000930
name: CD4-negative, CD8-negative type I NK T cell secreting interleukin-4
namespace: cell
def: "A mature NK T cell that secretes interleukin-4 and enhances Th2 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398]
synonym: "CD4-negative, CD8-negative type I NK T cell secreting IL-4" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T lymphocyte secreting interleukin-4" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-cell secreting interleukin-4" EXACT []
synonym: "CD4-negative, CD8-negative type I NK T-lymphocyte secreting interleukin-4" EXACT []
synonym: "CD4-negative, CD8-negative type I NKT cell secreting interleukin-4" EXACT []
is_a: CL:0000924 ! CD4-negative, CD8-negative type I NK T cell
intersection_of: CL:0000921 ! type I NK T cell
intersection_of: capable_of GO:0002830 ! positive regulation of type 2 immune response
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain
relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: develops_from CL:0000928 ! activated CD4-negative, CD8-negative type I NK T cell

[Term]
id: CL:0000931
name: activated type II NK T cell
namespace: cell
def: "A type II NK T cell that has been recently activated, secretes interferon-gamma and interleukin-4, and has the phenotype CD69-positive and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17964217]
synonym: "activated type II NK T lymphocyte" EXACT []
synonym: "activated type II NK T-cell" EXACT []
synonym: "activated type II NK T-lymphocyte" EXACT []
synonym: "activated type II NKT cell" EXACT []
is_a: CL:0000922 {is_inferred="true"} ! type II NK T cell
intersection_of: CL:0000922 ! type II NK T cell
intersection_of: capable_of GO:0002369 ! T cell cytokine production
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: capable_of GO:0002369 ! T cell cytokine production
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule

[Term]
id: CL:0000932
name: type II NK T cell secreting interferon-gamma
namespace: cell
def: "A type II NK T cell that has been recently activated, secretes interferon-gamma, and has the phenotype CD69-positive and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, PMID:17964217]
synonym: "type II NK T cell secreting IFN-gamma" EXACT []
synonym: "type II NK T lymphocyte secreting interferon-gamma" EXACT []
synonym: "type II NK T-cell secreting interferon-gamma" EXACT []
synonym: "type II NK T-lymphocyte secreting interferon-gamma" EXACT []
synonym: "type II NKT cell secreting interferon-gamma" EXACT []
is_a: CL:0000922 {is_inferred="true"} ! type II NK T cell
intersection_of: CL:0000922 ! type II NK T cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: develops_from CL:0000931 ! activated type II NK T cell
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule

[Term]
id: CL:0000933
name: type II NK T cell secreting interleukin-4
namespace: cell
def: "A type II NK T cell that has been recently activated, secretes interleukin-4, and has the phenotype CD69-positive and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17964217]
synonym: "type II NK T cell secreting IL-4" EXACT []
synonym: "type II NK T lymphocyte secreting interleukin-4" EXACT []
synonym: "type II NK T-cell secreting interleukin-4" EXACT []
synonym: "type II NK T-lymphocyte secreting interleukin-4" EXACT []
synonym: "type II NKT cell secreting interleukin-4" EXACT []
is_a: CL:0000922 {is_inferred="true"} ! type II NK T cell
intersection_of: CL:0000922 ! type II NK T cell
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: develops_from CL:0000931 ! activated type II NK T cell
relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule

[Term]
id: CL:0000934
name: CD4-positive, alpha-beta cytotoxic T cell
namespace: cell
def: "A CD4-positive, alpha-beta T cell that has cytotoxic function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18440213]
synonym: "CD4-positive, alpha-beta cytotoxic T lymphocyte" EXACT []
synonym: "CD4-positive, alpha-beta cytotoxic T-cell" EXACT []
synonym: "CD4-positive, alpha-beta cytotoxic T-lymphocyte" EXACT []
is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell
intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell
intersection_of: capable_of GO:0001913 ! T cell mediated cytotoxicity
intersection_of: has_completed GO:0030217 ! T cell differentiation
relationship: capable_of GO:0001913 ! T cell mediated cytotoxicity
relationship: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell
relationship: has_completed GO:0030217 ! T cell differentiation

[Term]
id: CL:0000935
name: CD4-negative, CD8-negative, alpha-beta intraepithelial T cell
namespace: cell
def: "A CD4-negative, CD8-negative, alpha-beta intraepithelial T cell that is found in the columnar epithelium of the gastrointestinal tract." [GO_REF:0000031, GOC:add, GOC:pam, PMID:11685222]
synonym: "CD4-negative, CD8-negative, alpha-beta intraepithelial T lymphocyte" EXACT []
synonym: "CD4-negative, CD8-negative, alpha-beta intraepithelial T-cell" EXACT []
synonym: "CD4-negative, CD8-negative, alpha-beta intraepithelial T-lymphocyte" EXACT []
is_a: CL:0000797 {is_inferred="true"} ! alpha-beta intraepithelial T cell
intersection_of: CL:0000797 ! alpha-beta intraepithelial T cell
intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
intersection_of: lacks_plasma_membrane_part PR:000025403 ! T-cell surface glycoprotein CD8 alpha chain isoform 1
relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule
relationship: lacks_plasma_membrane_part PR:000025403 ! T-cell surface glycoprotein CD8 alpha chain isoform 1

[Term]
id: CL:0000936
name: early lymphoid progenitor
namespace: cell
def: "A lymphoid progenitor cell that is found in bone marrow, gives rise to B cells, T cells, natural killer cells and dendritic cells, and has the phenotype Lin-negative, Kit-positive, Sca-1-positive, FLT3-positive, CD34-positive, CD150 negative, and GlyA-negative." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:pam, GOC:tfm, PMID:19022770]
comment: Markers are associated with mouse cells. ELP transcription factors include E2A-positive, Ikaros-positive, EBF-negative, Pax5-negative, PU.1-negative.
synonym: "ELP" EXACT []
synonym: "GMLP" RELATED [PMID:18371378]
synonym: "LMPP" EXACT []
synonym: "lymphoid-primed multipotent progenitor" EXACT []
is_a: CL:0000837 {is_inferred="true"} ! hematopoietic multipotent progenitor cell
is_a: CL:0011026 ! progenitor cell
intersection_of: CL:0000837 ! hematopoietic multipotent progenitor cell
intersection_of: capable_of GO:0030098 ! lymphocyte differentiation
intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1
intersection_of: lacks_plasma_membrane_part PR:000001460 ! glycophorin-A
intersection_of: RO:0002104 PR:000002001 ! has plasma membrane part receptor-type tyrosine-protein kinase FLT3
intersection_of: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor
intersection_of: RO:0002104 PR:000002979 ! has plasma membrane part lymphocyte antigen 6A-2/6E-1
relationship: capable_of GO:0030098 ! lymphocyte differentiation
relationship: develops_from CL:0002035 ! Slamf1-negative multipotent progenitor cell
relationship: lacks_plasma_membrane_part PR:000001460 ! glycophorin-A
relationship: RO:0002104 PR:000002001 ! has plasma membrane part receptor-type tyrosine-protein kinase FLT3
relationship: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor
relationship: RO:0002104 PR:000002979 ! has plasma membrane part lymphocyte antigen 6A-2/6E-1

[Term]
id: CL:0000937
name: pre-natural killer cell
namespace: cell
def: "Cell committed to natural killer cell lineage that has the phenotype CD122-positive, CD34-positive, and CD117-positive. This cell type lacks expression of natural killer receptor proteins." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:pam, GOC:tfm, PMID:16551251, PMID:17100874]
comment: These cells are also reportedly CD7-low, CD10-negative, CD45RA-positive, alpha-4-beta-7 integrin-high.
synonym: "pre-NK cell" EXACT []
is_a: CARO:0000006
is_a: CL:0000623 ! natural killer cell
intersection_of: CL:0000623 ! natural killer cell
intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
intersection_of: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta
intersection_of: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor
relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
relationship: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta
relationship: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor

[Term]
id: CL:0000938
name: CD16-negative, CD56-bright natural killer cell, human
namespace: cell
def: "NK cell that has the phenotype CD56-bright, CD16-negative, and CD84-positive with the function to secrete interferon-gamma but is not cytotoxic." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19796267, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'CD16-CD56bright NK cell'. Markers are associated with human cell types.
synonym: "CD16-CD56bright NK cell" EXACT [PMID:22343568]
synonym: "CD16-negative, CD56-bright NK cell" EXACT []
synonym: "CD56-bright cytokine secreting natural killer cell" EXACT []
synonym: "CD56-bright cytokine secreting NK cell" EXACT []
is_a: CARO:0000006
is_a: CL:0000824 ! mature natural killer cell
intersection_of: CL:0000824 ! mature natural killer cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: has_high_plasma_membrane_amount PR:000001024 ! neural cell adhesion molecule 1
intersection_of: in_taxon NCBITaxon:9606 ! Homo sapiens
intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
intersection_of: lacks_plasma_membrane_part PR:000002015 ! MHC class II histocompatibility antigen alpha chain DRA
intersection_of: RO:0002104 PR:000001319 ! has plasma membrane part SLAM family member 5
relationship: has_high_plasma_membrane_amount PR:000001024 ! neural cell adhesion molecule 1
relationship: in_taxon NCBITaxon:9606 ! Homo sapiens
relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III
relationship: lacks_plasma_membrane_part PR:000002015 ! MHC class II histocompatibility antigen alpha chain DRA
relationship: RO:0002104 PR:000001319 ! has plasma membrane part SLAM family member 5

[Term]
id: CL:0000939
name: CD16-positive, CD56-dim natural killer cell, human
namespace: cell
def: "A mature natural killer cell that has the phenotype CD56-low, CD16-positive and which is capable of cytotoxicity and cytokine production." [GO_REF:0000031, GOC:add, GOC:pam, PMID:19796267, PMID:22343568]
comment: This cell type is compatible with the HIPC Lyoplate markers for 'CD16+CD56+ NK cell'. Markers are associated with human cell types.
synonym: "CD16+CD56+ NK cell" EXACT [PMID:22343568]
synonym: "CD16-positive, CD56-dim NK cell" EXACT []
synonym: "CD16-positive, CD56-low natural killer cell" EXACT []
synonym: "CD16-positive, CD56-low NK cell" EXACT []
synonym: "CD16-positive, CD56-positive natural killer cell" EXACT []
synonym: "CD16-positive, CD56-positive NK cell" EXACT []
synonym: "cytotoxic CD56-dim natural killer cell" EXACT []
synonym: "cytotoxic CD56-dim NK cell" EXACT []
is_a: CARO:0000006
is_a: CL:0000824 ! mature natural killer cell
intersection_of: CL:0000824 ! mature natural killer cell
intersection_of: capable_of GO:0001816 ! cytokine production
intersection_of: capable_of GO:0042267 ! natural killer cell mediated cytotoxicity
intersection_of: has_low_plasma_membrane_amount PR:000001024 ! neural cell adhesion molecule 1
intersection_of: in_taxon NCBITaxon:9606 ! Homo sapiens
intersection_of: lacks_plasma_membrane_part PR:000002015 ! MHC class II histocompatibility antigen alpha chain DRA
intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III
relationship: capable_of GO:0042267 ! natural killer cell mediated cytotoxicity
relationship: has_low_plasma_membrane_amount PR:000001024 ! neural cell adhesion molecule 1
relationship: in_taxon NCBITaxon:9606 ! Homo sapiens
relationship: lacks_plasma_membrane_part PR:000002015 ! MHC class II histocompatibility antigen alpha chain DRA
relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III

[Term]
id: CL:0000940
name: mucosal invariant T cell
namespace: cell
def: "An alpha-beta T cell that is found in the lamina propria of mucosal tissues and is restricted by the MR-1 molecule." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19416870]
synonym: "mucosal invariant T lymphocyte" EXACT []
synonym: "mucosal invariant T-cell" EXACT []
synonym: "mucosal invariant T-lymphocyte" EXACT []
is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell
intersection_of: CL:0000791 ! mature alpha-beta T cell
intersection_of: capable_of GO:0002227 ! innate immune response in mucosa
intersection_of: capable_of GO:0032394 ! MHC class Ib receptor activity
intersection_of: has_completed GO:0030217 ! T cell differentiation
relationship: capable_of GO:0002227 ! innate immune response in mucosa
relationship: capable_of GO:0032394 ! MHC class Ib receptor activity
relationship: has_completed GO:0030217 ! T cell differentiation

[Term]
id: CL:0000941
name: thymic conventional dendritic cell
namespace: cell
def: "A dendritic cell arising in thymus that has the phenotype CD11c-positive, CD11b-negative, and CD45RA-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:19273629]
comment: In the mouse this cell expresses CD8-alpha-alpha.
is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell
intersection_of: CL:0000990 ! conventional dendritic cell
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: part_of UBERON:0002370 ! thymus
intersection_of: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X
relationship: develops_from CL:0000894 ! DN1 thymic pro-T cell
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: part_of UBERON:0002370 ! thymus
relationship: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X

[Term]
id: CL:0000942
name: thymic plasmacytoid dendritic cell
namespace: cell
def: "A plasmacytoid dendritic cell developing in the thymus with phenotype CD11c-negative or low, CD45RA-positive, CD11b-negative, and CD123-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19941119]
is_a: CARO:0000006
is_a: CL:0000784 {is_inferred="true"} ! plasmacytoid dendritic cell
intersection_of: CL:0000784 ! plasmacytoid dendritic cell
intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
intersection_of: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain
relationship: develops_from CL:0000894 ! DN1 thymic pro-T cell
relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M
relationship: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA
relationship: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain

[Term]
id: CL:0000943
name: Be1 Cell
namespace: cell
def: "A Be cell that facilitates development of T-helper 1 (Th1) phenotype in CD4-positive T cells, and secretes high levels of interleukin-2, tumor necrosis factor-alpha and interferon-gamma." [GO_REF:0000031, GOC:dsd, GOC:msz, GOC:tfm, PMID:11101868, PMID:20224569]
comment: Be1 cells are also reportedly capable of secreting IL-6, IL-10, and IL-12. They are also reportedly CD11b-negative and B220-positive.
synonym: "B effector 1 cell" EXACT [PMID:11101868, PMID:20224569]
synonym: "B effector cell type 1" RELATED []
is_a: CL:0000968 {is_inferred="true"} ! Be cell
intersection_of: CL:0000968 ! Be cell
intersection_of: capable_of GO:0032609 ! interferon-gamma production
intersection_of: capable_of GO:0032623 ! interleukin-2 production
intersection_of: capable_of GO:0032640 ! tumor necrosis factor production
intersection_of: capable_of GO:0045627 ! positive regulation of T-helper 1 cell differentiation
relationship: capable_of GO:0032609 ! interferon-gamma production
relationship: capable_of GO:0032623 ! interleukin-2 production
relationship: capable_of GO:0032640 ! tumor necrosis factor production
relationship: capable_of GO:0045627 ! positive regulation of T-helper 1 cell differentiation

[Term]
id: CL:0000944
name: Be2 cell
namespace: cell
def: "A Be cell that facilitates development of T-helper 2 (Th2) phenotype T cells, and secretes high levels of interleukin-2, interleukin-10, interleukin-4, and interleukin-6." [GO_REF:0000031, GOC:dsd, GOC:msz, GOC:tfm, PMID:11101868, PMID:20224569]
comment: Be2 cells are also reportedly capable of secreting IL-13 and TNF. They are also reportedly CD11b-negative and B220-positive.
synonym: "B effector 2 cell" EXACT [PMID:11101868, PMID:20224569]
synonym: "B effector cell type 2" RELATED []
is_a: CL:0000968 {is_inferred="true"} ! Be cell
intersection_of: CL:0000968 ! Be cell
intersection_of: capable_of GO:0032613 ! interleukin-10 production
intersection_of: capable_of GO:0032623 ! interleukin-2 production
intersection_of: capable_of GO:0032633 ! interleukin-4 production
intersection_of: capable_of GO:0032635 ! interleukin-6 production
intersection_of: capable_of GO:0045630 ! positive regulation of T-helper 2 cell differentiation
relationship: capable_of GO:0032613 ! interleukin-10 production
relationship: capable_of GO:0032623 ! interleukin-2 production
relationship: capable_of GO:0032633 ! interleukin-4 production
relationship: capable_of GO:0032635 ! interleukin-6 production
relationship: capable_of GO:0045630 ! positive regulation of T-helper 2 cell differentiation

[Term]
id: CL:0000945
name: lymphocyte of B lineage
namespace: cell
def: "A lymphocyte of B lineage with the commitment to express an immunoglobulin complex." [GO_REF:0000031, GOC:add, GOC:rhs, GOC:tfm, ISBN:0781735149]
comment: Types of B lineage lymphocytes include B cells and antibody secreting cells (plasmablasts and plasma cells).  Lymphocytes of B cell lineage can be distinguished from those of T cell lineage by their lack of CD3e (as part of the T cell receptor complex).
is_a: CL:0000542 {is_inferred="true"} ! lymphocyte
relationship: develops_from CL:0000826 ! pro-B cell

[Term]
id: CL:0000946
name: antibody secreting cell
namespace: cell
def: "A lymphocyte of B lineage that is devoted to secreting large amounts of immunoglobulin." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0721601464, ISBN:0781735149]
is_a: CL:0000945 {is_inferred="true"} ! lymphocyte of B lineage
intersection_of: CL:0000945 ! lymphocyte of B lineage
intersection_of: produces GO:0042571 ! immunoglobulin complex, circulating
relationship: produces GO:0042571 ! immunoglobulin complex, circulating

[Term]
id: CL:0000947
name: IgE plasma cell
namespace: cell
def: "A long lived plasma cell that secretes IgE." [GO_REF:0000031, GOC:msz, ISBN:781735149]
is_a: CL:0000974 {is_inferred="true"} ! long lived plasma cell
intersection_of: CL:0000974 ! long lived plasma cell
intersection_of: produces GO:0071743 ! IgE immunoglobulin complex, circulating
relationship: produces GO:0071743 ! IgE immunoglobulin complex, circulating

[Term]
id: CL:0000948
name: IgE memory B cell
namespace: cell
def: "A class switched memory B cell that expresses IgE on the cell surface." [GO_REF:0000031, GOC:rhs, ISBN:0781765196]
synonym: "IgE memory B lymphocyte" EXACT []
synonym: "IgE memory B-cell" EXACT []
synonym: "IgE memory B-lymphocyte" EXACT []
synonym: "memory IgE B cell" EXACT []
synonym: "memory IgE B lymphocyte" EXACT []
synonym: "memory IgE B-cell" EXACT []
synonym: "memory IgE B-lymphocyte" EXACT []
is_a: CL:0000972 {is_inferred="true"} ! class switched memory B cell
intersection_of: CL:0000972 ! class switched memory B cell
intersection_of: RO:0002104 GO:0071742 ! has plasma membrane part IgE immunoglobulin complex
relationship: RO:0002104 GO:0071742 ! has plasma membrane part IgE immunoglobulin complex

[Term]
id: CL:0000949
name: IgD plasmablast
namespace: cell
def: "A plasmablast that secretes IgD, and which occur in a small proportion of B cells in the adult." [GO_REF:0000031, GOC:msz]
is_a: CL:0000980 {is_inferred="true"} ! plasmablast
intersection_of: CL:0000980 ! plasmablast
intersection_of: produces GO:0071739 ! IgD immunoglobulin complex, circulating
relationship: produces GO:0071739 ! IgD immunoglobulin complex, circulating

[Term]
id: CL:0000950
name: IgE plasmablast
namespace: cell
def: "A plasmablast that secretes IgE." [GO_REF:0000031, GOC:msz]
is_a: CL:0000980 {is_inferred="true"} ! plasmablast
intersection_of: CL:0000980 ! plasmablast
intersection_of: produces GO:0071743 ! IgE immunoglobulin complex, circulating
relationship: produces GO:0071743 ! IgE immunoglobulin complex, circulating

[Term]
id: CL:0000951
name: IgE short lived plasma cell
namespace: cell
def: "A short lived plasma cell that secretes IgE." [GO_REF:0000031, GOC:msz, ISBN:781735149]
is_a: CL:0000975 {is_inferred="true"} ! short lived plasma cell
intersection_of: CL:0000975 ! short lived plasma cell
intersection_of: produces GO:0071743 ! IgE immunoglobulin complex, circulating
relationship: produces GO:0071743 ! IgE immunoglobulin complex, circulating

[Term]
id: CL:0000952
name: preBCR-positive large pre-B-II cell
namespace: cell
def: "An preBRC-positive large pre-B-II cell is a large pre-B-II cell that is pre-B cell receptor-positive, composed of surrogate light chain protein (SL), which is composed of VpreB , Lambda 5/14.1, in complex with immunoglobulin mu heavy chain (IgHmu) on the cell surface." [GO_REF:0000031, GOC:rhs, GOC:tfm, PMID:9785673]
is_a: CL:0000957 {is_inferred="true"} ! large pre-B-II cell
intersection_of: CL:0000957 ! large pre-B-II cell
intersection_of: has_not_completed GO:0071708 ! immunoglobulin light chain V-J recombination
intersection_of: RO:0002104 GO:0035369 ! has plasma membrane part pre-B cell receptor complex
intersection_of: RO:0002104 PR:000001858 ! has plasma membrane part immunoglobulin iota chain
intersection_of: RO:0002104 PR:000001859 ! has plasma membrane part immunoglobulin lambda-like polypeptide 1
relationship: has_not_completed GO:0071708 ! immunoglobulin light chain V-J recombination
relationship: RO:0002104 GO:0035369 ! has plasma membrane part pre-B cell receptor complex
relationship: RO:0002104 PR:000001858 ! has plasma membrane part immunoglobulin iota chain
relationship: RO:0002104 PR:000001859 ! has plasma membrane part immunoglobulin lambda-like polypeptide 1

[Term]
id: CL:0000953
name: preBCR-negative large pre-B-II cell
namespace: cell
def: "A pre-BCR-negative large pre-B-II cell is a large pre-B-II cell that is pre-B cell receptor-negative, composed of surrogate light chain protein (SL), which is composed of VpreB and Lambda 5/14.1, in complex with immunoglobulin mu heavy chain (IgHmu), on the cell surface, and lack a DNA rearrangement of immunoglobulin light chain genes." [GO_REF:0000031, GOC:rhs, GOC:tfm, PMID:9785673]
is_a: CL:0000957 {is_inferred="true"} ! large pre-B-II cell
intersection_of: CL:0000957 ! large pre-B-II cell
intersection_of: has_not_completed GO:0071708 ! immunoglobulin light chain V-J recombination
intersection_of: lacks_plasma_membrane_part GO:0035369 ! pre-B cell receptor complex
intersection_of: lacks_plasma_membrane_part PR:000001858 ! immunoglobulin iota chain
intersection_of: lacks_plasma_membrane_part PR:000001859 ! immunoglobulin lambda-like polypeptide 1
relationship: has_not_completed GO:0071708 ! immunoglobulin light chain V-J recombination
relationship: lacks_plasma_membrane_part GO:0035369 ! pre-B cell receptor complex
relationship: lacks_plasma_membrane_part PR:000001858 ! immunoglobulin iota chain
relationship: lacks_plasma_membrane_part PR:000001859 ! immunoglobulin lambda-like polypeptide 1

[Term]
id: CL:0000954
name: small pre-B-II cell
namespace: cell
def: "A small pre-B-II cell is a pre-B-II cell that is Rag1-positive, Rag2-positive, pre-BCR-negative, and BCR-negative, is not proliferating, and carries a DNA rearrangement of one or more immunoglobulin light chain genes." [GO_REF:0000031, GOC:dsd, GOC:rhs, GOC:tfm, PMID:16551251, PMID:18432934, PMID:9785673]
comment: Small pre-B-II cells are also reportedly CD10-positive, CD19-positive, CD34-negative, CD79a-positive, CD127-negative, TdT-negative, Vpre-B-negative, sIgM-negative, and sIgD-negative. Transcription factors: PU.1-positive, Ikaros-positive, E2A-positive, and PAX5-positive.
synonym: "small pre-BII cell" EXACT []
is_a: CL:0000955 {is_inferred="true"} ! pre-B-II cell
intersection_of: CL:0000955 ! pre-B-II cell
intersection_of: has_part PR:000003457 ! V(D)J recombination-activating protein 1
intersection_of: has_part PR:000003460 ! V(D)J recombination-activating protein 2
intersection_of: lacks_plasma_membrane_part GO:0019815 ! B cell receptor complex
intersection_of: lacks_plasma_membrane_part GO:0035369 ! pre-B cell receptor complex
intersection_of: participates_in GO:0071708 ! immunoglobulin light chain V-J recombination
relationship: has_part PR:000003457 ! V(D)J recombination-activating protein 1
relationship: has_part PR:000003460 ! V(D)J recombination-activating protein 2
relationship: lacks_plasma_membrane_part GO:0019815 ! B cell receptor complex
relationship: lacks_plasma_membrane_part GO:0035369 ! pre-B cell receptor complex
relationship: participates_in GO:0071708 ! immunoglobulin light chain V-J recombination

[Term]
id: CL:0000955
name: pre-B-II cell
namespace: cell
def: "A pre-B-II cell is a precursor B cell that expresses immunoglobulin mu heavy chain (IgHmu+), and lack expression of CD34, TdT, immunoglobulin kappa light chain and immunoglobulin lambda light chain." [GO_REF:0000031, GOC:dsd, GOC:rhs, GOC:tfm, PMID:9785673]
comment: pre-B-II cell are also reportedly CD19-positive, CD22-positive, CD38-positive, CD45-positive, and CD48-positive.
synonym: "pre-B-lymphocyte" EXACT []
synonym: "pre-BII cell" EXACT []
xref: BTO:0001133
xref: CALOHA:TS-0819
is_a: CL:0000817 {is_inferred="true"} ! precursor B cell
intersection_of: CL:0000817 ! precursor B cell
intersection_of: has_completed GO:0071707 ! immunoglobulin heavy chain V-D-J recombination
intersection_of: lacks_part PR:000006611 ! DNA nucleotidylexotransferase
intersection_of: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule
disjoint_from: CL:0000956 ! pre-B-I cell
relationship: has_completed GO:0071707 ! immunoglobulin heavy chain V-D-J recombination
relationship: lacks_part PR:000006611 ! DNA nucleotidylexotransferase
relationship: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule

[Term]
id: CL:0000956
name: pre-B-I cell
namespace: cell
def: "A pre-B-I cell is a precursor B cell that expresses CD34 and surrogate immunoglobulin light chain (VpreB , Lambda 5 (mouse)/14.1 (human)) on the cell surface, and TdT, Rag1,and Rag2 intracellularly. Cell type carries a D-JH DNA rearrangement, and lacks expression of immunglobulin heavy chain protein." [GO_REF:0000031, GOC:dsd, GOC:rhs, GOC:tfm, PMID:16551251, PMID:18432934, PMID:20839338, PMID:9785673]
comment: Human pre-B-I cells are reportedly CD10-positive, CD19-positive, CD22-positive, CD38-positive, CD45-low, CD79a-positive, CD127-negative, pre-BCR-negative, IgM-negative, IgD-negative, and Tdt-positive. Transcription factors expressed: Pax5-positive.
synonym: "pre-BI cell" EXACT []
synonym: "pro-B cell (Philadelphia nomenclature)" RELATED [PMID:11244048]
is_a: CL:0000817 {is_inferred="true"} ! precursor B cell
intersection_of: CL:0000817 ! precursor B cell
intersection_of: has_part PR:000003457 ! V(D)J recombination-activating protein 1
intersection_of: has_part PR:000003460 ! V(D)J recombination-activating protein 2
intersection_of: has_part PR:000006611 ! DNA nucleotidylexotransferase
intersection_of: participates_in GO:0071707 ! immunoglobulin heavy chain V-D-J recombination
intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
intersection_of: RO:0002104 PR:000001858 ! has plasma membrane part immunoglobulin iota chain
intersection_of: RO:0002104 PR:000001859 ! has plasma membrane part immunoglobulin lambda-like polypeptide 1
relationship: has_part PR:000003457 ! V(D)J recombination-activating protein 1
relationship: has_part PR:000003460 ! V(D)J recombination-activating protein 2
relationship: has_part PR:000006611 ! DNA nucleotidylexotransferase
relationship: participates_in GO:0071707 ! immunoglobulin heavy chain V-D-J recombination
relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule
relationship: RO:0002104 PR:000001858 ! has plasma membrane part immunoglobulin iota chain
relationship: RO:0002104 PR:000001859 ! has plasma membrane part immunoglobulin lambda-like polypeptide 1

[Term]
id: CL:0000957
name: large pre-B-II cell
namespace: cell
def: "A large pre-B-II cell is a pre-B-II cell that is proliferating and is Rag1-negative and Rag2-negative." [GO_REF:0000031, GOC:dsd, GOC:rhs, PMID:16551251, PMID:18432934, PMID:9785673]
comment: Large pre-B-II cells are also reportedly CD10-positive, CD19-positive, CD34-negative, CD79a-positive, CD127-negative, TdT-negative, Vpre-B-positive, pre-BCR-positive, sIgM-negative, and sIgD-negative. Transcription factors: PU.1-positive, Ikaros-positive, E2A-positive, and PAX5-positive.
synonym: "large pre-B cell" BROAD [PMID:11244048]
synonym: "large pre-BII cell" EXACT []
is_a: CL:0000955 {is_inferred="true"} ! pre-B-II cell
intersection_of: CL:0000955 ! pre-B-II cell
intersection_of: lacks_part PR:000003457 ! V(D)J recombination-activating protein 1
intersection_of: lacks_part PR:000003460 ! V(D)J recombination-activating protein 2
intersection_of: participates_in GO:0046651 ! lymphocyte proliferation
relationship: lacks_part PR:000003457 ! V(D)J recombination-activating protein 1
relationship: lacks_part PR:000003460 ! V(D)J recombination-activating protein 2
relationship: participates_in GO:0046651 ! lymphocyte proliferation

[Term]
id: CL:0000958
name: T1 B cell
namespace: cell
def: "A transitional stage B cell that migrates from the bone marrow into the peripheral circulation, and finally to the spleen. This cell type has the phenotype surface IgM-positive, surface IgD-negative, CD21-negative, CD23-negative, and CD62L-negative, and CD93-positive. This cell type has also been described as IgM-high, CD19-positive, B220-positive, AA4-positive, and CD23-negative." [GO_REF:0000031, GOC:dsd, GOC:msz, GOC:tfm, PMCID:PMC2193793, PMID:12810111]
comment: T1 B cells are also reportedly CD10-negative/positive??, CD20-positive, CD24-positive, CD38-positive, CD48-positive, CD84-positive, CD150-positive, CD244-negative, and CD352-positive.
synonym: "T1 B lymphocyte" EXACT []
synonym: "T1 B-cell" EXACT []
synonym: "T1 B-lymphocyte" EXACT []
synonym: "transitional stage 1 B cell" EXACT []
is_a: CL:0000818 {is_inferred="true"} ! transitional stage B cell
intersection_of: CL:0000818 ! transitional stage B cell
intersection_of: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin
intersection_of: lacks_plasma_membrane_part PR:000001338 ! complement receptor type 2
intersection_of: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
intersection_of: RO:0002104 PR:000002037 ! has plasma membrane part complement component C1q receptor
relationship: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin
relationship: lacks_plasma_membrane_part PR:000001338 ! complement receptor type 2
relationship: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
relationship: RO:0002104 PR:000002037 ! has plasma membrane part complement component C1q receptor

[Term]
id: CL:0000959
name: T2 B cell
namespace: cell
def: "A transitional stage B cell that has the phenotype surface IgM-positive, surface IgD-postive, CD21-positive, CD23-positive, CD62L-negative, CD93-positive and is located in the splenic B follicles. This cell type has also been described as IgM-high, CD19-positive, B220-positive, AA4-positive, and CD23-positive." [GO_REF:0000031, GOC:dsd, GOC:msz, GOC:tfm, PMCID:PMC2193793, PMID:12810111]
comment: T2 B cells are also reportedly CD20-positive, CD24-positive, CD38-positive, CD48-positive, CD84-positive, CD150-positive, CD244-negative, and CD352-positive.
synonym: "T2 B lymphocyte" EXACT []
synonym: "T2 B-cell" EXACT []
synonym: "T2 B-lymphocyte" EXACT []
synonym: "transitional stage 2 B cell" EXACT []
is_a: CL:0000818 {is_inferred="true"} ! transitional stage B cell
intersection_of: CL:0000818 ! transitional stage B cell
intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
intersection_of: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor
intersection_of: RO:0002104 PR:000002037 ! has plasma membrane part complement component C1q receptor
relationship: develops_from CL:0000958 ! T1 B cell
relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
relationship: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor
relationship: RO:0002104 PR:000002037 ! has plasma membrane part complement component C1q receptor

[Term]
id: CL:0000960
name: T3 B cell
namespace: cell
def: "A transitional stage B cell that expresses surface IgM and IgD, and CD62L. This cell type appears to be an anergic B cell that does not proliferate upon BCR signaling, is found in the spleen and lymph nodes, and has the phenotype surface IgM-positive, surface IgD-positive, CD21-positive, CD23-positive, CD62L-positive, and CD93-positive. This cell type has also been described as IgM-low, CD19-positive, B220-positive, AA4-positive, and CD23-positive (i.e. this cell-type is distinguished from T2 cells by surface expression of IgM)." [GO_REF:0000031, GOC:msz, GOC:tfm, http://www.immgen.org/index_content.html, PMID:12810111, PMID:17174121]
synonym: "An1 B cell" EXACT [PMID:17174121]
synonym: "T3 B lymphocyte" EXACT []
synonym: "T3 B-cell" EXACT []
synonym: "T3 B-lymphocyte" EXACT []
synonym: "transitional stage 3 B cell" EXACT []
is_a: CL:0000818 {is_inferred="true"} ! transitional stage B cell
intersection_of: CL:0000818 ! transitional stage B cell
intersection_of: participates_in GO:0002515 ! B cell anergy
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex
intersection_of: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin
intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
intersection_of: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor
relationship: develops_from CL:0000959 ! T2 B cell
relationship: participates_in GO:0002515 ! B cell anergy
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin
relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2
relationship: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor

[Term]
id: CL:0000961
name: Bm1 B cell
namespace: cell
def: "A follicular B cell that is IgD-positive, CD23-negative, and CD38-negative. This naive cell type is activated in the extrafollicular areas through interaction with interdigitating dendritic cells and antigen-specific CD4-positive T cells." [GO_REF:0000031, GOC:dsd, GOC:msz, PMID:17992590, PMID:18432934, PMID:8006591]
comment: These cells are also reportedly CD10-negative, CD39-positive, CD44-positive, CD71-negative, CD77-negative, IgM-positive, IgG-negative, IgA-negative, and IgE-negative.
synonym: "Bm1 B lymphocyte" EXACT []
synonym: "Bm1 B-cell" EXACT []
synonym: "Bm1 B-lymphocyte" EXACT []
is_a: CL:0000843 {is_inferred="true"} ! follicular B cell
is_a: CL:0002056 ! Fraction F mature B cell
intersection_of: CL:0000843 ! follicular B cell
intersection_of: lacks_plasma_membrane_part PR:000001408 ! ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
intersection_of: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: lacks_plasma_membrane_part PR:000001408 ! ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

[Term]
id: CL:0000962
name: Bm2 B cell
namespace: cell
def: "A follicular B cell that is IgD-positive and CD23-positive and CD38-positive. This naive cell type is activated in the extrafollicular areas via interaction with dendritic cells and antigen specific T cells." [GO_REF:0000031, GOC:dsd, GOC:msz, PMID:17992590, PMID:18432934, PMID:8006591]
comment: These cells are also CD10-negative, CD39-positive, CD44-positive, CD71-negative, CD77-negative, IgM-positive, IgG-negative, IgA-negative, and IgE-negative.
synonym: "Bm2 B lymphocyte" EXACT []
synonym: "Bm2 B-cell" EXACT []
synonym: "Bm2 B-lymphocyte" EXACT []
is_a: CL:0000843 {is_inferred="true"} ! follicular B cell
intersection_of: CL:0000843 ! follicular B cell
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
intersection_of: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor
relationship: develops_from CL:0000961 ! Bm1 B cell
relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: RO:0002104 PR:000001880 ! has plasma membrane part low affinity immunoglobulin epsilon Fc receptor

[Term]
id: CL:0000963
name: Bm3-delta B cell
namespace: cell
def: "A germinal center B cell that develops from a Bm3 B cell. This cell has the phenotype IgM-negative, IgD-positive, and CD38-positive." [GO_REF:0000031, GOC:add, GOC:msz, GOC:tfm, PMID:9280752]
synonym: "Bm3-delta B lymphocyte" EXACT []
synonym: "Bm3-delta B-cell" EXACT []
synonym: "Bm3-delta B-lymphocyte" EXACT []
is_a: CL:0000844 {is_inferred="true"} ! germinal center B cell
intersection_of: CL:0000844 ! germinal center B cell
intersection_of: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: develops_from CL:0000965 ! Bm3 B cell
relationship: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

[Term]
id: CL:0000964
name: Bm2' B cell
namespace: cell
def: "A germinal center B cell that founds a germinal center, and has the phenotype IgD-positive, CD38-positive, and CD23-negative." [GO_REF:0000031, GOC:dsd, GOC:msz, GOC:tfm, PMID:17992590, PMID:18432934, PMID:8006591]
comment: Bm2' B cells are also reportedly CD10-positive, CD39-negative, CD44-negative, CD71-positive, CD77-negative, IgM-positive, IgG-negative, IgA-negative, and IgE-negative.
synonym: "Bm2' B lymphocyte" EXACT []
synonym: "Bm2' B-cell" EXACT []
synonym: "Bm2-prime B cell" EXACT []
synonym: "Bm2-prime B-lymphocyte" EXACT []
synonym: "germinal center founder cell" RELATED []
is_a: CL:0000844 {is_inferred="true"} ! germinal center B cell
intersection_of: CL:0000844 ! germinal center B cell
intersection_of: capable_of GO:0002634 ! regulation of germinal center formation
intersection_of: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: capable_of GO:0002634 ! regulation of germinal center formation
relationship: develops_from CL:0000962 ! Bm2 B cell
relationship: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor
relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex
relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

[Term]
id: CL:0000965
name: Bm3 B cell
namespace: cell
def: "A germinal center B cell that is rapidly dividing and has the phenotype IgD-negative, CD38-positive, and CD77-positive. Somatic hypermutation of the immunoglobulin V gene region can occur during proliferation of this cell type." [GO_REF:0000031, GOC:dsd, GOC:msz, PMID:18432934, PMID:8006591]
comment: Bm3 B cells are also reportedly CD10-positive, CD23-negative, CD39-negative, CD44-negative, CD71-positive, and CD77-positive.
synonym: "Bm3 B lymphocyte" EXACT []
synonym: "Bm3 B-cell" EXACT []
synonym: "Bm3 B-lymphocyte" EXACT []
synonym: "centroblast" RELATED [PMID:8006591]
is_a: CL:0000844 {is_inferred="true"} ! germinal center B cell
intersection_of: CL:0000844 ! germinal center B cell
intersection_of: capable_of GO:0016446 ! somatic hypermutation of immunoglobulin genes
intersection_of: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
intersection_of: RO:0002104 PR:000003516 ! has plasma membrane part lactosylceramide 4-alpha-galactosyltransferase
relationship: capable_of GO:0016446 ! somatic hypermutation of immunoglobulin genes
relationship: develops_from CL:0000964 ! Bm2' B cell
relationship: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex
relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
relationship: RO:0002104 PR:000003516 ! has plasma membrane part lactosylceramide 4-alpha-galactosyltransferase

[Term]
id: CL:0000966
name: Bm4 B cell
namespace: cell
def: "A germinal center B cell that has the phenotype CD77-negative, IgD-negative, and CD38-positive. These cells have undergone somatic mutation of the B cell receptor." [GO_REF:0000031, GOC:dsd, GOC:msz, PMID:18432934, PMID:8006591]
comment: Bm4 B cells are also reportedly CD10-positive, CD23-negative, CD39-negative, CD44-positive, and CD71-positive.
synonym: "Bm4 B lymphocyte" EXACT []
synonym: "Bm4 B-cell" EXACT []
synonym: "Bm4 B-lymphocyte" EXACT []
synonym: "centrocyte" RELATED [PMID:17992590]
is_a: CL:0000844 {is_inferred="true"} ! germinal center B cell
intersection_of: CL:0000844 ! germinal center B cell
intersection_of: has_co