format-version: 1.2 data-version: releases/2022-11-25 subsetdef: 1_STAR "" subsetdef: 2_STAR "" subsetdef: 3_STAR "" subsetdef: abnormal_slim "" subsetdef: added_for_HCA "" subsetdef: attribute_slim "" subsetdef: BDS_subset "" subsetdef: cell_quality "" subsetdef: core "" subsetdef: cumbo "" subsetdef: cyclostome_subset "" subsetdef: developmental_classification "" subsetdef: disposition_slim "" subsetdef: dubious_grouping "" subsetdef: early_development "" subsetdef: efo_slim "" subsetdef: emapa_ehdaa2 "" subsetdef: functional_classification "" subsetdef: gocheck_do_not_annotate "" subsetdef: gocheck_do_not_manually_annotate "" subsetdef: goslim_agr "" subsetdef: goslim_candida "" subsetdef: goslim_chembl "" subsetdef: goslim_drosophila "" subsetdef: goslim_flybase_ribbon "" subsetdef: goslim_generic "" subsetdef: goslim_metagenomics "" subsetdef: goslim_mouse "" subsetdef: goslim_pir "" subsetdef: goslim_plant "" subsetdef: goslim_pombe "" subsetdef: goslim_synapse "" subsetdef: goslim_yeast "" subsetdef: grouping_class "" subsetdef: homology_grouping "" subsetdef: http://purl.obolibrary.org/obo/valid_for_go_annotation_extension "" subsetdef: http://purl.obolibrary.org/obo/valid_for_go_gp2term "" subsetdef: http://purl.obolibrary.org/obo/valid_for_go_ontology "" subsetdef: http://purl.obolibrary.org/obo/valid_for_gocam "" subsetdef: human_reference_atlas "" subsetdef: inconsistent_with_fma "" subsetdef: location_grouping "" subsetdef: major_organ "" subsetdef: mpath_slim "" subsetdef: non_informative "" subsetdef: organ_slim "" subsetdef: pheno_slim "" subsetdef: phenotype_rcn "" subsetdef: plus "" subsetdef: prokaryote_subset "" subsetdef: relational_slim "" subsetdef: ro-eco "" subsetdef: RO:0002259 "" subsetdef: scalar_slim "" subsetdef: uberon_slim "" subsetdef: ubprop:upper_level "abstract upper-level terms not directly useful for analysis" subsetdef: unverified_taxonomic_grouping "" subsetdef: upper_level "" subsetdef: value_slim "" subsetdef: vertebrate_core "" synonymtypedef: ABBREVIATION "" synonymtypedef: abbreviation "abbreviation" synonymtypedef: blast_name "" synonymtypedef: BRAND_NAME "" synonymtypedef: common_name "" synonymtypedef: COMPARATIVE_PREFERRED "" synonymtypedef: DEPRECATED "" synonymtypedef: DUBIOUS "" synonymtypedef: equivalent_name "" synonymtypedef: FORMULA "" synonymtypedef: genbank_common_name "" synonymtypedef: Gene-based "" synonymtypedef: HOMOLOGY "" synonymtypedef: HUMAN_PREFERRED "" synonymtypedef: HUMAN_PREFERRED "preferred term when talking about an instance of this class in Homo sapiens" synonymtypedef: in_part "" synonymtypedef: InChI "" synonymtypedef: InChIKey "" synonymtypedef: INCONSISTENT "" synonymtypedef: INN "" synonymtypedef: IUPAC_NAME "" synonymtypedef: LATIN "" synonymtypedef: LATIN "latin term" synonymtypedef: MISSPELLING "" synonymtypedef: NON_MAMMAL "" synonymtypedef: PENDING_REVIEW "" synonymtypedef: PLURAL "" synonymtypedef: PLURAL "plural term" synonymtypedef: PRO-proteoform-ftid "" synonymtypedef: PRO-proteoform-std "" synonymtypedef: PRO-short-label "" synonymtypedef: scientific_name "" synonymtypedef: SENSU "" synonymtypedef: SMILES "" synonymtypedef: syngo_official_label "" synonymtypedef: synonym "" synonymtypedef: SYSTEMATIC "" synonymtypedef: systematic_synonym "" remark: See PMID:15693950, PMID:12799354, PMID:20123131, PMID:21208450; Contact Alexander Diehl, addiehl@buffalo.edu, University at Buffalo. ontology: cl property_value: dc-contributor https://orcid.org/0000-0001-5208-3432 property_value: dc-contributor https://orcid.org/0000-0001-9114-8737 property_value: dc-contributor https://orcid.org/0000-0001-9990-8331 property_value: dc-contributor https://orcid.org/0000-0002-2244-7917 property_value: dc-contributor https://orcid.org/0000-0002-6601-2165 property_value: dc-contributor https://orcid.org/0000-0002-7073-9172 property_value: dc-contributor https://orcid.org/0000-0002-8688-6599 property_value: dc-contributor https://orcid.org/0000-0002-9900-7880 property_value: dc-contributor https://orcid.org/0000-0003-1980-3228 property_value: dc-description "An ontology of cell types." xsd:string property_value: dc-title "Cell Ontology" xsd:string property_value: dcterms-license http://creativecommons.org/licenses/by/4.0/ property_value: has_ontology_root_term CL:0000000 property_value: owl:versionInfo "2022-11-25" xsd:string [Term] id: BFO:0000002 name: continuant def: "An entity that exists in full at any time in which it exists at all, persists through time while maintaining its identity and has no temporal parts." [] disjoint_from: BFO:0000003 ! occurrent relationship: part_of BFO:0000002 ! continuant [Term] id: BFO:0000003 name: occurrent def: "An entity that has temporal parts and that happens, unfolds or develops through time." [] relationship: part_of BFO:0000003 ! occurrent [Term] id: BFO:0000004 name: independent continuant def: "A continuant that is a bearer of quality and realizable entity entities, in which other entities inhere and which itself cannot inhere in anything." [] is_a: BFO:0000002 ! continuant disjoint_from: BFO:0000020 ! specifically dependent continuant disjoint_from: BFO:0000031 ! generically dependent continuant relationship: part_of BFO:0000004 ! independent continuant [Term] id: BFO:0000006 name: spatial region is_a: BFO:0000141 ! immaterial entity [Term] id: BFO:0000015 name: process def: "An occurrent that has temporal proper parts and for some time t, p s-depends_on some material entity at t." [] is_a: BFO:0000003 ! occurrent [Term] id: BFO:0000016 name: disposition is_a: BFO:0000017 ! realizable entity disjoint_from: BFO:0000023 ! role [Term] id: BFO:0000017 name: realizable entity def: "A specifically dependent continuant that inheres in continuant entities and are not exhibited in full at every time in which it inheres in an entity or group of entities. The exhibition or actualization of a realizable entity is a particular manifestation, functioning or process that occurs under certain circumstances." [] is_a: BFO:0000020 ! specifically dependent continuant disjoint_from: BFO:0000019 ! quality relationship: part_of BFO:0000017 ! realizable entity [Term] id: BFO:0000019 name: quality is_a: BFO:0000020 ! specifically dependent continuant relationship: part_of BFO:0000019 ! quality [Term] id: BFO:0000020 name: specifically dependent continuant def: "A continuant that inheres in or is borne by other entities. Every instance of A requires some specific instance of B which must always be the same." [] is_a: BFO:0000002 ! continuant disjoint_from: BFO:0000031 ! generically dependent continuant relationship: part_of BFO:0000020 ! specifically dependent continuant [Term] id: BFO:0000023 name: role def: "A realizable entity the manifestation of which brings about some result or end that is not essential to a continuant in virtue of the kind of thing that it is but that can be served or participated in by that kind of continuant in some kinds of natural, social or institutional contexts." [] is_a: CHEBI:50906 ! role equivalent_to: CHEBI:50906 ! role [Term] id: BFO:0000031 name: generically dependent continuant def: "A continuant that is dependent on one or other independent continuant bearers. For every instance of A requires some instance of (an independent continuant type) B but which instance of B serves can change from time to time." [] is_a: BFO:0000002 ! continuant relationship: part_of BFO:0000031 ! generically dependent continuant [Term] id: BFO:0000034 name: function is_a: BFO:0000016 ! disposition [Term] id: BFO:0000040 name: material entity def: "An independent continuant that is spatially extended whose identity is independent of that of other entities and can be maintained through time." [] is_a: BFO:0000004 ! independent continuant disjoint_from: BFO:0000141 ! immaterial entity [Term] id: BFO:0000141 name: immaterial entity is_a: BFO:0000004 ! independent continuant [Term] id: CARO:0000000 name: anatomical entity def: "A part of a cellular organism that is either an immaterial entity or a material entity with granularity above the level of a protein complex. Or, a substance produced by a cellular organism with granularity above the level of a protein complex." [CAROC:Brownsville2014] comment: Following BFO, material anatomical entities may have immaterial parts (the lumen of your stomach is part of your stomach). The granularity limit follows the limits set by the Gene Ontology on the granularity limit for GO:cellular_component. Note that substances produced by an organism (sweat, feaces, urine) do not need to be part of an organism to qualify as an anatomical structure. is_a: CARO:0030000 ! biological entity [Term] id: CARO:0000003 name: connected anatomical structure def: "Material anatomical entity that is a single connected structure with inherent 3D shape generated by coordinated expression of the organism's own genome." [] comment: Note that the definition does not say 'generated exclusively by the co-ordinated expression of the organism's own genome', so this is still valid for cases where normal morphogenesis requires the actions of a facultative symbiont, or some looser dependency such as the a requirement for the presence of gut flora for normal gut development. subset: core is_a: CARO:0000006 ! material anatomical entity intersection_of: CARO:0000006 ! material anatomical entity intersection_of: bearer_of PATO:0002266 ! 3-D shape intersection_of: bearer_of PATO:0010000 ! maximally connected disjoint_from: CARO:0000004 ! organism substance relationship: bearer_of PATO:0002266 ! 3-D shape relationship: bearer_of PATO:0010000 ! maximally connected [Term] id: CARO:0000004 name: organism substance def: "Material anatomical entity in a gaseous, liquid, semisolid or solid state; produced by anatomical structures or derived from inhaled and ingested substances that have been modified by anatomical structures as they pass through the body and that does not have inherent 3D shape generated by coordinated expression of the organism's own genome." [] comment: Note - CARO explicitly declares organisms substances to be part of (some) organism. synonym: "portion of organism substance" EXACT [] is_a: CARO:0001008 ! gross anatomical part property_value: IAO:0000112 "Examples include feces, urine, blood, blood plasma, lymph, hemolymph, cerbro-spinal fluid. This class does not encompass anatomical entities with inherent 3D structure such as dentine and arthropod cuticle." xsd:string [Term] id: CARO:0000006 name: material anatomical entity def: "An anatomical entity that has mass." [] subset: core is_a: CARO:0000000 ! anatomical entity intersection_of: CARO:0000000 ! anatomical entity intersection_of: bearer_of PATO:0000125 ! mass disjoint_from: CARO:0000007 ! immaterial anatomical entity relationship: bearer_of PATO:0000125 ! mass [Term] id: CARO:0000007 name: immaterial anatomical entity def: "Anatomical entity that has no mass." [] subset: core is_a: BFO:0000141 ! immaterial entity is_a: CARO:0000000 ! anatomical entity [Term] id: CARO:0000010 name: anatomical boundary def: "A non-material anatomical entity of two dimensions. Anatomical boundaries are contiguous structures." [] comment: Except in the case of abstracted fiat boundaries such as the midline plane of an organism, all 2D anatomical entities have a 3 dimensional projection. For example, the surface of the shell of a muscle has a distinct shape that projects into the third dimension. Note that boundaries are 2D structures. They have no thickness - and so can not be sites of gene expression or gene product localisation. For this, use boundary region terms. is_a: BFO:0000009 is_a: CARO:0000007 ! immaterial anatomical entity [Term] id: CARO:0000012 name: multicellular organism def: "Anatomical structure that is an individual member of a clade and, at some point in its life-cycle, consists of more than one cell." [] comment: MH: Can't define this class based on 2 or more cells because most multi cellular organisms (if not all) have only a single cell at some point in life history. \n\nMH: sexual subtypes should probably be logically defined based on sexual processes or sex qualities. is_a: CARO:0010004 ! cellular organism [Term] id: CARO:0000013 name: cell def: "An anatomical structure that has as its parts a maximally connected cell compartment surrounded by a plasma membrane." [] comment: deprecate and replace with CL or GO term? xref: CL:0000000 xref: GO:0005623 is_a: CARO:0000003 ! connected anatomical structure is_a: CARO:0020003 ! cellular anatomical structure disjoint_from: CARO:0000014 ! cell part disjoint_from: CARO:0000040 ! acellular anatomical structure disjoint_from: CARO:0000042 ! extraembryonic structure disjoint_from: CARO:0001000 ! multi-cell-part structure disjoint_from: CARO:0010000 ! multicellular anatomical structure [Term] id: CARO:0000014 name: cell part def: "Anatomical structure that is part of a cell and that has a granularity level equal to that of a protein complex or higher." [] comment: This is declared equivalent with GO:0044464. The definition should be co-ordinated with GO. We could obsolete the CARO class and just use the GO class. is_a: CARO:0000003 ! connected anatomical structure disjoint_from: CARO:0000040 ! acellular anatomical structure disjoint_from: CARO:0000042 ! extraembryonic structure disjoint_from: CARO:0001000 ! multi-cell-part structure disjoint_from: CARO:0010000 ! multicellular anatomical structure relationship: part_of CARO:0000013 ! cell property_value: IAO:0000118 "cell component" xsd:string [Term] id: CARO:0000032 name: organism subdivision def: "Anatomical structure which is a subdivision of a whole organism, consisting of components of multiple anatomical systems, largely surrounded by a contiguous region of integument." [] subset: core is_a: CARO:0010000 ! multicellular anatomical structure property_value: editor_note "Old definition: Anatomical structure which is a primary subdivision of whole organism. The mereological sum of these is the whole organism." xsd:string [Term] id: CARO:0000040 name: acellular anatomical structure def: "An anatomical structure that has no cells or cell parts as a part." [] comment: Example. Insect cuticle, eggshell, hair. is_a: CARO:0000003 ! connected anatomical structure is_a: CARO:0001008 ! gross anatomical part intersection_of: CARO:0000003 ! connected anatomical structure intersection_of: has_component CARO:0000013 {cardinality="0"} ! cell intersection_of: has_component CARO:0000014 {cardinality="0"} ! cell part disjoint_from: CARO:0000042 ! extraembryonic structure disjoint_from: CARO:0001000 ! multi-cell-part structure disjoint_from: CARO:0010000 ! multicellular anatomical structure [Term] id: CARO:0000042 name: extraembryonic structure def: "A multicellular anatomical structure that is associated with an embryo and derived from the zygote from which it develops, but which does not contribute to the embryo proper or to structures that are part of the same organism after embryogenesis." [] comment: MH: define as not part of embryo, or will not develop into embryo? MH: changed def to exclude cells so this class could be included in gross anatomical part. DOS: Changed to something that I think works for both vertebrates and invertebrates and that keeps the restriction to multicellular structures. Old def: "Anatomical structure that is contiguous with the embryo and is comprised of portions of tissue that will not contribute to the embryo.". One remaining question - perhaps zygote is too restrictive given that some organisms have parthenogenesis e.g. aphids?\n subset: plus is_a: CARO:0000003 ! connected anatomical structure is_a: CARO:0001008 ! gross anatomical part disjoint_from: CARO:0001000 ! multi-cell-part structure disjoint_from: CARO:0010000 ! multicellular anatomical structure [Term] id: CARO:0001000 name: multi-cell-part structure def: "A structure consisting of multiple cell components but which is not itself a cell and does not have (complete) cells as a part." [] comment: Examples: a bundle of neuron projections in the brain; a region neuropil in an arthropod central nervous system; a region of cortex (preikaryal rind) in an arthropod brain. subset: core is_a: CARO:0001008 ! gross anatomical part disjoint_from: CARO:0010000 ! multicellular anatomical structure property_value: IAO:0000118 "multi-cell-component structure" xsd:string [Term] id: CARO:0001001 name: neuron projection bundle def: "A fasciculated bundle of neuron projections (GO:0043005), largely or completely lacking synapses." [] is_a: CARO:0001000 ! multi-cell-part structure relationship: bearer_of PATO:0002309 ! fiber shaped property_value: IAO:0000118 "nerve fiber bundle" xsd:string {http://purl.obolibrary.org/obo/IAO_scope="EXACT"} [Term] id: CARO:0001008 name: gross anatomical part def: "Anatomical structure that is part of a multicellular organism and is at the gross anatomical level, e.g. above the level of a cell. Included are portions of organism substances such as blood, multi-cell-part structures such as axon tracts, acellular anatomical structures such as hair, and organism subdivisions such as head. Excluded is the whole organism and more granular parts of the organism, such as atoms, molecules, macromolecular complexes and cells. " [] subset: plus is_a: CARO:0000006 ! material anatomical entity union_of: CARO:0000004 ! organism substance union_of: CARO:0000032 ! organism subdivision union_of: CARO:0000040 ! acellular anatomical structure union_of: CARO:0000042 ! extraembryonic structure union_of: CARO:0001000 ! multi-cell-part structure union_of: CARO:0010000 ! multicellular anatomical structure relationship: part_of CARO:0000012 ! multicellular organism property_value: http://purl.obolibrary.org/obo/IAO_creation_date "10.7.2011" xsd:string property_value: IAO:0000117 "mah" xsd:string [Term] id: CARO:0001010 name: organism or virus or viroid def: "Material anatomical entity that is a member of an individual species or is a viral or viroid particle." [] is_a: BFO:0000040 ! material entity property_value: http://purl.obolibrary.org/obo/IAO_creation_date "9/18/11" xsd:string property_value: IAO:0000117 "Melissa Haendel" xsd:string [Term] id: CARO:0010000 name: multicellular anatomical structure def: "An anatomical structure that has more than one cell as a part." [] subset: core is_a: CARO:0000003 ! connected anatomical structure is_a: CARO:0001008 ! gross anatomical part intersection_of: CARO:0000003 {comment="There is a cost to burying this in PATO. We lose that we could relax the cardinality assertion to subClassOf has_part some cell. I'm sure having this axiom inherited would come in handy. DOS"} ! connected anatomical structure intersection_of: bearer_of PATO:0001993 {comment="There is a cost to burying this in PATO. We lose that we could relax the cardinality assertion to subClassOf has_part some cell. I'm sure having this axiom inherited would come in handy. DOS"} ! multicellular relationship: bearer_of PATO:0001993 ! multicellular property_value: http://purl.obolibrary.org/obo/IAO_creation_date "Sun Feb 27 10:53:00 GMT 2011" xsd:string property_value: IAO:0000117 "djs93" xsd:string [Term] id: CARO:0010004 name: cellular organism def: "An individual member of a clade of cellular organisms." [] comment: A general term for organism that is agnostic about single cell vs multi-cellular. Note that this is a subclass of 'anatomical structure', meaning that an organism must be a connected structure. For example, if I take one plant and make a rooted cutting from a it, I now have two (clonally related) organisms. is_a: CARO:0000003 ! connected anatomical structure is_a: CARO:0001010 ! organism or virus or viroid property_value: http://purl.obolibrary.org/obo/IAO_creation_date "7.16.2011" xsd:string property_value: IAO:0000117 "mah" xsd:string [Term] id: CARO:0020000 name: disconnected anatomical group def: "Material anatomical entity consisting of multiple anatomical structures that are not connected to each other." [] subset: core is_a: CARO:0000006 ! material anatomical entity intersection_of: CARO:0000006 ! material anatomical entity intersection_of: bearer_of PATO:0010001 ! disconnected intersection_of: has_component CARO:0000003 {minCardinality="2"} ! connected anatomical structure relationship: bearer_of PATO:0010001 ! disconnected relationship: has_component CARO:0000003 ! connected anatomical structure [Term] id: CARO:0020003 name: cellular anatomical structure def: "An anatomical structure consisting of one or more cells." [] is_a: CARO:0000006 ! material anatomical entity property_value: created_by "dos" xsd:string creation_date: 2018-09-28T14:20:19Z [Term] id: CARO:0030000 name: biological entity def: "Entity that is, is part of, or derived from an organism, virus, or viroid or a collection of them." [] comment: Important for alignment with Darwin Core class "Organism". is_a: BFO:0000004 ! independent continuant [Term] id: CHEBI:10545 name: electron namespace: chebi_ontology def: "Elementary particle not affected by the strong force having a spin 1/2, a negative elementary charge and a rest mass of 0.000548579903(13) u, or 0.51099906(15) MeV." [] subset: 3_STAR synonym: "beta" RELATED [IUPAC] synonym: "beta(-)" RELATED [ChEBI] synonym: "beta-particle" RELATED [IUPAC] synonym: "e" RELATED [IUPAC] synonym: "e(-)" RELATED [UniProt] synonym: "e-" RELATED [KEGG_COMPOUND] synonym: "electron" EXACT [KEGG_COMPOUND] synonym: "electron" EXACT IUPAC_NAME [IUPAC] synonym: "electron" EXACT [ChEBI] synonym: "Elektron" RELATED [ChEBI] synonym: "negatron" RELATED [IUPAC] xref: KEGG:C05359 xref: PMID:21614077 {source="Europe PMC"} xref: Wikipedia:Electron is_a: CHEBI:36338 ! lepton property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "0.000548579903" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "0.0" xsd:string [Term] id: CHEBI:131565 name: steroid aldehyde namespace: chebi_ontology def: "Any steroid substituted by a formyl group." [] subset: 3_STAR synonym: "steroid aldehydes" RELATED [ChEBI] is_a: CHEBI:17478 ! aldehyde is_a: CHEBI:35341 ! steroid [Term] id: CHEBI:131604 name: Mycoplasma genitalium metabolite namespace: chebi_ontology def: "Any bacterial metabolite produced during a metabolic reaction in Mycoplasma genitalium." [] subset: 3_STAR synonym: "Mycoplasma genitalium metabolites" RELATED [ChEBI] is_a: CHEBI:76969 ! bacterial metabolite [Term] id: CHEBI:131621 name: C19-steroid namespace: chebi_ontology def: "A steroid compound with a structure based on a 19-carbon (androstane) skeleton." [] subset: 3_STAR synonym: "C19-steroids" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid relationship: has_parent_hydride CHEBI:35509 ! androstane [Term] id: CHEBI:131927 name: dicarboxylic acids and O-substituted derivatives namespace: chebi_ontology def: "A class of carbonyl compound encompassing dicarboxylic acids and any derivatives obtained by substitution of either one or both of the carboxy hydrogens." [] subset: 3_STAR synonym: "dicarboxylic acids and derivatives" RELATED [ChEBI] is_a: CHEBI:36586 ! carbonyl compound [Term] id: CHEBI:132153 name: hyaluronate namespace: chebi_ontology def: "A carbohydrate acid derivative anion obtained by deprotonation of the carboxy groups of hyaluronic acid; major species at pH 7.3." [] subset: 3_STAR synonym: "hyaluronan" RELATED [UniProt] synonym: "hyaluronate polyanion" RELATED [ChEBI] is_a: CHEBI:61469 ! polyanionic polymer is_a: CHEBI:63551 ! carbohydrate acid derivative anion relationship: is_conjugate_base_of CHEBI:16336 ! hyaluronic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H20NO11)n.H2O" xsd:string [Term] id: CHEBI:136849 name: 3-oxo-Delta(4)-steroid group namespace: chebi_ontology def: "An organic group derived from any 3-oxo-Delta(4)-steroid." [] subset: 3_STAR synonym: "a 3-oxo-Delta4-steroid group" RELATED [UniProt] is_a: CHEBI:33247 ! organic group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H6O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "94.111" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "94.04186" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=C(C*)*C(CC1=O)*" xsd:string [Term] id: CHEBI:136889 name: 5beta steroid namespace: chebi_ontology def: "Any steroid that has beta-configuration at position 5." [] subset: 3_STAR synonym: "5beta steroids" RELATED [ChEBI] synonym: "5beta-steroid" RELATED [ChEBI] synonym: "5beta-steroids" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid [Term] id: CHEBI:138103 name: inorganic acid namespace: chebi_ontology def: "A Bronsted acid derived from one or more inorganic compounds. Inorganic acids (also known as mineral acids) form hydrons and conjugate base ions when dissolved in water." [] subset: 3_STAR synonym: "inorganic acids" RELATED [ChEBI] synonym: "mineral acid" RELATED [ChEBI] synonym: "mineral acids" RELATED [ChEBI] xref: Wikipedia:Mineral_acid is_a: CHEBI:39141 ! Bronsted acid [Term] id: CHEBI:138366 name: bile acids namespace: chebi_ontology def: "Any member of a group of hydroxy steroids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration, while in lower vertebrates, some bile acids, known as allo-bile acids, have 5alpha-configuration." [] subset: 3_STAR is_a: CHEBI:25384 ! monocarboxylic acid is_a: CHEBI:35350 ! hydroxy steroid is_a: CHEBI:36078 ! cholanoid [Term] id: CHEBI:13850 name: apoprotein namespace: chebi_ontology def: "An apoprotein is a protein devoid of its characteristic prosthetic group or metal." [] subset: 3_STAR synonym: "apoprotein" EXACT IUPAC_NAME [IUPAC] synonym: "apoproteins" RELATED [ChEBI] xref: KEGG:C16240 is_a: CHEBI:38560 ! simple protein relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite [Term] id: CHEBI:138675 name: gas molecular entity namespace: chebi_ontology def: "Any main group molecular entity that is gaseous at standard temperature and pressure (STP; 0degreeC and 100 kPa)." [] subset: 3_STAR synonym: "gas molecular entities" RELATED [ChEBI] synonym: "gaseous molecular entities" RELATED [ChEBI] synonym: "gaseous molecular entity" RELATED [ChEBI] xref: Wikipedia:https\://en.wikipedia.org/wiki/Gas is_a: CHEBI:33579 ! main group molecular entity [Term] id: CHEBI:13941 name: carbamate namespace: chebi_ontology subset: 3_STAR synonym: "Carbamat" RELATED [ChEBI] synonym: "carbamate" EXACT [UniProt] synonym: "carbamate" EXACT IUPAC_NAME [IUPAC] synonym: "carbamate ion" RELATED [ChemIDplus] synonym: "carbamic acid, ion(1-)" RELATED [ChemIDplus] synonym: "Karbamat" RELATED [ChEBI] xref: Beilstein:3903503 {source="Beilstein"} xref: CAS:302-11-4 {source="ChemIDplus"} xref: Gmelin:239604 {source="Gmelin"} is_a: CHEBI:37022 ! amino-acid anion relationship: is_conjugate_base_of CHEBI:28616 ! carbamic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KXDHJXZQYSOELW-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "60.03212" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.00910" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC([O-])=O" xsd:string [Term] id: CHEBI:139588 name: alpha-hydroxy ketone namespace: chebi_ontology def: "An alpha-oxyketone that has a hydroxy group as the alpha-oxy moiety." [] subset: 3_STAR synonym: "alpha-hydroxy ketones" RELATED [ChEBI] synonym: "alpha-hydroxy-ketone" RELATED [ChEBI] synonym: "alpha-hydroxy-ketones" RELATED [ChEBI] synonym: "alpha-hydroxyketone" RELATED [ChEBI] synonym: "alpha-hydroxyketones" RELATED [ChEBI] xref: PMID:15326516 {source="Europe PMC"} xref: PMID:19908854 {source="Europe PMC"} xref: PMID:20382022 {source="Europe PMC"} xref: PMID:23295224 {source="Europe PMC"} is_a: CHEBI:30879 ! alcohol is_a: CHEBI:52396 ! alpha-oxyketone [Term] id: CHEBI:139590 name: primary alpha-hydroxy ketone namespace: chebi_ontology def: "An alpha-hydroxy ketone in which the carbonyl group and the hydroxy group are linked by a -CH2 (methylene) group." [] subset: 3_STAR synonym: "primary alpha-hydroxy ketones" RELATED [ChEBI] synonym: "primary alpha-hydroxy-ketone" RELATED [ChEBI] synonym: "primary alpha-hydroxy-ketones" RELATED [ChEBI] synonym: "primary alpha-hydroxyketone" RELATED [ChEBI] synonym: "primary alpha-hydroxyketones" RELATED [ChEBI] is_a: CHEBI:139588 ! alpha-hydroxy ketone is_a: CHEBI:15734 ! primary alcohol property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "59.044" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01330" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(C(O)([H])[H])=O" xsd:string [Term] id: CHEBI:140601 name: fatty acid 4:0 namespace: chebi_ontology def: "Any saturated fatty acid containing 4 carbons." [] subset: 3_STAR is_a: CHEBI:26666 ! short-chain fatty acid relationship: is_conjugate_acid_of CHEBI:78115 ! fatty acid anion 4:0 property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.017" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(O)=O" xsd:string [Term] id: CHEBI:142163 name: 24G7 epitope namespace: chebi_ontology def: "An antigenic epitope recognized by an anti-bilirubin monoclonal antibody designated 24G7. A substructure of bilirubin IXalpha, it is the region containing the oxo group at C-1, the methyl group at C-2, C-(4, 5, 6, 9), and N-21 and -22." [] subset: 3_STAR is_a: CHEBI:24433 ! group relationship: RO:0000087 CHEBI:53000 ! has role epitope property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C7H6N2O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "134.136" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "134.04801" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(=CC(NC(=*)*)=*)(NC(C(C)=*)=O)*" xsd:string [Term] id: CHEBI:14321 name: glutamate(1-) namespace: chebi_ontology def: "An alpha-amino-acid anion that is the conjugate base of glutamic acid, having anionic carboxy groups and a cationic amino group" [] subset: 3_STAR synonym: "2-ammoniopentanedioate" RELATED [IUPAC] synonym: "glutamate" RELATED [UniProt] synonym: "glutamate(1-)" EXACT [JCBN] synonym: "glutamic acid monoanion" RELATED [JCBN] synonym: "hydrogen glutamate" EXACT IUPAC_NAME [IUPAC] xref: Gmelin:327908 {source="Gmelin"} is_a: CHEBI:33558 ! alpha-amino-acid anion relationship: is_conjugate_acid_of CHEBI:29987 ! glutamate(2-) relationship: is_conjugate_base_of CHEBI:18237 ! glutamic acid relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H8NO4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "146.12136" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "146.04588" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]C(CCC([O-])=O)C([O-])=O" xsd:string [Term] id: CHEBI:15339 name: acceptor namespace: chebi_ontology alt_id: CHEBI:13699 alt_id: CHEBI:2377 def: "A molecular entity that can accept an electron, a pair of electrons, an atom or a group from another molecular entity." [] subset: 3_STAR synonym: "A" RELATED [KEGG_COMPOUND] synonym: "accepteur" RELATED [ChEBI] synonym: "Acceptor" EXACT [KEGG_COMPOUND] synonym: "Akzeptor" RELATED [ChEBI] synonym: "Hydrogen-acceptor" RELATED [KEGG_COMPOUND] synonym: "Oxidized donor" RELATED [KEGG_COMPOUND] xref: KEGG:C00028 xref: KEGG:C16722 is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:15355 name: acetylcholine namespace: chebi_ontology alt_id: CHEBI:12686 alt_id: CHEBI:13715 alt_id: CHEBI:22197 alt_id: CHEBI:2416 alt_id: CHEBI:40559 def: "Actylcholine is an ester of acetic acid and choline, which acts as a neurotransmitter." [ANON:ANON] subset: 3_STAR synonym: "2-acetyloxy-N,N,N-trimethylethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "2-acetyloxy-N,N,N-trimethylethanaminium" EXACT IUPAC_NAME [IUPAC:] synonym: "ACETYLCHOLINE" EXACT [PDBeChem:] synonym: "ACETYLCHOLINE" EXACT [PDBeChem] synonym: "Acetylcholine" EXACT [KEGG_COMPOUND] synonym: "Acetylcholine" EXACT [KEGG COMPOUND:] synonym: "acetylcholine" EXACT [UniProt] synonym: "ACh" RELATED [ChemIDplus] synonym: "ACh" RELATED [ChemIDplus:] synonym: "Azetylcholin" RELATED [ChEBI] synonym: "Azetylcholin" RELATED [ChEBI:] synonym: "C7H16NO2" RELATED FORMULA [KEGG COMPOUND:] synonym: "CC(=O)OCC[N+](C)(C)C" RELATED SMILES [ChEBI:] synonym: "choline acetate" RELATED [ChemIDplus] synonym: "choline acetate" RELATED [ChemIDplus:] synonym: "InChI=1S/C7H16NO2/c1-7(9)10-6-5-8(2,3)4/h5-6H2,1-4H3/q+1" RELATED InChI [ChEBI:] synonym: "InChIKey=OIPILFWXSMYKGL-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "O-Acetylcholine" RELATED [KEGG COMPOUND:] synonym: "O-Acetylcholine" RELATED [KEGG_COMPOUND] xref: Beilstein:1764436 {source="ChemIDplus"} xref: CAS:51-84-3 {source="ChemIDplus"} xref: CAS:51-84-3 {source="KEGG COMPOUND"} xref: Drug_Central:65 {source="DrugCentral"} xref: DrugBank:DB03128 xref: Gmelin:326108 {source="Gmelin"} xref: KEGG:C01996 xref: LINCS:LSM-5888 xref: PDBeChem:ACH xref: PMID:14764638 {source="Europe PMC"} xref: PMID:15014918 {source="Europe PMC"} xref: PMID:15231705 {source="Europe PMC"} xref: PMID:15361288 {source="Europe PMC"} xref: PMID:18050502 {source="Europe PMC"} xref: PMID:18407448 {source="Europe PMC"} xref: PMID:19255787 {source="Europe PMC"} xref: PMID:20963497 {source="Europe PMC"} xref: PMID:21130809 {source="Europe PMC"} xref: PMID:21246223 {source="Europe PMC"} xref: PMID:21545631 {source="Europe PMC"} xref: PMID:21601579 {source="Europe PMC"} xref: Wikipedia:Acetylcholine is_a: CHEBI:35287 ! acylcholine is_a: CHEBI:47622 ! acetate ester relationship: RO:0000087 CHEBI:24621 ! has role hormone relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent relationship: RO:0000087 CHEBI:38325 ! has role muscarinic agonist relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C7H16NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C7H16NO2/c1-7(9)10-6-5-8(2,3)4/h5-6H2,1-4H3/q+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OIPILFWXSMYKGL-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "146.20748" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "146.11756" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(=O)OCC[N+](C)(C)C" xsd:string [Term] id: CHEBI:15366 name: acetic acid namespace: chebi_ontology alt_id: CHEBI:22169 alt_id: CHEBI:2387 alt_id: CHEBI:40486 def: "A simple monocarboxylic acid containing two carbons." [] subset: 3_STAR synonym: "ACETIC ACID" EXACT [PDBeChem] synonym: "Acetic acid" EXACT [KEGG_COMPOUND] synonym: "acetic acid" EXACT IUPAC_NAME [IUPAC] synonym: "acide acetique" RELATED [ChemIDplus] synonym: "AcOH" RELATED [ChEBI] synonym: "CH3-COOH" RELATED [IUPAC] synonym: "CH3CO2H" RELATED [ChEBI] synonym: "E 260" RELATED [ChEBI] synonym: "E-260" RELATED [ChEBI] synonym: "E260" RELATED [ChEBI] synonym: "Essigsaeure" RELATED [ChEBI] synonym: "Ethanoic acid" RELATED [KEGG_COMPOUND] synonym: "ethoic acid" RELATED [ChEBI] synonym: "Ethylic acid" RELATED [ChemIDplus] synonym: "HOAc" RELATED [ChEBI] synonym: "INS No. 260" RELATED [ChEBI] synonym: "MeCO2H" RELATED [ChEBI] synonym: "MeCOOH" RELATED [ChEBI] synonym: "Methanecarboxylic acid" RELATED [ChemIDplus] xref: Beilstein:506007 {source="Beilstein"} xref: CAS:64-19-7 {source="ChemIDplus"} xref: CAS:64-19-7 {source="NIST Chemistry WebBook"} xref: CAS:64-19-7 {source="KEGG COMPOUND"} xref: Drug_Central:4211 {source="DrugCentral"} xref: Gmelin:1380 {source="Gmelin"} xref: HMDB:HMDB0000042 xref: KEGG:C00033 xref: KEGG:D00010 xref: KNApSAcK:C00001176 xref: LIPID_MAPS_instance:LMFA01010002 {source="LIPID MAPS"} xref: MetaCyc:ACET xref: PDBeChem:ACT xref: PDBeChem:ACY xref: PMID:12005138 {source="Europe PMC"} xref: PMID:15107950 {source="Europe PMC"} xref: PMID:16630552 {source="Europe PMC"} xref: PMID:16774200 {source="Europe PMC"} xref: PMID:17190852 {source="Europe PMC"} xref: PMID:19416101 {source="Europe PMC"} xref: PMID:19469536 {source="Europe PMC"} xref: PMID:22153255 {source="Europe PMC"} xref: PMID:22173419 {source="Europe PMC"} xref: PPDB:1333 xref: Reaxys:506007 {source="Reaxys"} xref: Wikipedia:Acetic_acid is_a: CHEBI:25384 ! monocarboxylic acid relationship: is_conjugate_acid_of CHEBI:30089 ! acetate relationship: RO:0000087 CHEBI:48356 ! has role protic solvent relationship: RO:0000087 CHEBI:64049 ! has role food acidity regulator relationship: RO:0000087 CHEBI:65256 ! has role antimicrobial food preservative relationship: RO:0000087 CHEBI:83056 ! has role Daphnia magna metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H4O2/c1-2(3)4/h1H3,(H,3,4)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QTBSBXVTEAMEQO-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "60.05200" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.02113" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(O)=O" xsd:string [Term] id: CHEBI:15377 name: water namespace: chebi_ontology alt_id: CHEBI:10743 alt_id: CHEBI:13352 alt_id: CHEBI:27313 alt_id: CHEBI:42043 alt_id: CHEBI:42857 alt_id: CHEBI:43228 alt_id: CHEBI:44292 alt_id: CHEBI:44701 alt_id: CHEBI:44819 alt_id: CHEBI:5585 def: "An oxygen hydride consisting of an oxygen atom that is covalently bonded to two hydrogen atoms" [] subset: 3_STAR synonym: "[OH2]" RELATED [IUPAC] synonym: "acqua" RELATED [ChEBI] synonym: "agua" RELATED [ChEBI] synonym: "aqua" RELATED [ChEBI] synonym: "BOUND WATER" RELATED [PDBeChem] synonym: "dihydridooxygen" RELATED [IUPAC] synonym: "dihydrogen oxide" RELATED [IUPAC] synonym: "eau" RELATED [ChEBI] synonym: "H2O" RELATED [KEGG_COMPOUND] synonym: "H2O" RELATED [UniProt] synonym: "HOH" RELATED [ChEBI] synonym: "hydrogen hydroxide" RELATED [ChEBI] synonym: "oxidane" EXACT IUPAC_NAME [IUPAC] synonym: "Wasser" RELATED [ChEBI] synonym: "WATER" EXACT [PDBeChem] synonym: "Water" EXACT [KEGG_COMPOUND] synonym: "water" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:3587155 {source="Beilstein"} xref: CAS:7732-18-5 {source="NIST Chemistry WebBook"} xref: CAS:7732-18-5 {source="ChemIDplus"} xref: CAS:7732-18-5 {source="KEGG COMPOUND"} xref: Gmelin:117 {source="Gmelin"} xref: HMDB:HMDB0002111 xref: KEGG:C00001 xref: KEGG:D00001 xref: MetaCyc:WATER xref: MolBase:1 xref: PDBeChem:HOH xref: Reaxys:3587155 {source="Reaxys"} xref: Wikipedia:Water is_a: CHEBI:33693 ! oxygen hydride is_a: CHEBI:37176 ! mononuclear parent hydride is_a: CHEBI:52625 ! inorganic hydroxy compound relationship: is_conjugate_acid_of CHEBI:16234 ! hydroxide relationship: is_conjugate_base_of CHEBI:29412 ! oxonium relationship: RO:0000087 CHEBI:48360 ! has role amphiprotic solvent relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:76413 ! has role greenhouse gas relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "18.01530" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "18.01056" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]O[H]" xsd:string [Term] id: CHEBI:15379 name: dioxygen namespace: chebi_ontology alt_id: CHEBI:10745 alt_id: CHEBI:13416 alt_id: CHEBI:23833 alt_id: CHEBI:25366 alt_id: CHEBI:30491 alt_id: CHEBI:44742 alt_id: CHEBI:7860 subset: 3_STAR synonym: "[OO]" RELATED [MolBase] synonym: "dioxygen" EXACT IUPAC_NAME [IUPAC] synonym: "dioxygene" RELATED [ChEBI] synonym: "Disauerstoff" RELATED [ChEBI] synonym: "E 948" RELATED [ChEBI] synonym: "E-948" RELATED [ChEBI] synonym: "E948" RELATED [ChEBI] synonym: "molecular oxygen" RELATED [ChEBI] synonym: "O2" RELATED [UniProt] synonym: "O2" RELATED [IUPAC] synonym: "O2" RELATED [KEGG_COMPOUND] synonym: "Oxygen" RELATED [KEGG_COMPOUND] synonym: "OXYGEN MOLECULE" RELATED [PDBeChem] xref: CAS:7782-44-7 {source="NIST Chemistry WebBook"} xref: CAS:7782-44-7 {source="ChemIDplus"} xref: CAS:7782-44-7 {source="KEGG COMPOUND"} xref: Gmelin:485 {source="Gmelin"} xref: HMDB:HMDB0001377 xref: KEGG:C00007 xref: KEGG:D00003 xref: MetaCyc:OXYGEN-MOLECULE xref: MolBase:750 xref: PDBeChem:OXY xref: PMID:10906528 {source="Europe PMC"} xref: PMID:16977326 {source="Europe PMC"} xref: PMID:18210929 {source="Europe PMC"} xref: PMID:18638417 {source="Europe PMC"} xref: PMID:19840863 {source="Europe PMC"} xref: PMID:7710549 {source="Europe PMC"} xref: PMID:9463773 {source="Europe PMC"} xref: Wikipedia:Oxygen is_a: CHEBI:138675 ! gas molecular entity is_a: CHEBI:25362 ! elemental molecule is_a: CHEBI:33263 ! diatomic oxygen relationship: is_conjugate_base_of CHEBI:29793 ! hydridodioxygen(1+) relationship: RO:0000087 CHEBI:27027 ! has role micronutrient relationship: RO:0000087 CHEBI:33893 ! has role reagent relationship: RO:0000087 CHEBI:35472 ! has role anti-inflammatory drug relationship: RO:0000087 CHEBI:63248 ! has role oxidising agent relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite relationship: RO:0000087 CHEBI:77974 ! has role food packaging gas property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O2/c1-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MYMOFIZGZYHOMD-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "31.998" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=O" xsd:string [Term] id: CHEBI:15428 name: glycine namespace: chebi_ontology alt_id: CHEBI:10792 alt_id: CHEBI:14344 alt_id: CHEBI:24368 alt_id: CHEBI:42964 alt_id: CHEBI:5460 def: "The simplest (and the only achiral) proteinogenic amino acid, with a hydrogen atom as its side chain." [] subset: 3_STAR synonym: "Aminoacetic acid" RELATED [KEGG_COMPOUND] synonym: "aminoacetic acid" EXACT IUPAC_NAME [IUPAC] synonym: "Aminoessigsaeure" RELATED [ChEBI] synonym: "aminoethanoic acid" RELATED [ChEBI] synonym: "aminoethanoic acid" RELATED [JCBN] synonym: "G" RELATED [ChEBI] synonym: "Gly" RELATED [KEGG_COMPOUND] synonym: "Glycin" RELATED [ChemIDplus] synonym: "GLYCINE" EXACT [PDBeChem] synonym: "Glycine" EXACT [KEGG_COMPOUND] synonym: "glycine" EXACT IUPAC_NAME [IUPAC] synonym: "Glycocoll" RELATED [ChemIDplus] synonym: "Glykokoll" RELATED [ChEBI] synonym: "Glyzin" RELATED [ChEBI] synonym: "H2N-CH2-COOH" RELATED [IUPAC] synonym: "Hgly" RELATED [IUPAC] synonym: "Leimzucker" RELATED [ChemIDplus] xref: Beilstein:635782 {source="Beilstein"} xref: CAS:56-40-6 {source="NIST Chemistry WebBook"} xref: CAS:56-40-6 {source="ChemIDplus"} xref: CAS:56-40-6 {source="KEGG COMPOUND"} xref: Drug_Central:1319 {source="DrugCentral"} xref: DrugBank:DB00145 xref: ECMDB:ECMDB00123 xref: Gmelin:1808 {source="Gmelin"} xref: HMDB:HMDB0000123 xref: KEGG:C00037 xref: KEGG:D00011 xref: KNApSAcK:C00001361 xref: MetaCyc:GLY xref: PDBeChem:GLY xref: PMID:10930630 {source="Europe PMC"} xref: PMID:11019925 {source="Europe PMC"} xref: PMID:11174716 {source="Europe PMC"} xref: PMID:11542461 {source="Europe PMC"} xref: PMID:11806864 {source="Europe PMC"} xref: PMID:12631515 {source="Europe PMC"} xref: PMID:12754315 {source="Europe PMC"} xref: PMID:12770151 {source="Europe PMC"} xref: PMID:12921899 {source="Europe PMC"} xref: PMID:15331688 {source="Europe PMC"} xref: PMID:15388434 {source="Europe PMC"} xref: PMID:15710237 {source="Europe PMC"} xref: PMID:16105183 {source="Europe PMC"} xref: PMID:16151895 {source="Europe PMC"} xref: PMID:16214212 {source="Europe PMC"} xref: PMID:16417482 {source="Europe PMC"} xref: PMID:16444815 {source="Europe PMC"} xref: PMID:16664855 {source="Europe PMC"} xref: PMID:16901953 {source="Europe PMC"} xref: PMID:16918424 {source="Europe PMC"} xref: PMID:16986325 {source="Europe PMC"} xref: PMID:16998855 {source="Europe PMC"} xref: PMID:17154252 {source="Europe PMC"} xref: PMID:17383967 {source="Europe PMC"} xref: PMID:17582620 {source="Europe PMC"} xref: PMID:17970719 {source="Europe PMC"} xref: PMID:18079355 {source="Europe PMC"} xref: PMID:18396796 {source="Europe PMC"} xref: PMID:18440992 {source="Europe PMC"} xref: PMID:18593588 {source="Europe PMC"} xref: PMID:18816054 {source="Europe PMC"} xref: PMID:18840508 {source="Europe PMC"} xref: PMID:19028609 {source="Europe PMC"} xref: PMID:19120667 {source="Europe PMC"} xref: PMID:19449910 {source="Europe PMC"} xref: PMID:19526731 {source="Europe PMC"} xref: PMID:19544666 {source="Europe PMC"} xref: PMID:19738917 {source="Europe PMC"} xref: PMID:19916621 {source="Europe PMC"} xref: PMID:19924257 {source="Europe PMC"} xref: PMID:21751272 {source="Europe PMC"} xref: PMID:22044190 {source="Europe PMC"} xref: PMID:22079563 {source="Europe PMC"} xref: PMID:22234938 {source="Europe PMC"} xref: PMID:22264337 {source="Europe PMC"} xref: PMID:22293292 {source="Europe PMC"} xref: PMID:22401276 {source="Europe PMC"} xref: PMID:22434786 {source="Europe PMC"} xref: Reaxys:635782 {source="Reaxys"} xref: Wikipedia:Glycine xref: YMDB:YMDB00016 is_a: CHEBI:26650 ! serine family amino acid relationship: is_conjugate_acid_of CHEBI:32508 ! glycinate relationship: is_conjugate_base_of CHEBI:32507 ! glycinium relationship: is_tautomer_of CHEBI:57305 ! glycine zwitterion relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:27027 ! has role micronutrient relationship: RO:0000087 CHEBI:50733 ! has role nutraceutical relationship: RO:0000087 CHEBI:62868 ! has role hepatoprotective agent relationship: RO:0000087 CHEBI:64570 ! has role EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitor relationship: RO:0000087 CHEBI:64571 ! has role NMDA receptor agonist relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H5NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "75.06664" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "75.03203" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC(O)=O" xsd:string [Term] id: CHEBI:15440 name: squalene namespace: chebi_ontology alt_id: CHEBI:10795 alt_id: CHEBI:10843 alt_id: CHEBI:15104 alt_id: CHEBI:26746 alt_id: CHEBI:9245 def: "A triterpene consisting of 2,6,10,15,19,23-hexamethyltetracosane having six double bonds at the 2-, 6-, 10-, 14-, 18- and 22-positions with (all-E)-configuration." [] subset: 3_STAR synonym: "(6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene" EXACT IUPAC_NAME [IUPAC] synonym: "(all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene" RELATED [NIST_Chemistry_WebBook] synonym: "Spinacene" RELATED [KEGG_COMPOUND] synonym: "Squalene" EXACT [KEGG_COMPOUND] synonym: "squalene" EXACT [UniProt] synonym: "Supraene" RELATED [KEGG_COMPOUND] xref: Beilstein:1728920 {source="Beilstein"} xref: CAS:111-02-4 {source="KEGG COMPOUND"} xref: CAS:111-02-4 {source="ChemIDplus"} xref: CAS:111-02-4 {source="NIST Chemistry WebBook"} xref: HMDB:HMDB0000256 xref: KEGG:C00751 xref: KNApSAcK:C00003755 xref: LIPID_MAPS_instance:LMPR0106010002 {source="LIPID MAPS"} xref: MetaCyc:SQUALENE xref: PDBeChem:SQL xref: PMID:16341241 {source="Europe PMC"} xref: PMID:23625688 {source="Europe PMC"} xref: PMID:24362891 {source="Europe PMC"} xref: PMID:25286851 {source="Europe PMC"} xref: PMID:25286853 {source="Europe PMC"} xref: PMID:25987292 {source="Europe PMC"} xref: Wikipedia:Squalene is_a: CHEBI:35191 ! triterpene relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C30H50" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C30H50/c1-25(2)15-11-19-29(7)23-13-21-27(5)17-9-10-18-28(6)22-14-24-30(8)20-12-16-26(3)4/h15-18,23-24H,9-14,19-22H2,1-8H3/b27-17+,28-18+,29-23+,30-24+" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YYGNTYWPHWGJRM-AAJYLUCBSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "410.730" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "410.39125" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(C)=CCC\\C(C)=C\\CC\\C(C)=C\\CC\\C=C(/C)CC\\C=C(/C)CCC=C(C)C" xsd:string [Term] id: CHEBI:15693 name: aldose namespace: chebi_ontology alt_id: CHEBI:13755 alt_id: CHEBI:22305 alt_id: CHEBI:2561 def: "Aldehydic parent sugars (polyhydroxy aldehydes H[CH(OH)]nC(=O)H, n >= 2) and their intramolecular hemiacetals." [] subset: 3_STAR synonym: "Aldose" EXACT [KEGG_COMPOUND] synonym: "aldoses" RELATED [ChEBI] synonym: "an aldose" RELATED [UniProt] xref: KEGG:C01370 xref: Wikipedia:Aldose is_a: CHEBI:35381 ! monosaccharide property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4O2(CH2O)n" xsd:string [Term] id: CHEBI:15705 name: L-alpha-amino acid namespace: chebi_ontology alt_id: CHEBI:13072 alt_id: CHEBI:13243 alt_id: CHEBI:13797 alt_id: CHEBI:21224 alt_id: CHEBI:6175 def: "Any alpha-amino acid having L-configuration at the alpha-carbon." [] subset: 3_STAR synonym: "L-2-Amino acid" RELATED [KEGG_COMPOUND] synonym: "L-alpha-amino acid" EXACT [IUPAC] synonym: "L-alpha-amino acids" EXACT IUPAC_NAME [IUPAC] synonym: "L-alpha-amino acids" RELATED [ChEBI] synonym: "L-Amino acid" RELATED [KEGG_COMPOUND] xref: KEGG:C00151 is_a: CHEBI:33704 ! alpha-amino acid relationship: is_conjugate_acid_of CHEBI:59814 ! L-alpha-amino acid anion relationship: is_tautomer_of CHEBI:59869 ! L-alpha-amino acid zwitterion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "N[C@@H]([*])C(O)=O" xsd:string [Term] id: CHEBI:15734 name: primary alcohol namespace: chebi_ontology alt_id: CHEBI:13676 alt_id: CHEBI:14887 alt_id: CHEBI:26262 alt_id: CHEBI:57489 alt_id: CHEBI:8406 def: "A primary alcohol is a compound in which a hydroxy group, -OH, is attached to a saturated carbon atom which has either three hydrogen atoms attached to it or only one other carbon atom and two hydrogen atoms attached to it." [] subset: 3_STAR synonym: "1-Alcohol" RELATED [KEGG_COMPOUND] synonym: "a primary alcohol" RELATED [UniProt] synonym: "Primary alcohol" EXACT [KEGG_COMPOUND] synonym: "primary alcohols" RELATED [ChEBI] xref: KEGG:C00226 is_a: CHEBI:30879 ! alcohol property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "31.034" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.01839" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(O)([H])[H]" xsd:string [Term] id: CHEBI:15740 name: formate namespace: chebi_ontology alt_id: CHEBI:14276 alt_id: CHEBI:24081 def: "A monocarboxylic acid anion that is the conjugate base of formic acid. Induces severe metabolic acidosis and ocular injury in human subjects." [] subset: 3_STAR synonym: "aminate" RELATED [ChEBI] synonym: "formate" EXACT IUPAC_NAME [IUPAC] synonym: "formate" EXACT [UniProt] synonym: "formiate" RELATED [ChEBI] synonym: "formic acid, ion(1-)" RELATED [ChemIDplus] synonym: "formylate" RELATED [ChEBI] synonym: "HCO2 anion" RELATED [NIST_Chemistry_WebBook] synonym: "hydrogen carboxylate" RELATED [ChEBI] synonym: "methanoate" RELATED [ChEBI] xref: Beilstein:1901205 {source="Beilstein"} xref: CAS:71-47-6 {source="ChemIDplus"} xref: CAS:71-47-6 {source="NIST Chemistry WebBook"} xref: Gmelin:1006 {source="Gmelin"} xref: HMDB:HMDB0000142 xref: KEGG:C00058 xref: MetaCyc:FORMATE xref: PMID:17190852 {source="Europe PMC"} xref: PMID:3946945 {source="Europe PMC"} xref: Reaxys:1901205 {source="Reaxys"} xref: UM-BBD_compID:c0106 {source="UM-BBD"} xref: Wikipedia:Formate is_a: CHEBI:35757 ! monocarboxylic acid anion relationship: is_conjugate_base_of CHEBI:30751 ! formic acid relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O2/c2-1-3/h1H,(H,2,3)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BDAGIHXWWSANSR-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01744" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99820" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C([O-])=O" xsd:string [Term] id: CHEBI:15841 name: polypeptide namespace: chebi_ontology alt_id: CHEBI:14860 alt_id: CHEBI:8314 def: "A peptide containing ten or more amino acid residues." [] subset: 3_STAR synonym: "polipeptido" RELATED [ChEBI] synonym: "Polypeptid" RELATED [ChEBI] synonym: "Polypeptide" EXACT [KEGG_COMPOUND] synonym: "polypeptides" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C00403 is_a: CHEBI:16670 ! peptide is_a: CHEBI:33839 ! macromolecule property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H6N2O3R2(C2H2NOR)n" xsd:string [Term] id: CHEBI:15986 name: polynucleotide namespace: chebi_ontology alt_id: CHEBI:13672 alt_id: CHEBI:14859 alt_id: CHEBI:8312 def: "A nucleobase-containing molecular entity with a polymeric structure comprised of a linear sequence of 13 or more nucleotide residues." [] subset: 3_STAR synonym: "Polynucleotide" EXACT [KEGG_COMPOUND] synonym: "polynucleotides" RELATED [ChEBI] xref: KEGG:C00419 is_a: CHEBI:33695 ! information biomacromolecule is_a: CHEBI:61120 ! nucleobase-containing molecular entity relationship: has_part CHEBI:50319 ! nucleotide residue property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "(C5H8O6PR)n.C10H17O10PR2" xsd:string [Term] id: CHEBI:16134 name: ammonia namespace: chebi_ontology alt_id: CHEBI:13405 alt_id: CHEBI:13406 alt_id: CHEBI:13407 alt_id: CHEBI:13771 alt_id: CHEBI:22533 alt_id: CHEBI:44269 alt_id: CHEBI:44284 alt_id: CHEBI:44404 alt_id: CHEBI:7434 def: "An azane that consists of a single nitrogen atom covelently bonded to three hydrogen atoms." [] subset: 3_STAR synonym: "[NH3]" RELATED [MolBase] synonym: "AMMONIA" EXACT [PDBeChem] synonym: "Ammonia" EXACT [KEGG_COMPOUND] synonym: "ammonia" EXACT IUPAC_NAME [IUPAC] synonym: "ammoniac" RELATED [ChEBI] synonym: "Ammoniak" RELATED [ChemIDplus] synonym: "amoniaco" RELATED [ChEBI] synonym: "azane" EXACT IUPAC_NAME [IUPAC] synonym: "NH3" RELATED [KEGG_COMPOUND] synonym: "NH3" RELATED [UniProt] synonym: "NH3" RELATED [IUPAC] synonym: "R-717" RELATED [ChEBI] synonym: "spirit of hartshorn" RELATED [ChemIDplus] xref: Beilstein:3587154 {source="Beilstein"} xref: CAS:7664-41-7 {source="ChemIDplus"} xref: CAS:7664-41-7 {source="NIST Chemistry WebBook"} xref: CAS:7664-41-7 {source="KEGG COMPOUND"} xref: Drug_Central:4625 {source="DrugCentral"} xref: Gmelin:79 {source="Gmelin"} xref: HMDB:HMDB0000051 xref: KEGG:C00014 xref: KEGG:D02916 xref: KNApSAcK:C00007267 xref: MetaCyc:AMMONIA xref: MolBase:930 xref: PDBeChem:NH3 xref: PMID:110589 {source="Europe PMC"} xref: PMID:11139349 {source="Europe PMC"} xref: PMID:11540049 {source="Europe PMC"} xref: PMID:11746427 {source="Europe PMC"} xref: PMID:11783653 {source="Europe PMC"} xref: PMID:13753780 {source="Europe PMC"} xref: PMID:14663195 {source="Europe PMC"} xref: PMID:15092448 {source="Europe PMC"} xref: PMID:15094021 {source="Europe PMC"} xref: PMID:15554424 {source="Europe PMC"} xref: PMID:15969015 {source="Europe PMC"} xref: PMID:16008360 {source="Europe PMC"} xref: PMID:16050680 {source="Europe PMC"} xref: PMID:16348008 {source="Europe PMC"} xref: PMID:16349403 {source="Europe PMC"} xref: PMID:16614889 {source="Europe PMC"} xref: PMID:16664306 {source="Europe PMC"} xref: PMID:16842901 {source="Europe PMC"} xref: PMID:17025297 {source="Europe PMC"} xref: PMID:17439666 {source="Europe PMC"} xref: PMID:17569513 {source="Europe PMC"} xref: PMID:17737668 {source="Europe PMC"} xref: PMID:18670398 {source="Europe PMC"} xref: PMID:22002069 {source="Europe PMC"} xref: PMID:22081570 {source="Europe PMC"} xref: PMID:22088435 {source="Europe PMC"} xref: PMID:22100291 {source="Europe PMC"} xref: PMID:22130175 {source="Europe PMC"} xref: PMID:22150211 {source="Europe PMC"} xref: PMID:22240068 {source="Europe PMC"} xref: PMID:22290316 {source="Europe PMC"} xref: PMID:22342082 {source="Europe PMC"} xref: PMID:22385337 {source="Europe PMC"} xref: PMID:22443779 {source="Europe PMC"} xref: PMID:22560242 {source="Europe PMC"} xref: Reaxys:3587154 {source="Reaxys"} xref: Wikipedia:Ammonia is_a: CHEBI:138675 ! gas molecular entity is_a: CHEBI:35107 ! azane is_a: CHEBI:37176 ! mononuclear parent hydride relationship: is_conjugate_acid_of CHEBI:29337 ! azanide relationship: is_conjugate_base_of CHEBI:28938 ! ammonium relationship: RO:0000087 CHEBI:50910 ! has role neurotoxin relationship: RO:0000087 CHEBI:59740 ! has role nucleophilic reagent relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77941 ! has role EC 3.5.1.4 (amidase) inhibitor relationship: RO:0000087 CHEBI:78433 ! has role refrigerant property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H3N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3N/h1H3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QGZKDVFQNNGYKY-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "17.03056" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.02655" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]N([H])[H]" xsd:string [Term] id: CHEBI:16137 name: chondroitin D-glucuronate namespace: chebi_ontology alt_id: CHEBI:13989 alt_id: CHEBI:13992 alt_id: CHEBI:23221 alt_id: CHEBI:3673 def: "A mucopolysaccharide composed of repeating beta-D-glucopyranuronosyl-(1->3)-beta-D-N-acetylgalactosaminyl units." [] subset: 3_STAR synonym: "Chondroitin" RELATED [KEGG_COMPOUND] synonym: "Chondroitin-D-glucuronate" RELATED [KEGG_COMPOUND] xref: KEGG:C00401 xref: KEGG:G11334 is_a: CHEBI:37395 ! mucopolysaccharide relationship: is_conjugate_acid_of CHEBI:57652 ! chondroitin D-glucuronate anion relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H21NO11)nH2O" xsd:string [Term] id: CHEBI:16189 name: sulfate namespace: chebi_ontology alt_id: CHEBI:15135 alt_id: CHEBI:45687 alt_id: CHEBI:9335 def: "A sulfur oxoanion obtained by deprotonation of both OH groups of sulfuric acid." [] subset: 3_STAR synonym: "[SO4](2-)" RELATED [IUPAC] synonym: "SO4(2-)" RELATED [IUPAC] synonym: "Sulfate" EXACT [KEGG_COMPOUND] synonym: "sulfate" EXACT [UniProt] synonym: "sulfate" EXACT IUPAC_NAME [IUPAC] synonym: "Sulfate anion(2-)" RELATED [HMDB] synonym: "Sulfate dianion" RELATED [HMDB] synonym: "SULFATE ION" RELATED [PDBeChem] synonym: "Sulfate(2-)" RELATED [HMDB] synonym: "Sulfuric acid ion(2-)" RELATED [HMDB] synonym: "sulphate" RELATED [ChEBI] synonym: "sulphate ion" RELATED [ChEBI] synonym: "tetraoxidosulfate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "tetraoxosulfate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "tetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:3648446 {source="Beilstein"} xref: CAS:14808-79-8 {source="ChemIDplus"} xref: CAS:14808-79-8 {source="NIST Chemistry WebBook"} xref: Gmelin:2120 {source="Gmelin"} xref: HMDB:HMDB0001448 xref: KEGG:C00059 xref: KEGG:D05963 xref: MetaCyc:SULFATE xref: PDBeChem:SO4 xref: PMID:11200094 {source="Europe PMC"} xref: PMID:11452993 {source="Europe PMC"} xref: PMID:11581495 {source="Europe PMC"} xref: PMID:11798107 {source="Europe PMC"} xref: PMID:12166931 {source="Europe PMC"} xref: PMID:12668033 {source="Europe PMC"} xref: PMID:14597181 {source="Europe PMC"} xref: PMID:15093386 {source="Europe PMC"} xref: PMID:15984785 {source="Europe PMC"} xref: PMID:16186560 {source="Europe PMC"} xref: PMID:16345535 {source="Europe PMC"} xref: PMID:16347366 {source="Europe PMC"} xref: PMID:16348007 {source="Europe PMC"} xref: PMID:16483812 {source="Europe PMC"} xref: PMID:16534979 {source="Europe PMC"} xref: PMID:16656509 {source="Europe PMC"} xref: PMID:16742508 {source="Europe PMC"} xref: PMID:16742518 {source="Europe PMC"} xref: PMID:17120760 {source="Europe PMC"} xref: PMID:17420092 {source="Europe PMC"} xref: PMID:17439666 {source="Europe PMC"} xref: PMID:17709180 {source="Europe PMC"} xref: PMID:18398178 {source="Europe PMC"} xref: PMID:18815700 {source="Europe PMC"} xref: PMID:18846414 {source="Europe PMC"} xref: PMID:19047345 {source="Europe PMC"} xref: PMID:19244483 {source="Europe PMC"} xref: PMID:19544990 {source="Europe PMC"} xref: PMID:19628332 {source="Europe PMC"} xref: PMID:19812358 {source="Europe PMC"} xref: PMID:30398859 {source="Europe PMC"} xref: Reaxys:3648446 {source="Reaxys"} xref: Wikipedia:Sulfate is_a: CHEBI:33482 ! sulfur oxoanion is_a: CHEBI:48154 ! sulfur oxide is_a: CHEBI:79388 ! divalent inorganic anion relationship: is_conjugate_base_of CHEBI:45696 ! hydrogensulfate relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O4S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-L" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06360" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95283" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]S([O-])(=O)=O" xsd:string [Term] id: CHEBI:16234 name: hydroxide namespace: chebi_ontology alt_id: CHEBI:13365 alt_id: CHEBI:13419 alt_id: CHEBI:44641 alt_id: CHEBI:5594 subset: 3_STAR synonym: "HO-" RELATED [KEGG_COMPOUND] synonym: "hydridooxygenate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydroxide" EXACT IUPAC_NAME [IUPAC] synonym: "HYDROXIDE ION" RELATED [PDBeChem] synonym: "Hydroxide ion" RELATED [KEGG_COMPOUND] synonym: "OH(-)" RELATED [IUPAC] synonym: "OH-" RELATED [KEGG_COMPOUND] synonym: "oxidanide" EXACT IUPAC_NAME [IUPAC] xref: CAS:14280-30-9 {source="ChemIDplus"} xref: CAS:14280-30-9 {source="NIST Chemistry WebBook"} xref: Gmelin:24714 {source="Gmelin"} xref: KEGG:C01328 xref: PDBeChem:OH is_a: CHEBI:33693 ! oxygen hydride relationship: is_conjugate_base_of CHEBI:15377 ! water relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "17.00734" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00329" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-][H]" xsd:string [Term] id: CHEBI:16336 name: hyaluronic acid namespace: chebi_ontology alt_id: CHEBI:14412 alt_id: CHEBI:24622 alt_id: CHEBI:24623 alt_id: CHEBI:5772 def: "A mucopolysaccharide composed of N-acetylglucosamine and glucuronic acid subunits. It is found in the connective tissues of vertebrates. A principal constituent of the extracellular matrix (ECM), it mediates the growth and metastasis of tumour cells." [] subset: 3_STAR synonym: "[beta-D-glucopyranuronosyl-(1->3)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1->4)]n" RELATED [ChEBI] synonym: "[beta-N-Acetyl-D-glucosaminyl(1,4)beta-D-glucuronosyl(1,3)]n" RELATED [KEGG_COMPOUND] synonym: "acide hyaluronique" RELATED [ChEBI] synonym: "acido hialuronico" RELATED [ChEBI] synonym: "hyaluronan" RELATED [ChEBI] synonym: "Hyaluronic acid" EXACT [KEGG_COMPOUND] synonym: "Hyaluronsaeure" RELATED [ChEBI] xref: Beilstein:8538277 {source="Beilstein"} xref: CAS:9004-61-9 {source="KEGG COMPOUND"} xref: CAS:9004-61-9 {source="ChemIDplus"} xref: HMDB:HMDB0010366 xref: KEGG:C00518 xref: KEGG:D08043 xref: KEGG:G10505 xref: PMID:11122186 {source="Europe PMC"} xref: PMID:18056362 {source="Europe PMC"} xref: PMID:18290544 {source="Europe PMC"} xref: Reaxys:8187837 {source="Reaxys"} xref: Wikipedia:Hyaluronan is_a: CHEBI:37395 ! mucopolysaccharide is_a: CHEBI:72813 ! exopolysaccharide relationship: is_conjugate_acid_of CHEBI:132153 ! hyaluronate relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "(C14H21NO12)n" xsd:string [Term] id: CHEBI:16480 name: nitric oxide namespace: chebi_ontology alt_id: CHEBI:14657 alt_id: CHEBI:25546 alt_id: CHEBI:44452 alt_id: CHEBI:7583 def: "A nitrogen oxide which is a free radical, each molecule of which consists of one nitrogen and one oxygen atom." [] subset: 3_STAR synonym: "(.)NO" RELATED [ChEBI] synonym: "(NO)(.)" RELATED [IUPAC] synonym: "[NO]" RELATED [MolBase] synonym: "EDRF" RELATED [ChEBI] synonym: "endothelium-derived relaxing factor" RELATED [ChEBI] synonym: "mononitrogen monoxide" RELATED [ChemIDplus] synonym: "monoxido de nitrogeno" RELATED [ChEBI] synonym: "monoxyde d'azote" RELATED [ChEBI] synonym: "Nitric oxide" EXACT [KEGG_COMPOUND] synonym: "nitric oxide" EXACT [UniProt] synonym: "nitrogen monooxide" RELATED [IUPAC] synonym: "Nitrogen monoxide" RELATED [KEGG_COMPOUND] synonym: "nitrogen monoxide" RELATED [IUPAC] synonym: "nitrosyl" RELATED [IUPAC] synonym: "NO" RELATED [KEGG_COMPOUND] synonym: "NO(.)" RELATED [IUPAC] synonym: "oxido de nitrogeno(II)" RELATED [ChEBI] synonym: "oxido nitrico" RELATED [ChEBI] synonym: "oxidonitrogen(.)" EXACT IUPAC_NAME [IUPAC] synonym: "oxoazanyl" EXACT IUPAC_NAME [IUPAC] synonym: "oxyde azotique" RELATED [ChEBI] synonym: "oxyde nitrique" RELATED [ChEBI] synonym: "Stickstoff(II)-oxid" RELATED [ChEBI] synonym: "Stickstoffmonoxid" RELATED [ChEBI] xref: CAS:10102-43-9 {source="KEGG COMPOUND"} xref: CAS:10102-43-9 {source="NIST Chemistry WebBook"} xref: CAS:10102-43-9 {source="ChemIDplus"} xref: DrugBank:DB00435 xref: Gmelin:451 {source="Gmelin"} xref: KEGG:C00533 xref: KEGG:D00074 xref: MolBase:943 xref: PDBeChem:NO xref: Reaxys:3587257 {source="Reaxys"} xref: Wikipedia:Nitric_oxide is_a: CHEBI:35196 ! nitrogen oxide is_a: CHEBI:36871 ! inorganic radical is_a: CHEBI:62764 ! reactive nitrogen species relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:35523 ! has role bronchodilator agent relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent relationship: RO:0000087 CHEBI:48578 ! has role radical scavenger relationship: RO:0000087 CHEBI:62488 ! has role signalling molecule relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "NO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/NO/c1-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MWUXSHHQAYIFBG-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "30.00614" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.99799" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[N]=O" xsd:string [Term] id: CHEBI:16541 name: protein polypeptide chain namespace: chebi_ontology alt_id: CHEBI:8526 def: "A naturally occurring polypeptide synthesized at the ribosome." [] subset: 3_STAR synonym: "a protein" RELATED [UniProt] synonym: "polypeptide chain" RELATED [ChEBI] synonym: "Protein" RELATED [KEGG_COMPOUND] synonym: "protein polypeptide chains" RELATED [ChEBI] xref: KEGG:C00017 is_a: CHEBI:15841 ! polypeptide relationship: has_part CHEBI:33700 ! proteinogenic amino-acid residue [Term] id: CHEBI:16646 name: carbohydrate namespace: chebi_ontology alt_id: CHEBI:15131 alt_id: CHEBI:23008 alt_id: CHEBI:9318 def: "Any member of the class of organooxygen compounds that is a polyhydroxy-aldehyde or -ketone or a lactol resulting from their intramolecular condensation (monosaccharides); substances derived from these by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom; and polymeric products arising by intermolecular acetal formation between two or more such molecules (disaccharides, polysaccharides and oligosaccharides). Carbohydrates contain only carbon, hydrogen and oxygen atoms; prior to any oxidation or reduction, most have the empirical formula Cm(H2O)n. Compounds obtained from carbohydrates by substitution, etc., are known as carbohydrate derivatives and may contain other elements. Cyclitols are generally not regarded as carbohydrates." [] subset: 3_STAR synonym: "a carbohydrate" RELATED [UniProt] synonym: "carbohidrato" RELATED [IUPAC] synonym: "carbohidratos" RELATED [IUPAC] synonym: "carbohydrate" EXACT IUPAC_NAME [IUPAC] synonym: "carbohydrates" EXACT IUPAC_NAME [IUPAC] synonym: "glucide" RELATED [ChEBI] synonym: "glucides" RELATED [ChEBI] synonym: "glucido" RELATED [ChEBI] synonym: "glucidos" RELATED [ChEBI] synonym: "hydrates de carbone" RELATED [ChEBI] synonym: "Kohlenhydrat" RELATED [ChEBI] synonym: "Kohlenhydrate" RELATED [ChEBI] synonym: "saccharide" RELATED [IUPAC] synonym: "saccharides" RELATED [IUPAC] synonym: "saccharidum" RELATED [ChEBI] xref: Wikipedia:Carbohydrate is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives [Term] id: CHEBI:16670 name: peptide namespace: chebi_ontology alt_id: CHEBI:14753 alt_id: CHEBI:25906 alt_id: CHEBI:7990 def: "Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from alpha-amino acids, but it includes those derived from any amino carboxylic acid." [ANON:ANON] def: "Amide derived from two or more amino carboxylic acid molecules (the same or different) by formation of a covalent bond from the carbonyl carbon of one to the nitrogen atom of another with formal loss of water. The term is usually applied to structures formed from alpha-amino acids, but it includes those derived from any amino carboxylic acid. X = OH, OR, NH2, NHR, etc." [] subset: 3_STAR synonym: "C2H4NO2R(C2H2NOR)n" RELATED FORMULA [KEGG COMPOUND:] synonym: "Peptid" RELATED [ChEBI:] synonym: "Peptid" RELATED [ChEBI] synonym: "Peptide" EXACT [KEGG_COMPOUND] synonym: "Peptide" EXACT [KEGG COMPOUND:] synonym: "peptides" EXACT IUPAC_NAME [IUPAC:] synonym: "peptides" EXACT IUPAC_NAME [IUPAC] synonym: "peptido" RELATED [ChEBI] synonym: "peptido" RELATED [ChEBI:] synonym: "peptidos" RELATED [ChEBI:] synonym: "peptidos" RELATED [ChEBI] xref: KEGG:C00012 is_a: CHEBI:37622 ! carboxamide is_a: CHEBI:50047 ! organic amino compound relationship: has_part CHEBI:33708 ! amino-acid residue relationship: is_tautomer_of CHEBI:60466 ! peptide zwitterion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "(C2H2NOR)nC2H3NOR" xsd:string [Term] id: CHEBI:166902 name: noradrenaline(1+) namespace: chebi_ontology subset: 2_STAR synonym: "noradrenaline" RELATED [UniProt] is_a: CHEBI:25697 ! organic cation is_a: CHEBI:35274 ! ammonium ion derivative relationship: is_conjugate_acid_of CHEBI:33569 ! noradrenaline property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H12NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "170.187" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "170.08117" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=CC(=CC(=C1O)O)C(C[NH3+])O" xsd:string [Term] id: CHEBI:167559 name: glycan namespace: chebi_ontology def: "Any oligosaccharide, polysaccharide or their derivatives consisting of monosaccharides or monosaccharide derivatives linked by glycosidic bonds. See also http://www.ontobee.org/ontology/GNO?iri=http://purl.obolibrary.org/obo/GNO_00000001." [] subset: 3_STAR synonym: "glycans" RELATED [ChEBI] is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives [Term] id: CHEBI:16765 name: tryptamine namespace: chebi_ontology alt_id: CHEBI:15274 alt_id: CHEBI:27161 alt_id: CHEBI:46157 alt_id: CHEBI:9767 def: "An aminoalkylindole consisting of indole having a 2-aminoethyl group at the 3-position." [] subset: 3_STAR synonym: "1H-indole-3-ethanamine" RELATED [NIST_Chemistry_WebBook] synonym: "2-(1H-INDOL-3-YL)ETHANAMINE" RELATED [PDBeChem] synonym: "2-(1H-indol-3-yl)ethanamine" EXACT IUPAC_NAME [IUPAC] synonym: "2-(3-indolyl)ethylamine" RELATED [ChemIDplus] synonym: "3-(2-Aminoethyl)indole" RELATED [KEGG_COMPOUND] synonym: "Tryptamine" EXACT [KEGG_COMPOUND] xref: Beilstein:125513 {source="Beilstein"} xref: CAS:61-54-1 {source="ChemIDplus"} xref: CAS:61-54-1 {source="NIST Chemistry WebBook"} xref: CAS:61-54-1 {source="KEGG COMPOUND"} xref: DrugBank:DB08653 xref: Gmelin:603448 {source="Gmelin"} xref: HMDB:HMDB0000303 xref: KEGG:C00398 xref: KNApSAcK:C00001434 xref: MetaCyc:TRYPTAMINE xref: PDBeChem:TSS xref: PMID:16126914 {source="Europe PMC"} xref: PMID:22770225 {source="Europe PMC"} xref: PMID:24345948 {source="Europe PMC"} xref: PMID:24558969 {source="Europe PMC"} xref: Reaxys:125513 {source="Reaxys"} xref: Wikipedia:Tryptamine is_a: CHEBI:27162 ! tryptamines is_a: CHEBI:38631 ! aminoalkylindole is_a: CHEBI:38958 ! indole alkaloid is_a: CHEBI:64365 ! aralkylamino compound relationship: is_conjugate_base_of CHEBI:57887 ! tryptaminium relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H12N2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "APJYDQYYACXCRM-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "160.21570" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "160.10005" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1c[nH]c2ccccc12" xsd:string [Term] id: CHEBI:16796 name: melatonin namespace: chebi_ontology alt_id: CHEBI:14577 alt_id: CHEBI:25180 alt_id: CHEBI:6730 def: "A member of the class of acetamides that is acetamide in which one of the hydrogens attached to the nitrogen atom is replaced by a 2-(5-methoxy-1H-indol-3-yl)ethyl group. It is a hormone secreted by the pineal gland in humans." [] subset: 3_STAR synonym: "5-methoxy-N-acetyltryptamine" RELATED [ChemIDplus] synonym: "Melatonin" EXACT [KEGG_COMPOUND] synonym: "melatonin" EXACT [UniProt] synonym: "melatonine" RELATED [ChEBI] synonym: "N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide" EXACT IUPAC_NAME [IUPAC] synonym: "N-[2-(5-methoxyindol-3-yl)ethyl]acetamide" RELATED [NIST_Chemistry_WebBook] synonym: "N-Acetyl-5-methoxytryptamine" RELATED [KEGG_COMPOUND] xref: Beilstein:205542 {source="Beilstein"} xref: CAS:73-31-4 {source="ChemIDplus"} xref: CAS:73-31-4 {source="NIST Chemistry WebBook"} xref: CAS:73-31-4 {source="KEGG COMPOUND"} xref: Drug_Central:1672 {source="DrugCentral"} xref: DrugBank:DB01065 xref: HMDB:HMDB0001389 xref: KEGG:C01598 xref: KEGG:D08170 xref: LINCS:LSM-4779 xref: MetaCyc:N-ACETYL-5-METHOXY-TRYPTAMINE xref: PDBeChem:ML1 xref: PMID:16678784 {source="Europe PMC"} xref: PMID:18212404 {source="Europe PMC"} xref: PMID:18485664 {source="Europe PMC"} xref: PMID:8290600 {source="Europe PMC"} xref: Reaxys:205542 {source="Reaxys"} xref: Wikipedia:Melatonin is_a: CHEBI:22160 ! acetamides is_a: CHEBI:27162 ! tryptamines relationship: has_functional_parent CHEBI:16765 ! tryptamine relationship: RO:0000087 CHEBI:176497 ! has role geroprotector relationship: RO:0000087 CHEBI:24621 ! has role hormone relationship: RO:0000087 CHEBI:35623 ! has role anticonvulsant relationship: RO:0000087 CHEBI:48578 ! has role radical scavenger relationship: RO:0000087 CHEBI:50847 ! has role immunological adjuvant relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C13H16N2O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C13H16N2O2/c1-9(16)14-6-5-10-8-15-13-4-3-11(17-2)7-12(10)13/h3-4,7-8,15H,5-6H2,1-2H3,(H,14,16)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DRLFMBDRBRZALE-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "232.283" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "232.12118" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C=1C=C(C=C2C(=CNC12)CCNC(=O)C)OC" xsd:string [Term] id: CHEBI:16865 name: gamma-aminobutyric acid namespace: chebi_ontology alt_id: CHEBI:1786 alt_id: CHEBI:193777 alt_id: CHEBI:20318 alt_id: CHEBI:40483 def: "A gamma-amino acid that is butanoic acid with the amino substituent located at C-4." [] def: "An amino fatty acid composed of butanoic acid with the amino substituent at C-4." [ANON:ANON] subset: 3_STAR synonym: "4-Aminobutanoic acid" RELATED [KEGG COMPOUND:] synonym: "4-Aminobutanoic acid" RELATED [KEGG_COMPOUND] synonym: "4-aminobutanoic acid" EXACT IUPAC_NAME [IUPAC] synonym: "4-aminobutanoic acid" EXACT IUPAC_NAME [IUPAC:] synonym: "4-aminobutanoic acid" RELATED [UniProt:] synonym: "4-aminobutanoic acid" RELATED [ChEBI:] synonym: "4-aminobutanoic acid" RELATED [ChEBI] synonym: "4-Aminobutyric acid" RELATED [KEGG_COMPOUND] synonym: "4-Aminobutyric acid" RELATED [KEGG COMPOUND:] synonym: "4-aminobutyric acid" RELATED [ChEBI] synonym: "4-aminobutyric acid" RELATED [ChEBI:] synonym: "4Abu" RELATED [ChEBI] synonym: "C4H9NO2" RELATED FORMULA [KEGG COMPOUND:] synonym: "GABA" RELATED [IUPHAR:] synonym: "GABA" RELATED [KEGG_COMPOUND] synonym: "GABA" RELATED [IUPHAR] synonym: "GAMMA-AMINO-BUTANOIC ACID" RELATED [PDBeChem] synonym: "GAMMA-AMINO-BUTANOIC ACID" RELATED [PDBeChem:] synonym: "gamma-amino-n-butyric acid" RELATED [NIST_Chemistry_WebBook] synonym: "gamma-amino-n-butyric acid" RELATED [NIST Chemistry WebBook:] synonym: "gamma-aminobutanoic acid" RELATED [NIST_Chemistry_WebBook] synonym: "gamma-aminobutanoic acid" RELATED [NIST Chemistry WebBook:] synonym: "gamma-Aminobuttersaeure" RELATED [NIST Chemistry WebBook:] synonym: "gamma-Aminobuttersaeure" RELATED [NIST_Chemistry_WebBook] synonym: "gamma-Aminobutyric acid" EXACT [KEGG COMPOUND:] synonym: "gamma-Aminobutyric acid" EXACT [KEGG_COMPOUND] synonym: "gamma-aminobutyric acid" EXACT [NIST_Chemistry_WebBook] synonym: "gamma-aminobutyric acid" EXACT [NIST Chemistry WebBook:] synonym: "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)" RELATED InChI [ChEBI:] synonym: "InChIKey=BTCSSZJGUNDROE-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "NCCCC(O)=O" RELATED SMILES [ChEBI:] synonym: "omega-aminobutyric acid" RELATED [NIST_Chemistry_WebBook] synonym: "omega-aminobutyric acid" RELATED [NIST Chemistry WebBook:] synonym: "piperidic acid" RELATED [ChemIDplus:] synonym: "piperidic acid" RELATED [ChemIDplus] synonym: "piperidinic acid" RELATED [ChemIDplus:] synonym: "piperidinic acid" RELATED [ChemIDplus] xref: Beilstein:906818 {source="Beilstein"} xref: BPDB:2298 xref: CAS:56-12-2 {source="ChemIDplus"} xref: CAS:56-12-2 {source="NIST Chemistry WebBook"} xref: CAS:56-12-2 {source="KEGG COMPOUND"} xref: Drug_Central:1262 {source="DrugCentral"} xref: DrugBank:DB02530 xref: Gmelin:49775 {source="Gmelin"} xref: HMDB:HMDB0000112 xref: KEGG:C00334 xref: KEGG:D00058 xref: KNApSAcK:C00001337 xref: LIPID_MAPS_instance:LMFA01100039 {source="LIPID MAPS"} xref: MetaCyc:4-AMINO-BUTYRATE xref: PDBeChem:ABU xref: PMID:10630630 {source="Europe PMC"} xref: PMID:10930630 {source="Europe PMC"} xref: PMID:16276116 {source="Europe PMC"} xref: PMID:21614609 {source="Europe PMC"} xref: PMID:22770225 {source="Europe PMC"} xref: Reaxys:906818 {source="Reaxys"} xref: Wikipedia:Gamma-Aminobutyric_acid is_a: CHEBI:25384 ! monocarboxylic acid is_a: CHEBI:33707 ! gamma-amino acid relationship: has_functional_parent CHEBI:30772 ! butyric acid relationship: is_conjugate_acid_of CHEBI:30566 ! gamma-aminobutyrate relationship: is_tautomer_of CHEBI:59888 ! gamma-aminobutyric acid zwitterion relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:62488 ! has role signalling molecule relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H9NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "103.11980" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "103.06333" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCCC(O)=O" xsd:string [Term] id: CHEBI:16990 name: bilirubin IXalpha namespace: chebi_ontology alt_id: CHEBI:13898 alt_id: CHEBI:22870 alt_id: CHEBI:3099 def: "A member of the class of biladienes that is a linear tetrapyrrole with the dipyrrole units being of both exovinyl and endovinyl type. A product of heme degradation, it is produced in the reticuloendothelial system by the reduction of biliverdin and transported to the liver as a complex with serum albumin." [] subset: 3_STAR synonym: "1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinylbiline-8,12-dipropionic acid" RELATED [ChemIDplus] synonym: "2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-biline-8,12-dipropanoic acid" RELATED [ChemIDplus] synonym: "2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid" RELATED [IUPAC] synonym: "3,18-diethenyl-2,7,13,17-tetramethyl-1,19-dioxo-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoic acid" EXACT IUPAC_NAME [IUPAC] synonym: "8,12-bis(2-carboxyethyl)-2,7,13,17-tetramethyl-3,18-divinylbiladiene-ac-1,19(21H,24H)-dione" RELATED [JCBN] synonym: "Bilirubin" RELATED [KEGG_COMPOUND] synonym: "bilirubin" EXACT IUPAC_NAME [IUPAC] synonym: "bilirubin(Z,Z)" RELATED [ChEBI] synonym: "bilirubin-IXalpha" RELATED [ChEBI] xref: Beilstein:74376 {source="Beilstein"} xref: CAS:635-65-4 {source="KEGG COMPOUND"} xref: CAS:635-65-4 {source="ChemIDplus"} xref: Gmelin:411033 {source="Gmelin"} xref: HMDB:HMDB0000054 xref: KEGG:C00486 xref: KNApSAcK:C00029828 xref: MetaCyc:BILIRUBIN xref: PDBeChem:BLR xref: PMID:12799017 {source="Europe PMC"} xref: PMID:18442622 {source="Europe PMC"} xref: PMID:23763371 {source="Europe PMC"} xref: PMID:23768684 {source="Europe PMC"} xref: PMID:30224965 {source="Europe PMC"} xref: PMID:8605219 {source="Europe PMC"} xref: PMID:9587403 {source="Europe PMC"} xref: Reaxys:74376 {source="Reaxys"} xref: Wikipedia:Bilirubin is_a: CHEBI:35692 ! dicarboxylic acid is_a: CHEBI:36735 ! biladienes relationship: has_part CHEBI:142163 ! 24G7 epitope relationship: is_conjugate_acid_of CHEBI:57977 ! bilirubin(2-) relationship: RO:0000087 CHEBI:22586 ! has role antioxidant relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C33H36N4O6" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/b26-13-,27-14-" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BPYKTIZUTYGOLE-IFADSCNNSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "584.673" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "584.26348" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC1=C(C=C)\\C(NC1=O)=C\\C1=C(C)C(CCC(O)=O)=C(CC2=C(CCC(O)=O)C(C)=C(N2)\\C=C2/NC(=O)C(C=C)=C2C)N1" xsd:string [Term] id: CHEBI:16991 name: deoxyribonucleic acid namespace: chebi_ontology alt_id: CHEBI:13302 alt_id: CHEBI:21123 alt_id: CHEBI:33698 alt_id: CHEBI:4291 def: "High molecular weight, linear polymers, composed of nucleotides containing deoxyribose and linked by phosphodiester bonds; DNA contain the genetic information of organisms." [] subset: 3_STAR synonym: "(Deoxyribonucleotide)m" RELATED [KEGG_COMPOUND] synonym: "(Deoxyribonucleotide)n" RELATED [KEGG_COMPOUND] synonym: "(Deoxyribonucleotide)n+m" RELATED [KEGG_COMPOUND] synonym: "Deoxyribonucleic acid" EXACT [KEGG_COMPOUND] synonym: "deoxyribonucleic acids" EXACT IUPAC_NAME [IUPAC] synonym: "deoxyribonucleic acids" RELATED [ChEBI] synonym: "Desoxyribonukleinsaeure" RELATED [ChEBI] synonym: "desoxyribose nucleic acid" RELATED [ChemIDplus] synonym: "DNA" RELATED [UniProt] synonym: "DNA" RELATED [KEGG_COMPOUND] synonym: "DNA" RELATED [IUPAC] synonym: "DNAn" RELATED [KEGG_COMPOUND] synonym: "DNAn+1" RELATED [KEGG_COMPOUND] synonym: "DNS" RELATED [ChEBI] synonym: "thymus nucleic acid" RELATED [ChEBI] xref: CAS:9007-49-2 {source="ChemIDplus"} xref: CAS:9007-49-2 {source="KEGG COMPOUND"} xref: KEGG:C00039 is_a: CHEBI:33696 ! nucleic acid relationship: has_part CHEBI:33793 ! canonical deoxyribonucleoside residue relationship: has_part CHEBI:50298 ! canonical deoxyribonucleotide residue relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite [Term] id: CHEBI:17026 name: progesterone namespace: chebi_ontology alt_id: CHEBI:14896 alt_id: CHEBI:18798 alt_id: CHEBI:26269 alt_id: CHEBI:439 alt_id: CHEBI:45786 alt_id: CHEBI:8453 def: "A C21-steroid hormone in which a pregnane skeleton carries oxo substituents at positions 3 and 20 and is unsaturated at C(4)-C(5). As a hormone, it is involved in the female menstrual cycle, pregnancy and embryogenesis of humans and other species." [] subset: 3_STAR synonym: "(S)-4-Pregnene-3,20-dione" RELATED [KEGG_COMPOUND] synonym: "(S)-Pregn-4-en-3,20-dione" RELATED [KEGG_COMPOUND] synonym: "(S)-Progesterone" RELATED [KEGG_COMPOUND] synonym: "17alpha-progesterone" RELATED [NIST_Chemistry_WebBook] synonym: "4-Pregnene-3,20-dione" RELATED [KEGG_COMPOUND] synonym: "Agolutin" RELATED [NIST_Chemistry_WebBook] synonym: "Akrolutin" RELATED [ChEBI] synonym: "corpus luteum hormone" RELATED [ChemIDplus] synonym: "Crinone" RELATED [ChemIDplus] synonym: "Delta(4)-pregnene-3,20-dione" RELATED [ChEBI] synonym: "Gelbkoerperhormon" RELATED [ChEBI] synonym: "luteohormone" RELATED [ChemIDplus] synonym: "pregn-4-ene-3,20-dione" EXACT IUPAC_NAME [IUPAC] synonym: "Progesteron" RELATED [ChEBI] synonym: "PROGESTERONE" EXACT [PDBeChem] synonym: "Progesterone" EXACT [KEGG_COMPOUND] synonym: "progesterone" EXACT [UniProt] xref: Beilstein:1915950 {source="Beilstein"} xref: CAS:57-83-0 {source="KEGG COMPOUND"} xref: CAS:57-83-0 {source="ChemIDplus"} xref: CAS:57-83-0 {source="NIST Chemistry WebBook"} xref: Drug_Central:2279 {source="DrugCentral"} xref: DrugBank:DB00396 xref: Gmelin:708590 {source="Gmelin"} xref: HMDB:HMDB0001830 xref: KEGG:C00410 xref: KEGG:D00066 xref: MetaCyc:PROGESTERONE xref: PDBeChem:STR xref: PMID:10438974 {source="Europe PMC"} xref: PMID:9506942 {source="Europe PMC"} xref: Reaxys:1915950 {source="Reaxys"} xref: Wikipedia:Progesterone is_a: CHEBI:36885 ! 20-oxo steroid is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid is_a: CHEBI:64600 ! C21-steroid hormone relationship: has_parent_hydride CHEBI:8386 ! pregnane relationship: RO:0000087 CHEBI:49323 ! has role contraceptive drug relationship: RO:0000087 CHEBI:59826 ! has role progestin relationship: RO:0000087 CHEBI:70709 ! has role progesterone receptor agonist relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H30O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H30O2/c1-13(22)17-6-7-18-16-5-4-14-12-15(23)8-10-20(14,2)19(16)9-11-21(17,18)3/h12,16-19H,4-11H2,1-3H3/t16-,17+,18-,19-,20-,21+/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RJKFOVLPORLFTN-LEKSSAKUSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "314.46170" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "314.22458" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3=CC(=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@H](CC[C@@]21[H])C(C)=O" xsd:string [Term] id: CHEBI:17087 name: ketone namespace: chebi_ontology alt_id: CHEBI:13427 alt_id: CHEBI:13646 alt_id: CHEBI:24974 alt_id: CHEBI:6127 alt_id: CHEBI:8742 def: "A compound in which a carbonyl group is bonded to two carbon atoms: R2C=O (neither R may be H)." [] subset: 3_STAR synonym: "a ketone" RELATED [UniProt] synonym: "cetone" RELATED [ChEBI] synonym: "Keton" RELATED [ChEBI] synonym: "Ketone" EXACT [KEGG_COMPOUND] synonym: "ketones" EXACT IUPAC_NAME [IUPAC] synonym: "ketones" RELATED [ChEBI] synonym: "R-CO-R'" RELATED [KEGG_COMPOUND] xref: KEGG:C01450 xref: Wikipedia:Ketone is_a: CHEBI:36586 ! carbonyl compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "COR2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "28.010" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "27.99491" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C([*])=O" xsd:string [Term] id: CHEBI:17089 name: glycoprotein namespace: chebi_ontology alt_id: CHEBI:14349 alt_id: CHEBI:5481 alt_id: CHEBI:5493 def: "A compound in which a carbohydrate component is covalently bound to a protein component." [] subset: 3_STAR synonym: "a glycoprotein" RELATED [UniProt] synonym: "glicoproteina" RELATED [ChEBI] synonym: "glicoproteinas" RELATED [ChEBI] synonym: "Glycoprotein" EXACT [KEGG_COMPOUND] synonym: "glycoproteine" RELATED [ChEBI] synonym: "glycoproteines" RELATED [ChEBI] synonym: "glycoproteins" EXACT IUPAC_NAME [IUPAC] synonym: "Glykoprotein" RELATED [ChEBI] synonym: "Glykoproteine" RELATED [ChEBI] xref: KEGG:C00326 is_a: CHEBI:33837 ! conjugated protein is_a: CHEBI:63299 ! carbohydrate derivative [Term] id: CHEBI:17234 name: glucose namespace: chebi_ontology alt_id: CHEBI:14313 alt_id: CHEBI:24277 alt_id: CHEBI:33929 alt_id: CHEBI:5418 def: "An aldohexose used as a source of energy and metabolic intermediate." [] subset: 3_STAR synonym: "DL-glucose" RELATED [ChEBI] synonym: "Glc" RELATED [JCBN] synonym: "gluco-hexose" EXACT IUPAC_NAME [IUPAC] synonym: "Glucose" EXACT [KEGG_COMPOUND] synonym: "glucose" EXACT IUPAC_NAME [IUPAC] synonym: "Glukose" RELATED [ChEBI] xref: CAS:50-99-7 {source="KEGG COMPOUND"} xref: KEGG:C00293 xref: Wikipedia:Glucose is_a: CHEBI:33917 ! aldohexose relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H12O6" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "180.15588" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "180.06339" xsd:string [Term] id: CHEBI:17347 name: testosterone namespace: chebi_ontology alt_id: CHEBI:15214 alt_id: CHEBI:26883 alt_id: CHEBI:45798 alt_id: CHEBI:9461 def: "An androstanoid having 17beta-hydroxy and 3-oxo groups, together with unsaturation at C-4-C-5.." [] subset: 3_STAR synonym: "17beta-Hydroxy-4-androsten-3-one" RELATED [KEGG_COMPOUND] synonym: "17beta-hydroxy-4-androsten-3-one" RELATED [ChEBI] synonym: "17beta-hydroxyandrost-4-en-3-one" EXACT IUPAC_NAME [IUPAC] synonym: "4-androsten-17beta-ol-3-one" RELATED [NIST_Chemistry_WebBook] synonym: "Androderm" RELATED [ChemIDplus] synonym: "Testosteron" RELATED [ChemIDplus] synonym: "testosterona" RELATED INN [ChemIDplus] synonym: "TESTOSTERONE" EXACT [PDBeChem] synonym: "Testosterone" EXACT [KEGG_COMPOUND] synonym: "testosterone" EXACT [UniProt] synonym: "testosterone" RELATED INN [ChemIDplus] synonym: "testosteronum" RELATED INN [ChemIDplus] xref: Beilstein:1915399 {source="Beilstein"} xref: Beilstein:3653705 {source="Beilstein"} xref: CAS:58-22-0 {source="NIST Chemistry WebBook"} xref: CAS:58-22-0 {source="ChemIDplus"} xref: CAS:58-22-0 {source="KEGG COMPOUND"} xref: Drug_Central:2607 {source="DrugCentral"} xref: DrugBank:DB00624 xref: Gmelin:538843 {source="Gmelin"} xref: HMDB:HMDB0000234 xref: KEGG:C00535 xref: KEGG:D00075 xref: KNApSAcK:C00003675 xref: LIPID_MAPS_instance:LMST02020002 {source="LIPID MAPS"} xref: PDBeChem:TES xref: PMID:10438974 {source="Europe PMC"} xref: PMID:11786693 {source="Europe PMC"} xref: PMID:18900503 {source="Europe PMC"} xref: PMID:24498482 {source="Europe PMC"} xref: Reaxys:1915399 {source="Reaxys"} xref: Wikipedia:Testosterone is_a: CHEBI:131621 ! C19-steroid is_a: CHEBI:35343 ! 17beta-hydroxy steroid is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid is_a: CHEBI:50402 ! androstanoid relationship: RO:0000087 CHEBI:50113 ! has role androgen relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite relationship: RO:0000087 CHEBI:83056 ! has role Daphnia magna metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H28O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C19H28O2/c1-18-9-7-13(20)11-12(18)3-4-14-15-5-6-17(21)19(15,2)10-8-16(14)18/h11,14-17,21H,3-10H2,1-2H3/t14-,15-,16-,17-,18-,19-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MUMGGOZAMZWBJJ-DYKIIFRCSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "288.42440" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.20893" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3=CC(=O)CC[C@]3(C)[C@@]1([H])CC[C@]1(C)[C@@H](O)CC[C@@]21[H]" xsd:string [Term] id: CHEBI:17478 name: aldehyde namespace: chebi_ontology alt_id: CHEBI:13432 alt_id: CHEBI:13753 alt_id: CHEBI:13805 alt_id: CHEBI:13806 alt_id: CHEBI:22291 alt_id: CHEBI:2554 alt_id: CHEBI:8750 def: "A compound RC(=O)H, in which a carbonyl group is bonded to one hydrogen atom and to one R group." [] subset: 3_STAR synonym: "aldehido" RELATED [ChEBI] synonym: "aldehidos" RELATED [ChEBI] synonym: "Aldehyd" RELATED [ChEBI] synonym: "Aldehyde" EXACT [KEGG_COMPOUND] synonym: "aldehyde" EXACT [ChEBI] synonym: "aldehyde" EXACT IUPAC_NAME [IUPAC] synonym: "aldehydes" EXACT IUPAC_NAME [IUPAC] synonym: "aldehydes" RELATED [ChEBI] synonym: "aldehydum" RELATED [ChEBI] synonym: "an aldehyde" RELATED [UniProt] synonym: "RC(=O)H" RELATED [IUPAC] synonym: "RCHO" RELATED [KEGG_COMPOUND] xref: KEGG:C00071 is_a: CHEBI:36586 ! carbonyl compound relationship: has_part CHEBI:42485 ! formyl group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHOR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "29.01800" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.00274" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C([*])=O" xsd:string [Term] id: CHEBI:17544 name: hydrogencarbonate namespace: chebi_ontology alt_id: CHEBI:13363 alt_id: CHEBI:22863 alt_id: CHEBI:40961 alt_id: CHEBI:5589 def: "The carbon oxoanion resulting from the removal of a proton from carbonic acid." [] subset: 3_STAR synonym: "[CO2(OH)](-)" RELATED [IUPAC] synonym: "Acid carbonate" RELATED [KEGG_COMPOUND] synonym: "Bicarbonate" RELATED [KEGG_COMPOUND] synonym: "BICARBONATE ION" RELATED [PDBeChem] synonym: "HCO3(-)" RELATED [IUPAC] synonym: "HCO3-" RELATED [KEGG_COMPOUND] synonym: "hydrogen carbonate" RELATED [PDBeChem] synonym: "hydrogen(trioxidocarbonate)(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "Hydrogencarbonate" EXACT [KEGG_COMPOUND] synonym: "hydrogencarbonate" EXACT [UniProt] synonym: "hydrogencarbonate" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogencarbonate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogentrioxocarbonate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogentrioxocarbonate(IV)" EXACT IUPAC_NAME [IUPAC] synonym: "hydroxidodioxidocarbonate(1-)" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:3903504 {source="Beilstein"} xref: CAS:71-52-3 {source="ChemIDplus"} xref: Gmelin:49249 {source="Gmelin"} xref: HMDB:HMDB0000595 xref: KEGG:C00288 xref: MetaCyc:HCO3 xref: PDBeChem:BCT xref: PMID:17215880 {source="Europe PMC"} xref: PMID:17505962 {source="Europe PMC"} xref: PMID:18439416 {source="Europe PMC"} xref: PMID:28732801 {source="Europe PMC"} xref: PMID:29150416 {source="Europe PMC"} xref: PMID:29460248 {source="Europe PMC"} xref: PMID:29466234 {source="Europe PMC"} xref: PMID:4208463 {source="Europe PMC"} xref: Wikipedia:Bicarbonate is_a: CHEBI:35604 ! carbon oxoanion relationship: is_conjugate_acid_of CHEBI:41609 ! carbonate relationship: is_conjugate_base_of CHEBI:28976 ! carbonic acid relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "61.01684" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "60.99312" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([O-])=O" xsd:string [Term] id: CHEBI:176497 name: geroprotector namespace: chebi_ontology def: "Any compound that supports healthy aging, slows the biological aging process, or extends lifespan." [] subset: 3_STAR synonym: "anti-aging agent" RELATED [ChEBI] synonym: "anti-aging agents" RELATED [ChEBI] synonym: "anti-aging drug" RELATED [ChEBI] synonym: "anti-aging drugs" RELATED [ChEBI] synonym: "geroprotective agent" RELATED [ChEBI] synonym: "geroprotective agents" RELATED [ChEBI] synonym: "geroprotectors" RELATED [ChEBI] xref: PMID:23372317 {source="Europe PMC"} xref: PMID:28580190 {source="Europe PMC"} xref: PMID:30885572 {source="Europe PMC"} xref: PMID:33144142 {source="Europe PMC"} xref: PMID:33973253 {source="Europe PMC"} xref: PMID:34606237 {source="Europe PMC"} xref: Wikipedia:Geroprotector is_a: CHEBI:50267 ! protective agent [Term] id: CHEBI:177917 name: phenolic steroid namespace: chebi_ontology subset: 2_STAR synonym: "a phenolic steroid" RELATED [UniProt] xref: KEGG:C02453 {source="SUBMITTER"} xref: MetaCyc:PHENOLIC-STEROID {source="SUBMITTER"} is_a: CHEBI:33853 ! phenols is_a: CHEBI:36834 ! 3-hydroxy steroid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H24O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H24O/c1-18-9-2-3-17(18)16-6-4-12-11-13(19)5-7-14(12)15(16)8-10-18/h5,7,11,15-17,19H,2-4,6,8-10H2,1H3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "HJKVPZJVBHWFCQ-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "256.389" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "256.18272" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=C2C(CCC3C4CCCC4(CCC32)C)=CC(=C1)O" xsd:string [Term] id: CHEBI:17891 name: donor namespace: chebi_ontology alt_id: CHEBI:14202 alt_id: CHEBI:4697 def: "A molecular entity that can transfer (\"donate\") an electron, a pair of electrons, an atom or a group to another molecular entity." [] subset: 3_STAR synonym: "Donator" RELATED [ChEBI] synonym: "donneur" RELATED [ChEBI] synonym: "Donor" EXACT [KEGG_COMPOUND] xref: KEGG:C01351 is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:17968 name: butyrate namespace: chebi_ontology alt_id: CHEBI:13924 alt_id: CHEBI:22946 def: "A short-chain fatty acid anion that is the conjugate base of butyric acid, obtained by deprotonation of the carboxy group." [] subset: 3_STAR synonym: "1-butanoate" RELATED [ChEBI] synonym: "1-butyrate" RELATED [ChEBI] synonym: "1-propanecarboxylate" RELATED [ChEBI] synonym: "butanate" RELATED [ChEBI] synonym: "butanoate" EXACT IUPAC_NAME [IUPAC] synonym: "butanoate" RELATED [ChEBI] synonym: "butanoate" RELATED [UniProt] synonym: "butanoic acid, ion(1-)" RELATED [ChemIDplus] synonym: "butyrate" EXACT [IUPAC] synonym: "CH3-[CH2]2-COO(-)" RELATED [IUPAC] synonym: "n-butanoate" RELATED [ChEBI] synonym: "n-butyrate" RELATED [ChemIDplus] synonym: "propanecarboxylate" RELATED [ChEBI] synonym: "propylformate" RELATED [ChEBI] xref: Beilstein:3601060 {source="Beilstein"} xref: CAS:461-55-2 {source="ChemIDplus"} xref: Gmelin:324289 {source="Gmelin"} xref: KEGG:C00246 xref: MetaCyc:BUTYRIC_ACID xref: PMID:17190852 {source="Europe PMC"} xref: PMID:7496326 {source="Europe PMC"} xref: Reaxys:3601060 {source="Reaxys"} xref: UM-BBD_compID:c0035 {source="UM-BBD"} is_a: CHEBI:78115 ! fatty acid anion 4:0 relationship: is_conjugate_base_of CHEBI:30772 ! butyric acid relationship: RO:0000087 CHEBI:61115 ! has role EC 3.5.1.98 (histone deacetylase) inhibitor relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H7O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H8O2/c1-2-3-4(5)6/h2-3H2,1H3,(H,5,6)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FERIUCNNQQJTOY-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "87.09718" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.04515" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCCC([O-])=O" xsd:string [Term] id: CHEBI:18059 name: lipid namespace: chebi_ontology alt_id: CHEBI:14517 alt_id: CHEBI:25054 alt_id: CHEBI:6486 def: "'Lipids' is a loosely defined term for substances of biological origin that are soluble in nonpolar solvents. They consist of saponifiable lipids, such as glycerides (fats and oils) and phospholipids, as well as nonsaponifiable lipids, principally steroids." [ANON:ANON] subset: 3_STAR synonym: "Lipid" EXACT [KEGG_COMPOUND] synonym: "Lipid" EXACT [KEGG COMPOUND:] synonym: "lipid" EXACT [UniProt:] synonym: "lipids" EXACT IUPAC_NAME [IUPAC:] synonym: "lipids" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C01356 is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:18085 name: glycosaminoglycan namespace: chebi_ontology alt_id: CHEBI:14361 alt_id: CHEBI:24398 alt_id: CHEBI:5495 def: "Any polysaccharide containing a substantial proportion of aminomonosaccharide residues." [] subset: 3_STAR synonym: "glicosaminoglicano" RELATED [IUPAC] synonym: "Glycosaminoglycan" EXACT [KEGG_COMPOUND] synonym: "glycosaminoglycan" EXACT IUPAC_NAME [IUPAC] synonym: "glycosaminoglycane" RELATED [IUPAC] synonym: "glycosaminoglycans" RELATED [ChEBI] synonym: "Glykosaminoglykan" RELATED [ChEBI] xref: KEGG:C02545 xref: Wikipedia:Glycosaminoglycan is_a: CHEBI:22506 ! aminoglycan [Term] id: CHEBI:18133 name: hexose namespace: chebi_ontology alt_id: CHEBI:14399 alt_id: CHEBI:24590 alt_id: CHEBI:5709 def: "Any six-carbon monosaccharide which in its linear form contains either an aldehyde group at position 1 (aldohexose) or a ketone group at position 2 (ketohexose)." [] subset: 3_STAR synonym: "Hexose" EXACT [KEGG_COMPOUND] synonym: "hexoses" RELATED [ChEBI] synonym: "WURCS=2.0/1,1,0/[axxxxh-1x_1-5_2*NCC/3=O]/1/" RELATED [GlyTouCan] xref: GlyGen:G70994MS xref: GlyTouCan:G70994MS xref: KEGG:C00738 is_a: CHEBI:35381 ! monosaccharide [Term] id: CHEBI:18154 name: polysaccharide namespace: chebi_ontology alt_id: CHEBI:14864 alt_id: CHEBI:26205 alt_id: CHEBI:8322 def: "A biomacromolecule consisting of large numbers of monosaccharide residues linked glycosidically. This term is commonly used only for those containing more than ten monosaccharide residues." [] subset: 3_STAR synonym: "Glycan" RELATED [KEGG_COMPOUND] synonym: "Glycane" RELATED [ChEBI] synonym: "glycans" RELATED [IUPAC] synonym: "Glykan" RELATED [ChEBI] synonym: "Glykane" RELATED [ChEBI] synonym: "polisacarido" RELATED [ChEBI] synonym: "polisacaridos" RELATED [IUPAC] synonym: "Polysaccharide" EXACT [KEGG_COMPOUND] synonym: "polysaccharides" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C00420 is_a: CHEBI:16646 ! carbohydrate is_a: CHEBI:167559 ! glycan is_a: CHEBI:33694 ! biomacromolecule [Term] id: CHEBI:18237 name: glutamic acid namespace: chebi_ontology alt_id: CHEBI:24314 alt_id: CHEBI:5431 def: "An alpha-amino acid that has formula C5H9NO4." [ANON:ANON] def: "An alpha-amino acid that is glutaric acid bearing a single amino substituent at position 2." [] subset: 3_STAR synonym: "2-Aminoglutaric acid" RELATED [KEGG_COMPOUND] synonym: "2-Aminoglutaric acid" RELATED [KEGG COMPOUND:] synonym: "2-aminopentanedioic acid" EXACT IUPAC_NAME [IUPAC:] synonym: "2-aminopentanedioic acid" EXACT IUPAC_NAME [IUPAC] synonym: "C5H9NO4" RELATED FORMULA [KEGG COMPOUND:] synonym: "DL-Glutamic acid" RELATED [KEGG_DRUG] synonym: "DL-Glutaminic acid" RELATED [KEGG_COMPOUND] synonym: "E" RELATED [ChEBI] synonym: "Glu" RELATED [ChEBI] synonym: "Glutamate" RELATED [KEGG_COMPOUND] synonym: "Glutamic acid" EXACT [KEGG_COMPOUND] synonym: "glutamic acid" EXACT IUPAC_NAME [IUPAC:] synonym: "glutamic acid" EXACT IUPAC_NAME [IUPAC] synonym: "Glutaminic acid" RELATED [KEGG COMPOUND:] synonym: "Glutaminic acid" RELATED [KEGG_COMPOUND] synonym: "Glutaminsaeure" RELATED [ChEBI:] synonym: "Glutaminsaeure" RELATED [ChEBI] synonym: "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)" RELATED InChI [ChEBI:] synonym: "InChIKey=WHUUTDBJXJRKMK-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "NC(CCC(O)=O)C(O)=O" RELATED SMILES [ChEBI:] xref: Beilstein:1723799 {source="Beilstein"} xref: CAS:617-65-2 {source="ChemIDplus"} xref: CAS:617-65-2 {source="NIST Chemistry WebBook"} xref: CAS:617-65-2 {source="KEGG COMPOUND"} xref: Gmelin:101971 {source="Gmelin"} xref: KEGG:C00302 xref: KEGG:D04341 xref: KNApSAcK:C00001358 xref: KNApSAcK:C00019577 xref: PMID:15739367 {source="Europe PMC"} xref: PMID:17190852 {source="Europe PMC"} xref: PMID:24616376 {source="Europe PMC"} xref: PMID:24984001 {source="Europe PMC"} xref: Reaxys:1723799 {source="Reaxys"} xref: Wikipedia:Glutamic_acid is_a: CHEBI:26167 ! polar amino acid is_a: CHEBI:33704 ! alpha-amino acid relationship: has_part CHEBI:50329 ! 2-carboxyethyl group relationship: is_conjugate_acid_of CHEBI:14321 ! glutamate(1-) relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H9NO4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "147.12930" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "147.05316" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(CCC(O)=O)C(O)=O" xsd:string [Term] id: CHEBI:18243 name: dopamine namespace: chebi_ontology alt_id: CHEBI:11695 alt_id: CHEBI:11930 alt_id: CHEBI:14203 alt_id: CHEBI:1764 alt_id: CHEBI:23886 alt_id: CHEBI:43686 def: "Catechol in which the hydrogen at position 4 is substituted by a 2-aminoethyl group." [ANON:ANON] subset: 3_STAR synonym: "2-(3,4-Dihydroxyphenyl)ethylamine" RELATED [KEGG COMPOUND:] synonym: "2-(3,4-Dihydroxyphenyl)ethylamine" RELATED [KEGG_COMPOUND] synonym: "2-(3,4-dihydroxyphenyl)ethylamine" RELATED [ChEBI] synonym: "2-(3,4-dihydroxyphenyl)ethylamine" RELATED [ChEBI:] synonym: "3,4-Dihydroxyphenethylamine" RELATED [KEGG_COMPOUND] synonym: "3,4-Dihydroxyphenethylamine" RELATED [KEGG COMPOUND:] synonym: "3-Hydroxytyramine" RELATED [ChemIDplus] synonym: "3-Hydroxytyramine" RELATED [ChemIDplus:] synonym: "4-(2-Aminoethyl)-1,2-benzenediol" RELATED [KEGG_COMPOUND] synonym: "4-(2-Aminoethyl)-1,2-benzenediol" RELATED [KEGG COMPOUND:] synonym: "4-(2-aminoethyl)-1,2-benzenediol" RELATED [ChEBI] synonym: "4-(2-aminoethyl)-1,2-benzenediol" RELATED [ChEBI:] synonym: "4-(2-Aminoethyl)benzene-1,2-diol" RELATED [KEGG_COMPOUND] synonym: "4-(2-Aminoethyl)benzene-1,2-diol" RELATED [KEGG COMPOUND:] synonym: "4-(2-aminoethyl)benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC] synonym: "4-(2-aminoethyl)benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC:] synonym: "4-(2-aminoethyl)catechol" RELATED [ChemIDplus:] synonym: "4-(2-aminoethyl)catechol" RELATED [ChemIDplus] synonym: "4-(2-aminoethyl)pyrocatechol" RELATED [ChemIDplus] synonym: "4-(2-aminoethyl)pyrocatechol" RELATED [ChemIDplus:] synonym: "C8H11NO2" RELATED FORMULA [KEGG COMPOUND:] synonym: "Deoxyepinephrine" RELATED [DrugBank:] synonym: "Deoxyepinephrine" RELATED [DrugBank] synonym: "dopamina" RELATED INN [ChemIDplus:] synonym: "dopamina" RELATED INN [ChemIDplus] synonym: "Dopamine" EXACT [KEGG_COMPOUND] synonym: "Dopamine" EXACT [KEGG COMPOUND:] synonym: "dopamine" RELATED INN [ChEBI:] synonym: "dopamine" RELATED INN [ChEBI] synonym: "dopaminum" RELATED INN [ChemIDplus] synonym: "dopaminum" RELATED INN [ChemIDplus:] synonym: "Hydroxytyramin" RELATED [DrugBank:] synonym: "Hydroxytyramin" RELATED [DrugBank] synonym: "InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2" RELATED InChI [ChEBI:] synonym: "InChIKey=VYFYYTLLBUKUHU-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "NCCc1ccc(O)c(O)c1" RELATED SMILES [ChEBI:] xref: CAS:51-61-6 {source="ChemIDplus"} xref: Drug_Central:947 {source="DrugCentral"} xref: DrugBank:DB00988 xref: HMDB:HMDB0000073 xref: KEGG:C03758 xref: KEGG:D07870 xref: KNApSAcK:C00001408 xref: LINCS:LSM-4630 xref: MetaCyc:DOPAMINE xref: PMID:10629745 {source="Europe PMC"} xref: PMID:11149432 {source="Europe PMC"} xref: PMID:9422813 {source="Europe PMC"} xref: Reaxys:1072822 {source="Reaxys"} xref: Wikipedia:Dopamine is_a: CHEBI:33567 ! catecholamine relationship: is_conjugate_base_of CHEBI:59905 ! dopaminium(1+) relationship: RO:0000087 CHEBI:35522 ! has role beta-adrenergic agonist relationship: RO:0000087 CHEBI:35524 ! has role sympathomimetic agent relationship: RO:0000087 CHEBI:38147 ! has role cardiotonic drug relationship: RO:0000087 CHEBI:48560 ! has role dopaminergic agent relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VYFYYTLLBUKUHU-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "153.17840" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "153.07898" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:18248 name: iron atom namespace: chebi_ontology alt_id: CHEBI:13322 alt_id: CHEBI:24872 alt_id: CHEBI:5974 def: "An iron group element atom that has atomic number 26." [] subset: 3_STAR synonym: "26Fe" RELATED [IUPAC] synonym: "Eisen" RELATED [ChEBI] synonym: "Fe" RELATED [UniProt] synonym: "Fe" RELATED [IUPAC] synonym: "fer" RELATED [ChEBI] synonym: "ferrum" RELATED [IUPAC] synonym: "hierro" RELATED [ChEBI] synonym: "Iron" RELATED [KEGG_COMPOUND] synonym: "iron" EXACT IUPAC_NAME [IUPAC] synonym: "iron" RELATED [ChEBI] xref: CAS:7439-89-6 {source="ChemIDplus"} xref: CAS:7439-89-6 {source="NIST Chemistry WebBook"} xref: CAS:7439-89-6 {source="KEGG COMPOUND"} xref: DrugBank:DB01592 xref: HMDB:HMDB0015531 xref: KEGG:C00023 xref: Reaxys:4122945 {source="Reaxys"} xref: WebElements:Fe is_a: CHEBI:33356 ! iron group element atom relationship: RO:0000087 CHEBI:27027 ! has role micronutrient relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Fe" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Fe" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XEEYBQQBJWHFJM-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "55.84500" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "55.93494" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Fe]" xsd:string [Term] id: CHEBI:18282 name: nucleobase namespace: chebi_ontology alt_id: CHEBI:13873 alt_id: CHEBI:25598 alt_id: CHEBI:2995 def: "That part of DNA or RNA that may be involved in pairing." [] subset: 3_STAR synonym: "Base" RELATED [KEGG_COMPOUND] synonym: "nucleobases" RELATED [ChEBI] xref: KEGG:C00701 xref: Wikipedia:Nucleobase is_a: CHEBI:38101 ! organonitrogen heterocyclic compound [Term] id: CHEBI:18295 name: histamine namespace: chebi_ontology alt_id: CHEBI:14401 alt_id: CHEBI:24596 alt_id: CHEBI:43187 alt_id: CHEBI:817 def: "A member of the class of imidazoles that is 1H-imidazole substituted at position C-4 by a 2-aminoethyl group." [] def: "An aralkylamine that has formula C5H9N3." [ANON:ANON] subset: 3_STAR synonym: "1H-Imidazole-4-ethanamine" RELATED [KEGG COMPOUND:] synonym: "1H-Imidazole-4-ethanamine" RELATED [KEGG_COMPOUND] synonym: "2-(1H-imidazol-4-yl)ethanamine" EXACT IUPAC_NAME [IUPAC:] synonym: "2-(1H-imidazol-4-yl)ethanamine" EXACT IUPAC_NAME [IUPAC] synonym: "2-(4-Imidazolyl)ethylamine" RELATED [KEGG COMPOUND:] synonym: "2-(4-Imidazolyl)ethylamine" RELATED [KEGG_COMPOUND] synonym: "C5H9N3" RELATED FORMULA [KEGG COMPOUND:] synonym: "HISTAMINE" EXACT [PDBeChem:] synonym: "HISTAMINE" EXACT [PDBeChem] synonym: "Histamine" EXACT [KEGG COMPOUND:] synonym: "Histamine" EXACT [KEGG_COMPOUND] synonym: "InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)" RELATED InChI [ChEBI:] synonym: "InChIKey=NTYJJOPFIAHURM-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "NCCc1c[nH]cn1" RELATED SMILES [ChEBI:] xref: Beilstein:2012 {source="Beilstein"} xref: CAS:51-45-6 {source="NIST Chemistry WebBook"} xref: CAS:51-45-6 {source="ChemIDplus"} xref: CAS:51-45-6 {source="KEGG COMPOUND"} xref: Drug_Central:1375 {source="DrugCentral"} xref: Gmelin:2968 {source="Gmelin"} xref: HMDB:HMDB0000870 xref: KEGG:C00388 xref: KEGG:D08040 xref: KNApSAcK:C00001414 xref: MetaCyc:HISTAMINE xref: PDBeChem:HSM xref: PMID:16399866 {source="Europe PMC"} xref: PMID:19547708 {source="Europe PMC"} xref: PMID:19843401 {source="Europe PMC"} xref: PMID:22770225 {source="Europe PMC"} xref: PMID:24101735 {source="Europe PMC"} xref: Reaxys:2012 {source="Reaxys"} xref: Wikipedia:Histamine is_a: CHEBI:24780 ! imidazoles is_a: CHEBI:64365 ! aralkylamino compound relationship: is_conjugate_base_of CHEBI:58432 ! histaminium relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H9N3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NTYJJOPFIAHURM-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "111.14518" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "111.07965" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCc1c[nH]cn1" xsd:string [Term] id: CHEBI:18310 name: alkane namespace: chebi_ontology alt_id: CHEBI:13435 alt_id: CHEBI:22317 alt_id: CHEBI:2576 def: "An acyclic branched or unbranched hydrocarbon having the general formula CnH2n+2, and therefore consisting entirely of hydrogen atoms and saturated carbon atoms." [] subset: 3_STAR synonym: "alcane" RELATED [IUPAC] synonym: "alcanes" RELATED [IUPAC] synonym: "alcano" RELATED [IUPAC] synonym: "alcanos" RELATED [IUPAC] synonym: "Alkan" RELATED [ChEBI] synonym: "Alkane" EXACT [KEGG_COMPOUND] synonym: "alkane" EXACT IUPAC_NAME [IUPAC] synonym: "alkanes" EXACT IUPAC_NAME [IUPAC] synonym: "an alkane" RELATED [UniProt] synonym: "RH" RELATED [KEGG_COMPOUND] xref: KEGG:C01371 is_a: CHEBI:24632 ! hydrocarbon is_a: CHEBI:33653 ! aliphatic compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "15.035" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.02348" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[*]" xsd:string [Term] id: CHEBI:18357 name: (R)-noradrenaline namespace: chebi_ontology alt_id: CHEBI:1 alt_id: CHEBI:14668 alt_id: CHEBI:25592 alt_id: CHEBI:258884 alt_id: CHEBI:43725 def: "The R-enantiomer of noradrenaline." [] subset: 3_STAR synonym: "(-)-arterenol" RELATED [ChemIDplus] synonym: "(-)-noradrenaline" RELATED [IUPHAR] synonym: "(-)-norepinephrine" RELATED [ChemIDplus] synonym: "(R)-(-)-norepinephrine" RELATED [ChemIDplus] synonym: "(R)-4-(2-amino-1-hydroxyethyl)-1,2-benzenediol" RELATED [ChemIDplus] synonym: "(R)-norepinephrine" RELATED [ChemIDplus] synonym: "4-[(1R)-2-Amino-1-hydroxyethyl]-1,2-benzenediol" RELATED [KEGG_COMPOUND] synonym: "4-[(1R)-2-amino-1-hydroxyethyl]benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC] synonym: "Arterenol" RELATED [KEGG_COMPOUND] synonym: "L-Noradrenaline" RELATED [KEGG_COMPOUND] synonym: "L-NOREPINEPHRINE" RELATED [PDBeChem] synonym: "Noradrenaline" RELATED [KEGG_COMPOUND] synonym: "norepinefrina" RELATED INN [ChEBI] synonym: "Norepinephrine" RELATED [KEGG_COMPOUND] synonym: "norepinephrine" RELATED INN [ChemIDplus] synonym: "norepinephrine" RELATED INN [WHO_MedNet] synonym: "norepinephrinum" RELATED INN [ChEBI] xref: Beilstein:2804840 {source="Beilstein"} xref: Beilstein:4231961 {source="ChemIDplus"} xref: CAS:51-41-2 {source="ChemIDplus"} xref: CAS:51-41-2 {source="KEGG COMPOUND"} xref: Drug_Central:1960 {source="DrugCentral"} xref: DrugBank:DB00368 xref: HMDB:HMDB0000216 xref: KEGG:C00547 xref: KEGG:D00076 xref: KNApSAcK:C00001424 xref: PDBeChem:LNR xref: Reaxys:2804840 {source="Reaxys"} xref: Wikipedia:Norepinephrine is_a: CHEBI:33569 ! noradrenaline relationship: is_conjugate_base_of CHEBI:72587 ! (R)-noradrenaline(1+) relationship: is_enantiomer_of CHEBI:33571 ! (S)-noradrenaline relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:35524 ! has role sympathomimetic agent relationship: RO:0000087 CHEBI:35569 ! has role alpha-adrenergic agonist relationship: RO:0000087 CHEBI:50514 ! has role vasoconstrictor agent relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2/t8-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-QMMMGPOBSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "169.17780" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "169.07389" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC[C@H](O)c1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:18367 name: phosphate(3-) namespace: chebi_ontology alt_id: CHEBI:14791 alt_id: CHEBI:45024 alt_id: CHEBI:7793 def: "A phosphate ion that is the conjugate base of hydrogenphosphate." [] subset: 3_STAR synonym: "[PO4](3-)" RELATED [IUPAC] synonym: "Orthophosphate" RELATED [KEGG_COMPOUND] synonym: "Phosphate" RELATED [KEGG_COMPOUND] synonym: "phosphate" EXACT IUPAC_NAME [IUPAC] synonym: "PHOSPHATE ION" RELATED [PDBeChem] synonym: "PO4(3-)" RELATED [IUPAC] synonym: "tetraoxidophosphate(3-)" EXACT IUPAC_NAME [IUPAC] synonym: "tetraoxophosphate(3-)" EXACT IUPAC_NAME [IUPAC] synonym: "tetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:3903772 {source="Beilstein"} xref: CAS:14265-44-2 {source="KEGG COMPOUND"} xref: CAS:14265-44-2 {source="ChemIDplus"} xref: Gmelin:1997 {source="Gmelin"} xref: KEGG:C00009 xref: PDBeChem:PO4 {source="ChEBI"} xref: Reaxys:3903772 {source="Reaxys"} is_a: CHEBI:35780 ! phosphate ion is_a: CHEBI:79387 ! trivalent inorganic anion relationship: is_conjugate_base_of CHEBI:43474 ! hydrogenphosphate property_value: http://purl.obolibrary.org/obo/chebi/charge "-3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O4P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-K" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "94.97136" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "94.95507" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]P([O-])([O-])=O" xsd:string [Term] id: CHEBI:18421 name: superoxide namespace: chebi_ontology alt_id: CHEBI:15143 alt_id: CHEBI:26839 alt_id: CHEBI:7710 subset: 3_STAR synonym: "(O2)(.-)" RELATED [IUPAC] synonym: "Dioxid(1-)" RELATED [ChEBI] synonym: "dioxidanidyl" EXACT IUPAC_NAME [IUPAC] synonym: "dioxide(.1-)" EXACT IUPAC_NAME [IUPAC] synonym: "dioxide(1-)" RELATED [IUPAC] synonym: "hiperoxido" RELATED [ChEBI] synonym: "Hyperoxid" RELATED [ChEBI] synonym: "hyperoxide" RELATED [IUPAC] synonym: "O2(-)" RELATED [IUPAC] synonym: "O2(.-)" RELATED [IUPAC] synonym: "O2-" RELATED [KEGG_COMPOUND] synonym: "O2.-" RELATED [KEGG_COMPOUND] synonym: "superoxide" EXACT [IUPAC] synonym: "superoxide" EXACT [UniProt] synonym: "Superoxide anion" RELATED [KEGG_COMPOUND] synonym: "superoxide anion radical" RELATED [ChemIDplus] synonym: "superoxide radical" RELATED [ChEBI] synonym: "superoxide radical anion" RELATED [ChEBI] synonym: "superoxido" RELATED [ChEBI] synonym: "superoxyde" RELATED [ChEBI] xref: CAS:11062-77-4 {source="ChemIDplus"} xref: CAS:11062-77-4 {source="NIST Chemistry WebBook"} xref: Chemspider:4514331 xref: FooDB:FDB022880 xref: Gmelin:487 {source="Gmelin"} xref: HMDB:HMDB0002168 xref: KEGG:C00704 xref: MetaCyc:SUPER-OXIDE xref: PDBeChem:2FK xref: PMID:10440226 {source="Europe PMC"} xref: PMID:10523323 {source="Europe PMC"} xref: PMID:10588368 {source="Europe PMC"} xref: PMID:11008114 {source="Europe PMC"} xref: PMID:11333112 {source="Europe PMC"} xref: PMID:11485972 {source="Europe PMC"} xref: PMID:12097818 {source="Europe PMC"} xref: PMID:12137408 {source="Europe PMC"} xref: PMID:12598407 {source="Europe PMC"} xref: PMID:14529453 {source="Europe PMC"} xref: PMID:14703794 {source="Europe PMC"} xref: PMID:14726604 {source="Europe PMC"} xref: PMID:15586010 {source="Europe PMC"} xref: PMID:15807660 {source="Europe PMC"} xref: PMID:15952898 {source="Europe PMC"} xref: PMID:1671684 {source="Europe PMC"} xref: PMID:16771675 {source="Europe PMC"} xref: PMID:16814528 {source="Europe PMC"} xref: PMID:17052238 {source="Europe PMC"} xref: PMID:17303648 {source="Europe PMC"} xref: PMID:17531522 {source="Europe PMC"} xref: PMID:18519744 {source="Europe PMC"} xref: PMID:18827931 {source="Europe PMC"} xref: PMID:19273321 {source="Europe PMC"} xref: PMID:19482633 {source="Europe PMC"} xref: PMID:19628033 {source="Europe PMC"} xref: PMID:19857607 {source="Europe PMC"} xref: PMID:19914407 {source="Europe PMC"} xref: PMID:20868230 {source="Europe PMC"} xref: PMID:21297912 {source="Europe PMC"} xref: PMID:21434856 {source="Europe PMC"} xref: PMID:21473702 {source="Europe PMC"} xref: PMID:2160451 {source="Europe PMC"} xref: PMID:217531 {source="Europe PMC"} xref: PMID:22198225 {source="Europe PMC"} xref: PMID:22247596 {source="Europe PMC"} xref: PMID:22521482 {source="Europe PMC"} xref: PMID:22729857 {source="Europe PMC"} xref: PMID:22759590 {source="Europe PMC"} xref: PMID:23542447 {source="Europe PMC"} xref: PMID:23660153 {source="Europe PMC"} xref: PMID:23668959 {source="Europe PMC"} xref: PMID:24567847 {source="Europe PMC"} xref: PMID:24862271 {source="Europe PMC"} xref: PMID:2552230 {source="Europe PMC"} xref: PMID:26047895 {source="Europe PMC"} xref: PMID:26475962 {source="Europe PMC"} xref: PMID:26875845 {source="Europe PMC"} xref: PMID:27066025 {source="Europe PMC"} xref: PMID:27066179 {source="Europe PMC"} xref: PMID:27085844 {source="Europe PMC"} xref: PMID:27357008 {source="Europe PMC"} xref: PMID:27590268 {source="Europe PMC"} xref: PMID:27965593 {source="Europe PMC"} xref: PMID:28341974 {source="Europe PMC"} xref: PMID:28599858 {source="Europe PMC"} xref: PMID:28825637 {source="Europe PMC"} xref: PMID:28842347 {source="Europe PMC"} xref: PMID:28842493 {source="Europe PMC"} xref: PMID:29259135 {source="Europe PMC"} xref: PMID:29385710 {source="Europe PMC"} xref: PMID:29669742 {source="Europe PMC"} xref: PMID:29896077 {source="Europe PMC"} xref: PMID:30307099 {source="Europe PMC"} xref: PMID:30500433 {source="Europe PMC"} xref: PMID:30573187 {source="Europe PMC"} xref: PMID:30886134 {source="Europe PMC"} xref: PMID:31254369 {source="Europe PMC"} xref: PMID:31484901 {source="Europe PMC"} xref: PMID:32144830 {source="Europe PMC"} xref: PMID:32220789 {source="Europe PMC"} xref: PMID:32478084 {source="Europe PMC"} xref: PMID:32667121 {source="Europe PMC"} xref: PMID:32760286 {source="Europe PMC"} xref: PMID:32927603 {source="Europe PMC"} xref: PMID:33248264 {source="Europe PMC"} xref: PMID:33716500 {source="Europe PMC"} xref: PMID:33805942 {source="Europe PMC"} xref: PMID:34635271 {source="Europe PMC"} xref: PMID:7998676 {source="Europe PMC"} xref: PMID:8577306 {source="Europe PMC"} xref: PMID:8720916 {source="Europe PMC"} xref: PMID:8959373 {source="Europe PMC"} xref: PMID:9337481 {source="Europe PMC"} xref: Wikipedia:Superoxide is_a: CHEBI:33263 ! diatomic oxygen is_a: CHEBI:36876 ! inorganic radical anion is_a: CHEBI:61073 ! oxygen radical relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/HO2/c1-2/h1H/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OUUQCZGPVNCOIJ-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "31.999" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O][O-]" xsd:string [Term] id: CHEBI:20664 name: 5beta-cholane namespace: chebi_ontology subset: 3_STAR synonym: "5beta-cholane" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:2048472 {source="Beilstein"} is_a: CHEBI:35519 ! cholane property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H42" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18+,19+,20-,21+,22+,23+,24-/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QSHQKIURKJITMZ-OBUPQJQESA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "330.59028" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "330.32865" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC" xsd:string [Term] id: CHEBI:22160 name: acetamides namespace: chebi_ontology def: "Compounds with the general formula RNHC(=O)CH3." [] subset: 3_STAR is_a: CHEBI:37622 ! carboxamide [Term] id: CHEBI:22221 name: acyl group namespace: chebi_ontology def: "An organic group formed by removing one or more hydroxy groups from an oxoacid that has the general structure RkE(=O)l(OH)m (l =/= 0). Although the term is almost always applied to organic compounds, with carboxylic acid as the oxoacid, acyl groups can in principle be derived from other types of acids such as sulfonic acids or phosphonic acids." [] subset: 3_STAR synonym: "acyl group" EXACT [IUPAC] synonym: "acyl groups" RELATED [ChEBI] synonym: "alkanoyl" EXACT IUPAC_NAME [IUPAC] synonym: "alkanoyl group" RELATED [ChEBI] synonym: "groupe acyle" RELATED [IUPAC] is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:22313 name: alkaline earth metal atom namespace: chebi_ontology subset: 3_STAR synonym: "alkaline earth metal" RELATED [ChEBI] synonym: "alkaline earth metals" EXACT IUPAC_NAME [IUPAC] synonym: "alkaline-earth metal" RELATED [ChEBI] synonym: "alkaline-earth metals" RELATED [ChEBI] synonym: "Erdalkalimetall" RELATED [ChEBI] synonym: "Erdalkalimetalle" RELATED [ChEBI] synonym: "metal alcalino-terreux" RELATED [ChEBI] synonym: "metal alcalinoterreo" RELATED [ChEBI] synonym: "metales alcalinoterreos" RELATED [ChEBI] synonym: "metaux alcalino-terreux" RELATED [ChEBI] is_a: CHEBI:33318 ! main group element atom is_a: CHEBI:33521 ! metal atom is_a: CHEBI:33559 ! s-block element atom [Term] id: CHEBI:22314 name: alkali metal atom namespace: chebi_ontology subset: 3_STAR synonym: "alkali metal" RELATED [ChEBI] synonym: "alkali metals" EXACT IUPAC_NAME [IUPAC] synonym: "Alkalimetall" RELATED [ChEBI] synonym: "Alkalimetalle" RELATED [ChEBI] synonym: "metal alcalin" RELATED [ChEBI] synonym: "metal alcalino" RELATED [ChEBI] synonym: "metales alcalinos" RELATED [ChEBI] synonym: "metaux alcalins" RELATED [ChEBI] is_a: CHEBI:33318 ! main group element atom is_a: CHEBI:33521 ! metal atom is_a: CHEBI:33559 ! s-block element atom [Term] id: CHEBI:22315 name: alkaloid namespace: chebi_ontology def: "Any of the naturally occurring, basic nitrogen compounds (mostly heterocyclic) occurring mostly in the plant kingdom, but also found in bacteria, fungi, and animals. By extension, certain neutral compounds biogenetically related to basic alkaloids are also classed as alkaloids. Amino acids, peptides, proteins, nucleotides, nucleic acids, amino sugars and antibiotics are not normally regarded as alkaloids. Compounds in which the nitrogen is exocyclic (dopamine, mescaline, serotonin, etc.) are usually classed as amines rather than alkaloids." [] subset: 3_STAR synonym: "alcaloide" RELATED [ChEBI] synonym: "alcaloides" RELATED [ChEBI] synonym: "Alkaloid" EXACT [ChEBI] synonym: "Alkaloide" RELATED [ChEBI] synonym: "alkaloids" EXACT IUPAC_NAME [IUPAC] xref: Wikipedia:Alkaloid is_a: CHEBI:35352 ! organonitrogen compound relationship: RO:0000087 CHEBI:25212 ! has role metabolite [Term] id: CHEBI:22506 name: aminoglycan namespace: chebi_ontology subset: 3_STAR synonym: "aminoglycans" RELATED [ChEBI] is_a: CHEBI:35352 ! organonitrogen compound is_a: CHEBI:65212 ! polysaccharide derivative [Term] id: CHEBI:22563 name: anion namespace: chebi_ontology def: "A monoatomic or polyatomic species having one or more elementary charges of the electron." [] subset: 3_STAR synonym: "Anion" EXACT [ChEBI] synonym: "anion" EXACT IUPAC_NAME [IUPAC] synonym: "anion" EXACT [ChEBI] synonym: "Anionen" RELATED [ChEBI] synonym: "aniones" RELATED [ChEBI] synonym: "anions" RELATED [IUPAC] is_a: CHEBI:24870 ! ion [Term] id: CHEBI:22586 name: antioxidant namespace: chebi_ontology def: "A substance that opposes oxidation or inhibits reactions brought about by dioxygen or peroxides." [] subset: 3_STAR synonym: "antioxidants" RELATED [ChEBI] synonym: "antioxydant" RELATED [ChEBI] synonym: "antoxidant" RELATED [ChEBI] is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:22695 name: base namespace: chebi_ontology def: "A molecular entity having an available pair of electrons capable of forming a covalent bond with a hydron (Bronsted base) or with the vacant orbital of some other molecular entity (Lewis base)." [] subset: 3_STAR synonym: "Base" EXACT [ChEBI] synonym: "base" EXACT [ChEBI] synonym: "base" EXACT IUPAC_NAME [IUPAC] synonym: "Base1" RELATED [KEGG_COMPOUND] synonym: "Base2" RELATED [KEGG_COMPOUND] synonym: "Basen" RELATED [ChEBI] synonym: "bases" RELATED [ChEBI] synonym: "Nucleobase" RELATED [KEGG_COMPOUND] xref: KEGG:C00701 is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:22728 name: benzopyrrole namespace: chebi_ontology subset: 3_STAR synonym: "benzopyrroles" RELATED [ChEBI:] synonym: "benzopyrroles" RELATED [ChEBI] is_a: CHEBI:27171 ! organic heterobicyclic compound is_a: CHEBI:38101 ! organonitrogen heterocyclic compound is_a: CHEBI:38180 ! polycyclic heteroarene [Term] id: CHEBI:22868 name: bile salt namespace: chebi_ontology def: "A sodium salt of the conjugate of any bile acid with either glycine or taurine." [] subset: 3_STAR synonym: "Bile acid" RELATED [KEGG_COMPOUND] synonym: "bile salts" RELATED [ChEBI] xref: KEGG:C01558 is_a: CHEBI:36078 ! cholanoid is_a: CHEBI:38700 ! organic sodium salt [Term] id: CHEBI:22984 name: calcium atom namespace: chebi_ontology subset: 3_STAR synonym: "20Ca" RELATED [IUPAC] synonym: "Ca" RELATED [IUPAC] synonym: "Ca" RELATED [UniProt] synonym: "calcio" RELATED [ChEBI] synonym: "Calcium" RELATED [KEGG_COMPOUND] synonym: "calcium" EXACT IUPAC_NAME [IUPAC] synonym: "calcium" RELATED [ChEBI] synonym: "Kalzium" RELATED [ChEBI] xref: CAS:7440-70-2 {source="ChemIDplus"} xref: DrugBank:DB01373 xref: KEGG:C00076 xref: WebElements:Ca is_a: CHEBI:22313 ! alkaline earth metal atom relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Ca" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OYPRJOBELJOOCE-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "40.07800" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Ca]" xsd:string [Term] id: CHEBI:22985 name: calcium molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "calcium compounds" RELATED [ChEBI] synonym: "calcium molecular entities" RELATED [ChEBI] synonym: "calcium molecular entity" EXACT [ChEBI] is_a: CHEBI:33299 ! alkaline earth molecular entity relationship: has_part CHEBI:22984 ! calcium atom [Term] id: CHEBI:23004 name: carbamoyl group namespace: chebi_ontology def: "The univalent carboacyl group formed by loss of -OH from the carboxy group of carbamic acid." [] subset: 3_STAR synonym: "-C(O)NH2" RELATED [ChEBI] synonym: "-CONH2" RELATED [IUPAC] synonym: "aminocarbonyl" RELATED [IUPAC] synonym: "carbamoyl" EXACT IUPAC_NAME [IUPAC] synonym: "carbamyl" RELATED [ChEBI] synonym: "carbamyl group" RELATED [ChEBI] synonym: "carboxamide" RELATED [IUPAC] xref: PMID:24168430 {source="Europe PMC"} is_a: CHEBI:27207 ! univalent carboacyl group relationship: is_substituent_group_from CHEBI:28616 ! carbamic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2NO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.03272" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.01364" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(N)=O" xsd:string [Term] id: CHEBI:23019 name: carbonyl group namespace: chebi_ontology subset: 3_STAR synonym: ">C=O" RELATED [IUPAC] synonym: "carbonyl" EXACT IUPAC_NAME [IUPAC] synonym: "carbonyl group" EXACT [ChEBI] synonym: "carbonyl group" EXACT [UniProt] is_a: CHEBI:51422 ! organodiyl group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "28.01010" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "27.99491" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=C(*)*" xsd:string [Term] id: CHEBI:23357 name: cofactor namespace: chebi_ontology def: "An organic molecule or ion (usually a metal ion) that is required by an enzyme for its activity. It may be attached either loosely (coenzyme) or tightly (prosthetic group)." [] subset: 3_STAR synonym: "cofactor" EXACT [IUPAC] synonym: "cofactors" EXACT IUPAC_NAME [IUPAC] xref: Wikipedia:Cofactor_(biochemistry) is_a: CHEBI:52206 ! biochemical role [Term] id: CHEBI:23367 name: molecular entity namespace: chebi_ontology def: "Any constitutionally or isotopically distinct atom, molecule, ion, ion pair, radical, radical ion, complex, conformer etc., identifiable as a separately distinguishable entity." [ANON:ANON] subset: 3_STAR synonym: "entidad molecular" RELATED [IUPAC:] synonym: "entidad molecular" RELATED [IUPAC] synonym: "entidades moleculares" RELATED [IUPAC:] synonym: "entidades moleculares" RELATED [IUPAC] synonym: "entite moleculaire" RELATED [IUPAC] synonym: "entite moleculaire" RELATED [IUPAC:] synonym: "molecular entities" RELATED [IUPAC:] synonym: "molecular entities" RELATED [IUPAC] synonym: "molecular entity" EXACT IUPAC_NAME [IUPAC:] synonym: "molecular entity" EXACT IUPAC_NAME [IUPAC] synonym: "molekulare Entitaet" RELATED [ChEBI] synonym: "molekulare Entitaet" RELATED [ChEBI:] is_a: CHEBI:24431 ! chemical entity [Term] id: CHEBI:23449 name: cyclic peptide namespace: chebi_ontology subset: 3_STAR synonym: "cyclic peptides" RELATED [ChEBI] synonym: "Cyclopeptid" RELATED [ChEBI] synonym: "peptide cyclique" RELATED [IUPAC] synonym: "peptido ciclico" RELATED [IUPAC] synonym: "Zyklopeptid" RELATED [ChEBI] is_a: CHEBI:16670 ! peptide [Term] id: CHEBI:23677 name: diazole namespace: chebi_ontology def: "An azole that is either one of a pair of heterocyclic organic compounds comprising three carbon atoms and two nitrogen atoms arranged in a ring." [] def: "Either one of a pair of heterocyclic organic compounds comprising three carbon atoms and two nitrogen atoms arranged in a ring." [ANON:ANON] subset: 3_STAR synonym: "diazoles" RELATED [ChEBI] synonym: "diazoles" RELATED [ChEBI:] is_a: CHEBI:68452 ! azole [Term] id: CHEBI:23888 name: drug namespace: chebi_ontology def: "Any substance which when absorbed into a living organism may modify one or more of its functions. The term is generally accepted for a substance taken for a therapeutic purpose, but is also commonly used for abused substances." [] subset: 3_STAR synonym: "drugs" RELATED [ChEBI] synonym: "medicine" RELATED [ChEBI] is_a: CHEBI:52217 ! pharmaceutical [Term] id: CHEBI:23897 name: ecdysteroid namespace: chebi_ontology alt_id: CHEBI:23896 def: "A class of steroids that include insect moulting and sex hormones." [] subset: 3_STAR synonym: "ecdysteroid hormones" RELATED [ChEBI] synonym: "ecdysteroids" RELATED [ChEBI] xref: Wikipedia:Ecdysteroid is_a: CHEBI:35341 ! steroid relationship: RO:0000087 CHEBI:24621 ! has role hormone [Term] id: CHEBI:23906 name: monoatomic cation namespace: chebi_ontology subset: 3_STAR synonym: "monoatomic cations" RELATED [ChEBI] is_a: CHEBI:24867 ! monoatomic ion is_a: CHEBI:36916 ! cation [Term] id: CHEBI:23924 name: enzyme inhibitor namespace: chebi_ontology def: "A compound or agent that combines with an enzyme in such a manner as to prevent the normal substrate-enzyme combination and the catalytic reaction." [] subset: 3_STAR synonym: "enzyme inhibitor" EXACT IUPAC_NAME [IUPAC] synonym: "enzyme inhibitors" RELATED [ChEBI] synonym: "inhibidor enzimatico" RELATED [ChEBI] synonym: "inhibidores enzimaticos" RELATED [ChEBI] synonym: "inhibiteur enzymatique" RELATED [ChEBI] synonym: "inhibiteurs enzymatiques" RELATED [ChEBI] is_a: CHEBI:35222 ! inhibitor is_a: CHEBI:52206 ! biochemical role [Term] id: CHEBI:23965 name: estradiol namespace: chebi_ontology alt_id: CHEBI:42364 def: "A 3-hydroxy steroid that is estra-1,3,5(10)-triene substituted by hydroxy groups at positions 3 and 17." [] subset: 3_STAR synonym: "estra-1,3,5(10)-triene-3,17-diol" EXACT IUPAC_NAME [IUPAC] synonym: "oestradiol" RELATED [ChEBI] xref: PMID:10696569 {source="Europe PMC"} xref: PMID:24084694 {source="Europe PMC"} xref: Wikipedia:Estradiol is_a: CHEBI:177917 ! phenolic steroid is_a: CHEBI:36838 ! 17-hydroxy steroid relationship: has_parent_hydride CHEBI:23966 ! estrane relationship: RO:0000087 CHEBI:50114 ! has role estrogen relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H24O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H24O2/c1-18-9-8-14-13-5-3-12(19)10-11(13)2-4-15(14)16(18)6-7-17(18)20/h3,5,10,14-17,19-20H,2,4,6-9H2,1H3/t14-,15-,16+,17?,18+/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VOXZDWNPVJITMN-WKUFJEKOSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "272.38196" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "272.17763" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]12CC[C@]3(C)C(O)CC[C@@]3([H])[C@]1([H])CCc1cc(O)ccc21" xsd:string [Term] id: CHEBI:23966 name: estrane namespace: chebi_ontology subset: 3_STAR synonym: "estrane" EXACT IUPAC_NAME [IUPAC] synonym: "Oestran" RELATED [ChEBI] synonym: "oestrane" RELATED [JCBN] xref: Beilstein:3125721 {source="Beilstein"} xref: LIPID_MAPS_instance:LMST02010000 {source="LIPID MAPS"} is_a: CHEBI:35508 ! steroid fundamental parent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H30" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C18H30/c1-18-11-4-7-17(18)16-9-8-13-5-2-3-6-14(13)15(16)10-12-18/h13-17H,2-12H2,1H3/t13?,14-,15+,16+,17-,18-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "GRXPVLPQNMUNNX-MHJRRCNVSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "246.43080" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "246.23475" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]12CCCCC1CC[C@]1([H])[C@]2([H])CC[C@]2(C)CCC[C@@]12[H]" xsd:string [Term] id: CHEBI:24261 name: glucocorticoid namespace: chebi_ontology def: "Glucocorticoids are a class of steroid hormones that regulate a variety of physiological processes, in particular control of the concentration of glucose in blood." [] subset: 3_STAR synonym: "glucocorticoids" RELATED [ChEBI] is_a: CHEBI:36699 ! corticosteroid hormone [Term] id: CHEBI:24318 name: glutamine family amino acid namespace: chebi_ontology def: "An L-alpha-amino acid which is L-glutamic acid or any of the essential amino acids biosynthesised from it (glutamine, proline and arginine). A closed class." [] subset: 3_STAR synonym: "glutamine family amino acids" RELATED [ChEBI] xref: PMID:20716061 {source="Europe PMC"} is_a: CHEBI:15705 ! L-alpha-amino acid is_a: CHEBI:83813 ! proteinogenic amino acid [Term] id: CHEBI:24384 name: glycogens namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:37163 ! glucan [Term] id: CHEBI:24402 name: glycosphingolipid namespace: chebi_ontology alt_id: CHEBI:5498 def: "A glycosphingolipid is a glycolipid that is a carbohydrate-containing derivative of a sphingoid or ceramide. It is understood that the carbohydrate residue is attached by a glycosidic linkage to O-1 of the sphingoid." [] subset: 3_STAR synonym: "glycosphingolipids" RELATED [ChEBI] xref: PMID:18845618 {source="Europe PMC"} xref: PMID:19303901 {source="Europe PMC"} xref: PMID:26954668 {source="Europe PMC"} xref: PMID:26976737 {source="Europe PMC"} xref: PMID:27253729 {source="Europe PMC"} xref: PMID:27325407 {source="Europe PMC"} xref: Wikipedia:Glycosphingolipid is_a: CHEBI:26739 ! sphingolipid is_a: CHEBI:33563 ! glycolipid [Term] id: CHEBI:24431 name: chemical entity namespace: chebi_ontology def: "A chemical entity is a physical entity of interest in chemistry including molecular entities, parts thereof, and chemical substances." [ANON:ANON] subset: 3_STAR synonym: "chemical entity" EXACT [UniProt] is_a: BFO:0000040 ! material entity [Term] id: CHEBI:24432 name: biological role namespace: chebi_ontology def: "A role played by the molecular entity or part thereof within a biological context." [] subset: 3_STAR synonym: "biological function" RELATED [ChEBI] is_a: BFO:0000023 ! role is_a: CHEBI:50906 ! role [Term] id: CHEBI:24433 name: group namespace: chebi_ontology def: "A defined linked collection of atoms or a single atom within a molecular entity." [] subset: 3_STAR synonym: "group" EXACT IUPAC_NAME [IUPAC] synonym: "groupe" RELATED [IUPAC] synonym: "grupo" RELATED [IUPAC] synonym: "grupos" RELATED [IUPAC] synonym: "Gruppe" RELATED [ChEBI] synonym: "Rest" RELATED [ChEBI] is_a: CHEBI:24431 ! chemical entity relationship: has_part CHEBI:33250 ! atom [Term] id: CHEBI:24505 name: heparins namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:35722 ! sulfated glycosaminoglycan is_a: CHEBI:37395 ! mucopolysaccharide [Term] id: CHEBI:24532 name: organic heterocyclic compound namespace: chebi_ontology def: "A cyclic compound having as ring members atoms of carbon and at least of one other element." [ANON:ANON] subset: 3_STAR synonym: "organic heterocycle" RELATED [ChEBI:] synonym: "organic heterocycle" RELATED [ChEBI] synonym: "organic heterocyclic compounds" RELATED [ChEBI] synonym: "organic heterocyclic compounds" RELATED [ChEBI:] is_a: CHEBI:33285 ! heteroorganic entity is_a: CHEBI:33832 ! organic cyclic compound is_a: CHEBI:5686 ! heterocyclic compound [Term] id: CHEBI:24533 name: heterodetic cyclic peptide namespace: chebi_ontology def: "A heterodetic cyclic peptide is a peptide consisting only of amino-acid residues, but in which the linkages forming the ring are not solely peptide bonds; one or more is an isopeptide, disulfide, ester, or other bond." [] subset: 3_STAR synonym: "heterodetic cyclic peptide" EXACT IUPAC_NAME [IUPAC] synonym: "heterodetic cyclic peptides" RELATED [ChEBI] synonym: "peptide cyclique heterodetique" RELATED [IUPAC] synonym: "peptido ciclico heterodetico" RELATED [IUPAC] is_a: CHEBI:23449 ! cyclic peptide [Term] id: CHEBI:24621 name: hormone namespace: chebi_ontology def: "Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds." [] subset: 3_STAR synonym: "endocrine" RELATED [ChEBI] synonym: "hormones" RELATED [ChEBI] is_a: CHEBI:33280 ! molecular messenger is_a: CHEBI:48705 ! agonist [Term] id: CHEBI:24632 name: hydrocarbon namespace: chebi_ontology def: "A compound consisting of carbon and hydrogen only." [] subset: 3_STAR synonym: "hidrocarburo" RELATED [IUPAC] synonym: "hidrocarburos" RELATED [IUPAC] synonym: "hydrocarbon" EXACT IUPAC_NAME [IUPAC] synonym: "hydrocarbons" EXACT IUPAC_NAME [IUPAC] synonym: "hydrocarbure" RELATED [IUPAC] synonym: "Kohlenwasserstoff" RELATED [ChEBI] synonym: "Kohlenwasserstoffe" RELATED [ChEBI] is_a: CHEBI:33245 ! organic fundamental parent [Term] id: CHEBI:24651 name: hydroxides namespace: chebi_ontology def: "Hydroxides are chemical compounds containing a hydroxy group or salts containing hydroxide (OH(-))." [ANON:ANON] subset: 3_STAR is_a: CHEBI:25806 ! oxygen molecular entity is_a: CHEBI:33608 ! hydrogen molecular entity is_a: CHEBI:37577 ! heteroatomic molecular entity relationship: has_part CHEBI:43176 ! hydroxy group [Term] id: CHEBI:24663 name: hydroxy-5beta-cholanic acid namespace: chebi_ontology def: "Any member of the class of 5beta-cholanic acids carrying at least one hydroxy group at unspecified position." [] subset: 3_STAR synonym: "hydroxy-5beta-cholanic acids" RELATED [ChEBI] is_a: CHEBI:33822 ! organic hydroxy compound is_a: CHEBI:36248 ! 5beta-cholanic acids relationship: has_functional_parent CHEBI:36238 ! 5beta-cholanic acid [Term] id: CHEBI:24780 name: imidazoles namespace: chebi_ontology def: "A five-membered organic heterocycle containing two nitrogen atoms at positions 1 and 3, or any of its derivatives; compounds containing an imidazole skeleton." [ANON:ANON] subset: 3_STAR is_a: CHEBI:23677 ! diazole [Term] id: CHEBI:24828 name: indoles namespace: chebi_ontology def: "Any compound containing an indole skeleton." [ANON:ANON] subset: 3_STAR is_a: CHEBI:22728 ! benzopyrrole [Term] id: CHEBI:24833 name: oxoacid namespace: chebi_ontology def: "A compound which contains oxygen, at least one other element, and at least one hydrogen bound to oxygen, and which produces a conjugate base by loss of positive hydrogen ion(s) (hydrons)." [ANON:ANON] subset: 3_STAR synonym: "oxacids" RELATED [ChEBI] synonym: "oxacids" RELATED [ChEBI:] synonym: "oxiacids" RELATED [ChEBI:] synonym: "oxiacids" RELATED [ChEBI] synonym: "oxo acid" RELATED [ChEBI:] synonym: "oxo acid" RELATED [ChEBI] synonym: "oxoacid" EXACT IUPAC_NAME [IUPAC] synonym: "oxoacid" EXACT IUPAC_NAME [IUPAC:] synonym: "oxoacids" EXACT IUPAC_NAME [IUPAC:] synonym: "oxoacids" EXACT IUPAC_NAME [IUPAC] synonym: "oxy-acids" RELATED [ChEBI:] synonym: "oxy-acids" RELATED [ChEBI] synonym: "oxyacids" RELATED [ChEBI] synonym: "oxyacids" RELATED [ChEBI:] is_a: CHEBI:24651 ! hydroxides relationship: RO:0000087 CHEBI:39141 ! has role Bronsted acid [Term] id: CHEBI:24834 name: inorganic anion namespace: chebi_ontology subset: 3_STAR synonym: "inorganic anions" RELATED [ChEBI] is_a: CHEBI:22563 ! anion is_a: CHEBI:36914 ! inorganic ion [Term] id: CHEBI:24835 name: inorganic molecular entity namespace: chebi_ontology def: "A molecular entity that contains no carbon." [] subset: 3_STAR synonym: "anorganische Verbindungen" RELATED [ChEBI] synonym: "inorganic compounds" RELATED [ChEBI] synonym: "inorganic entity" RELATED [ChEBI] synonym: "inorganic molecular entities" RELATED [ChEBI] synonym: "inorganics" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:24836 name: inorganic oxide namespace: chebi_ontology subset: 3_STAR synonym: "inorganic oxides" RELATED [ChEBI] is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:25741 ! oxide [Term] id: CHEBI:24866 name: salt namespace: chebi_ontology def: "A salt is an assembly of cations and anions." [] subset: 3_STAR synonym: "ionic compound" RELATED [ChEBI] synonym: "ionic compounds" RELATED [ChEBI] synonym: "sal" RELATED [ChEBI] synonym: "sales" RELATED [ChEBI] synonym: "salt" EXACT IUPAC_NAME [IUPAC] synonym: "salts" RELATED [ChEBI] synonym: "Salz" RELATED [ChEBI] synonym: "Salze" RELATED [ChEBI] synonym: "sel" RELATED [ChEBI] synonym: "sels" RELATED [ChEBI] is_a: CHEBI:37577 ! heteroatomic molecular entity relationship: has_part CHEBI:22563 ! anion relationship: has_part CHEBI:36916 ! cation [Term] id: CHEBI:24867 name: monoatomic ion namespace: chebi_ontology subset: 3_STAR synonym: "monoatomic ions" RELATED [ChEBI] is_a: CHEBI:24870 ! ion is_a: CHEBI:33238 ! monoatomic entity [Term] id: CHEBI:24868 name: organic salt namespace: chebi_ontology subset: 3_STAR synonym: "organic salts" RELATED [ChEBI] synonym: "organisches Salz" RELATED [ChEBI] is_a: CHEBI:24866 ! salt [Term] id: CHEBI:24870 name: ion namespace: chebi_ontology def: "A molecular entity having a net electric charge." [ANON:ANON] subset: 3_STAR synonym: "Ion" EXACT [ChEBI] synonym: "Ion" EXACT [ChEBI:] synonym: "ion" EXACT IUPAC_NAME [IUPAC:] synonym: "ion" EXACT IUPAC_NAME [IUPAC] synonym: "ion" EXACT [ChEBI] synonym: "ion" EXACT [ChEBI:] synonym: "Ionen" RELATED [ChEBI:] synonym: "Ionen" RELATED [ChEBI] synonym: "iones" RELATED [ChEBI:] synonym: "iones" RELATED [ChEBI] synonym: "ions" RELATED [ChEBI:] synonym: "ions" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:24873 name: iron molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "iron compounds" RELATED [ChEBI] synonym: "iron molecular entities" RELATED [ChEBI] synonym: "iron molecular entity" EXACT [ChEBI] is_a: CHEBI:33744 ! iron group molecular entity relationship: has_part CHEBI:18248 ! iron atom [Term] id: CHEBI:24875 name: iron cation namespace: chebi_ontology subset: 3_STAR synonym: "Fe cation" RELATED [UniProt] synonym: "iron cation" EXACT IUPAC_NAME [IUPAC] synonym: "iron cations" RELATED [ChEBI] is_a: CHEBI:33515 ! transition element cation is_a: CHEBI:82663 ! elemental iron relationship: RO:0000087 CHEBI:23357 ! has role cofactor property_value: http://purl.obolibrary.org/obo/chebi/formula "Fe" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "55.845" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "55.93494" xsd:string [Term] id: CHEBI:24913 name: isoprenoid namespace: chebi_ontology def: "Any lipid formally derived from isoprene (2-methylbuta-1,3-diene), the skeleton of which can generally be discerned in repeated occurrence in the molecule. The skeleton of isoprenoids may differ from strict additivity of isoprene units by loss or shift of a fragment, commonly a methyl group. The class includes both hydrocarbons and oxygenated derivatives." [] subset: 3_STAR synonym: "isoprenoid" EXACT [ChEBI] synonym: "isoprenoids" EXACT IUPAC_NAME [IUPAC] synonym: "isoprenoids" RELATED [ChEBI] xref: LIPID_MAPS_class:LMPR01 {source="LIPID MAPS"} xref: PMID:12769708 {source="Europe PMC"} xref: PMID:19219049 {source="Europe PMC"} is_a: CHEBI:18059 ! lipid [Term] id: CHEBI:24943 name: juvenile hormone namespace: chebi_ontology def: "A family of farnesane sesquiterpenoids that regulate many aspects of insect physiology." [] subset: 3_STAR xref: Wikipedia:Juvenile_hormone is_a: CHEBI:36757 ! farnesane sesquiterpenoid relationship: RO:0000087 CHEBI:24621 ! has role hormone relationship: RO:0000087 CHEBI:75767 ! has role animal metabolite [Term] id: CHEBI:25046 name: linear tetrapyrrole namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:26932 ! tetrapyrrole [Term] id: CHEBI:25179 name: melanins namespace: chebi_ontology alt_id: CHEBI:6727 subset: 1_STAR is_a: CHEBI:26195 ! polyphenol relationship: RO:0000087 CHEBI:26130 ! has role biological pigment [Term] id: CHEBI:25212 name: metabolite namespace: chebi_ontology alt_id: CHEBI:26619 alt_id: CHEBI:35220 def: "Any intermediate or product resulting from metabolism. The term 'metabolite' subsumes the classes commonly known as primary and secondary metabolites." [] subset: 3_STAR synonym: "metabolite" EXACT IUPAC_NAME [IUPAC] synonym: "metabolites" RELATED [ChEBI] synonym: "primary metabolites" RELATED [ChEBI] synonym: "secondary metabolites" RELATED [ChEBI] is_a: CHEBI:52206 ! biochemical role [Term] id: CHEBI:25213 name: metal cation namespace: chebi_ontology subset: 3_STAR synonym: "a metal cation" RELATED [UniProt] synonym: "metal cations" RELATED [ChEBI] is_a: CHEBI:23906 ! monoatomic cation is_a: CHEBI:36915 ! inorganic cation [Term] id: CHEBI:25354 name: mineralocorticoid namespace: chebi_ontology def: "Mineralocorticoids are a class of steroid hormones that regulate water and electrolyte metabolism." [] subset: 3_STAR synonym: "mineralocorticoids" RELATED [ChEBI] is_a: CHEBI:36699 ! corticosteroid hormone [Term] id: CHEBI:25362 name: elemental molecule namespace: chebi_ontology def: "A molecule all atoms of which have the same atomic number." [] subset: 3_STAR synonym: "homoatomic molecule" RELATED [ChEBI] synonym: "homoatomic molecules" RELATED [ChEBI] is_a: CHEBI:25367 ! molecule is_a: CHEBI:33259 ! elemental molecular entity [Term] id: CHEBI:25367 name: molecule namespace: chebi_ontology def: "Any polyatomic entity that is an electrically neutral entity consisting of more than one atom." [] subset: 3_STAR synonym: "molecula" RELATED [IUPAC] synonym: "molecule" EXACT [IUPAC] synonym: "molecules" RELATED [IUPAC] synonym: "Molekuel" RELATED [ChEBI] synonym: "neutral molecular compounds" RELATED [IUPAC] is_a: CHEBI:36357 ! polyatomic entity [Term] id: CHEBI:25375 name: monoamine molecular messenger namespace: chebi_ontology def: "A group of neurotransmitters and neuromodulators that contain one amino group that is connected to an aromatic ring by ethylene group (-CH2-CH2-). Monoamines are derived from the aromatic amino acids phenylalanine, tyrosine, histidine and tryptophan." [] subset: 3_STAR synonym: "monamines" RELATED [ChEBI] synonym: "monoamines" RELATED [ChEBI] is_a: CHEBI:63534 ! monoamine relationship: RO:0000087 CHEBI:33280 ! has role molecular messenger [Term] id: CHEBI:25384 name: monocarboxylic acid namespace: chebi_ontology def: "An oxoacid containing a single carboxy group." [ANON:ANON] subset: 3_STAR synonym: "monocarboxylic acid" EXACT [UniProt:] synonym: "monocarboxylic acids" RELATED [ChEBI] synonym: "monocarboxylic acids" RELATED [ChEBI:] is_a: CHEBI:33575 ! carboxylic acid relationship: is_conjugate_acid_of CHEBI:35757 ! monocarboxylic acid anion [Term] id: CHEBI:25414 name: monoatomic monocation namespace: chebi_ontology subset: 3_STAR synonym: "monoatomic monocations" RELATED [ChEBI] synonym: "monovalent inorganic cations" RELATED [ChEBI] is_a: CHEBI:23906 ! monoatomic cation property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "0.00000" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*+]" xsd:string [Term] id: CHEBI:25512 name: neurotransmitter namespace: chebi_ontology def: "An endogenous compound that is used to transmit information across the synapse between a neuron and another cell." [] subset: 3_STAR synonym: "neurotransmitters" RELATED [ChEBI] xref: Wikipedia:Neurotransmitter is_a: CHEBI:33280 ! molecular messenger [Term] id: CHEBI:25555 name: nitrogen atom namespace: chebi_ontology subset: 3_STAR synonym: "7N" RELATED [IUPAC] synonym: "azote" RELATED [IUPAC] synonym: "N" RELATED [IUPAC] synonym: "nitrogen" EXACT IUPAC_NAME [IUPAC] synonym: "nitrogen" RELATED [ChEBI] synonym: "nitrogeno" RELATED [ChEBI] synonym: "Stickstoff" RELATED [ChEBI] xref: WebElements:N is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33300 ! pnictogen relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "14.007" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "14.00307" xsd:string [Term] id: CHEBI:25585 name: nonmetal atom namespace: chebi_ontology subset: 3_STAR synonym: "Nichtmetall" RELATED [ChEBI] synonym: "Nichtmetalle" RELATED [ChEBI] synonym: "no metal" RELATED [ChEBI] synonym: "no metales" RELATED [ChEBI] synonym: "non-metal" RELATED [ChEBI] synonym: "non-metaux" RELATED [ChEBI] synonym: "nonmetal" EXACT IUPAC_NAME [IUPAC] synonym: "nonmetal" RELATED [ChEBI] synonym: "nonmetals" RELATED [ChEBI] is_a: CHEBI:33250 ! atom [Term] id: CHEBI:25696 name: organic anion namespace: chebi_ontology def: "Any organic ion with a net negative charge." [] subset: 3_STAR synonym: "organic anions" RELATED [ChEBI] is_a: CHEBI:22563 ! anion is_a: CHEBI:25699 ! organic ion [Term] id: CHEBI:25697 name: organic cation namespace: chebi_ontology def: "Any organic ion with a net positive charge." [] subset: 3_STAR synonym: "organic cations" RELATED [ChEBI] is_a: CHEBI:25699 ! organic ion is_a: CHEBI:36916 ! cation [Term] id: CHEBI:25699 name: organic ion namespace: chebi_ontology subset: 3_STAR synonym: "organic ions" RELATED [ChEBI] is_a: CHEBI:24870 ! ion is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:25704 name: organic sulfate namespace: chebi_ontology def: "Compounds of the general formula SO3HOR where R is an organyl group" [] subset: 3_STAR synonym: "organic sulfates" RELATED [ChEBI] is_a: CHEBI:26820 ! sulfates relationship: is_conjugate_acid_of CHEBI:58958 ! organosulfate oxoanion [Term] id: CHEBI:25741 name: oxide namespace: chebi_ontology def: "An oxide is a chemical compound of oxygen with other chemical elements." [] subset: 3_STAR synonym: "oxide" EXACT [ChEBI] synonym: "oxides" RELATED [ChEBI] is_a: CHEBI:25806 ! oxygen molecular entity is_a: CHEBI:37577 ! heteroatomic molecular entity [Term] id: CHEBI:25805 name: oxygen atom namespace: chebi_ontology subset: 3_STAR synonym: "8O" RELATED [IUPAC] synonym: "O" RELATED [IUPAC] synonym: "oxigeno" RELATED [ChEBI] synonym: "oxygen" EXACT IUPAC_NAME [IUPAC] synonym: "oxygen" RELATED [ChEBI] synonym: "oxygene" RELATED [ChEBI] synonym: "Sauerstoff" RELATED [ChEBI] xref: KEGG:C00007 xref: WebElements:O is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33303 ! chalcogen relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QVGXLLKOCUKJST-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "15.99940" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.99491" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O]" xsd:string [Term] id: CHEBI:25806 name: oxygen molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "oxygen molecular entities" RELATED [ChEBI] synonym: "oxygen molecular entities" RELATED [ChEBI:] synonym: "oxygen molecular entity" EXACT [ChEBI:] synonym: "oxygen molecular entity" EXACT [ChEBI] is_a: CHEBI:33304 ! chalcogen molecular entity relationship: has_part CHEBI:25805 ! oxygen atom [Term] id: CHEBI:25905 name: peptide hormone namespace: chebi_ontology def: "Any peptide with hormonal activity in animals, whether endocrine, neuroendocrine, or paracrine." [] subset: 3_STAR synonym: "peptide hormones" RELATED [ChEBI] synonym: "polypeptide hormone" RELATED [ChEBI] is_a: CHEBI:16670 ! peptide relationship: RO:0000087 CHEBI:24621 ! has role hormone [Term] id: CHEBI:26020 name: phosphate namespace: chebi_ontology def: "Salts and esters of phosphoric and oligophosphoric acids and their chalcogen analogues. In inorganic chemistry, the term is also used to describe anionic coordination entities with phosphorus as central atom." [] subset: 3_STAR synonym: "phosphates" EXACT IUPAC_NAME [IUPAC] synonym: "phosphates" RELATED [ChEBI] is_a: CHEBI:26079 ! phosphoric acid derivative [Term] id: CHEBI:26078 name: phosphoric acid namespace: chebi_ontology def: "A phosphorus oxoacid that consists of one oxo and three hydroxy groups joined covalently to a central phosphorus atom." [] subset: 3_STAR synonym: "[PO(OH)3]" RELATED [IUPAC] synonym: "acide phosphorique" RELATED [ChEBI] synonym: "acidum phosphoricum" RELATED [ChEBI] synonym: "H3PO4" RELATED [IUPAC] synonym: "Orthophosphoric acid" RELATED [KEGG_COMPOUND] synonym: "orthophosphoric acid" RELATED [NIST_Chemistry_WebBook] synonym: "Phosphate" RELATED [KEGG_COMPOUND] synonym: "Phosphoric acid" EXACT [KEGG_COMPOUND] synonym: "phosphoric acid" EXACT [IUPAC] synonym: "Phosphorsaeure" RELATED [ChEBI] synonym: "Phosphorsaeureloesungen" RELATED [ChEBI] synonym: "tetraoxophosphoric acid" EXACT IUPAC_NAME [IUPAC] synonym: "trihydrogen tetraoxophosphate(3-)" EXACT IUPAC_NAME [IUPAC] synonym: "trihydroxidooxidophosphorus" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:1921286 {source="Beilstein"} xref: CAS:7664-38-2 {source="NIST Chemistry WebBook"} xref: CAS:7664-38-2 {source="KEGG COMPOUND"} xref: CAS:7664-38-2 {source="ChemIDplus"} xref: Drug_Central:4478 {source="DrugCentral"} xref: Gmelin:2000 {source="Gmelin"} xref: HMDB:HMDB0002142 xref: KEGG:C00009 xref: KEGG:D05467 xref: KNApSAcK:C00007408 xref: PMID:11455380 {source="Europe PMC"} xref: PMID:15630224 {source="Europe PMC"} xref: PMID:17439666 {source="Europe PMC"} xref: PMID:17518491 {source="Europe PMC"} xref: PMID:22282755 {source="Europe PMC"} xref: PMID:22333268 {source="Europe PMC"} xref: PMID:22381614 {source="Europe PMC"} xref: PMID:22401268 {source="Europe PMC"} xref: Reaxys:1921286 {source="Reaxys"} xref: Wikipedia:Phosphoric_Acid is_a: CHEBI:59698 ! phosphoric acids relationship: is_conjugate_acid_of CHEBI:39745 ! dihydrogenphosphate relationship: RO:0000087 CHEBI:33287 ! has role fertilizer relationship: RO:0000087 CHEBI:46787 ! has role solvent relationship: RO:0000087 CHEBI:77746 ! has role human metabolite relationship: RO:0000087 CHEBI:84735 ! has role algal metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H3O4P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "97.99520" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "97.97690" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OP(=O)(O[H])O[H]" xsd:string [Term] id: CHEBI:26079 name: phosphoric acid derivative namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:36359 ! phosphorus oxoacid derivative relationship: has_functional_parent CHEBI:26078 ! phosphoric acid [Term] id: CHEBI:26082 name: phosphorus molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "phosphorus molecular entities" RELATED [ChEBI] is_a: CHEBI:33302 ! pnictogen molecular entity relationship: has_part CHEBI:28659 ! phosphorus atom [Term] id: CHEBI:26130 name: biological pigment namespace: chebi_ontology def: "An endogenous molecular entity that results in a colour of an organism as the consequence of the selective absorption of light." [] subset: 3_STAR synonym: "pigments" RELATED [ChEBI] is_a: CHEBI:52208 ! biophysical role [Term] id: CHEBI:26167 name: polar amino acid namespace: chebi_ontology alt_id: CHEBI:8283 def: "Any amino acid whose side chain is capable of forming one or more hydrogen bonds." [] subset: 3_STAR synonym: "polar amino acid" EXACT [ChEBI] synonym: "polar amino acids" RELATED [ChEBI] synonym: "polar amino-acid" RELATED [ChEBI] synonym: "polar amino-acids" RELATED [ChEBI] xref: MetaCyc:Polar-amino-acids xref: PMID:12016058 {source="Europe PMC"} is_a: CHEBI:33709 ! amino acid relationship: is_tautomer_of CHEBI:62031 ! polar amino acid zwitterion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC(C(*)N)=O" xsd:string [Term] id: CHEBI:26195 name: polyphenol namespace: chebi_ontology def: "Members of the class of phenols that contain 2 or more benzene rings each of which is substituted by at least one hydroxy group." [] subset: 3_STAR synonym: "polyphenols" RELATED [ChEBI] xref: Wikipedia:Polyphenol is_a: CHEBI:33853 ! phenols [Term] id: CHEBI:26519 name: radical namespace: chebi_ontology def: "A molecular entity possessing an unpaired electron." [] subset: 3_STAR synonym: "free radical" RELATED [ChEBI] synonym: "freies Radikal" RELATED [ChEBI] synonym: "radical" EXACT IUPAC_NAME [IUPAC] synonym: "radical libre" RELATED [ChEBI] synonym: "radicales libres" RELATED [ChEBI] synonym: "radicals" RELATED [IUPAC] synonym: "Radikal" RELATED [ChEBI] synonym: "Radikale" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:26523 name: reactive oxygen species namespace: chebi_ontology def: "Molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers." [] subset: 3_STAR synonym: "ROS" RELATED [ChEBI] xref: Wikipedia:Reactive_oxygen_species is_a: CHEBI:25806 ! oxygen molecular entity [Term] id: CHEBI:26607 name: saturated fatty acid namespace: chebi_ontology def: "Any fatty acid containing no carbon to carbon multiple bonds. Known to produce adverse biological effects when ingested to excess." [ANON:ANON] subset: 3_STAR synonym: "saturated fatty acid" EXACT [ChEBI:] synonym: "saturated fatty acid" EXACT [ChEBI] synonym: "saturated fatty acids" RELATED [ChEBI:] synonym: "saturated fatty acids" RELATED [ChEBI] synonym: "SFA" RELATED [ChEBI] synonym: "SFA" RELATED [ChEBI:] synonym: "SFAs" RELATED [ChEBI:] synonym: "SFAs" RELATED [ChEBI] xref: PMID:16492686 {source="Europe PMC"} xref: PMID:19763019 {source="Europe PMC"} xref: PMID:20237329 {source="Europe PMC"} is_a: CHEBI:35366 ! fatty acid [Term] id: CHEBI:26650 name: serine family amino acid namespace: chebi_ontology def: "An L-alpha-amino acid which is biosynthesised from 3-phosphoglycerate (i.e. serine, glycine, cysteine and homocysteine). A closed class." [] subset: 3_STAR synonym: "3-phosphoglycerate family amino acid" RELATED [ChEBI] synonym: "3-phosphoglycerate family amino acids" RELATED [ChEBI] synonym: "serine family amino acids" RELATED [ChEBI] xref: PMID:20709681 {source="Europe PMC"} is_a: CHEBI:15705 ! L-alpha-amino acid is_a: CHEBI:83813 ! proteinogenic amino acid [Term] id: CHEBI:26658 name: sesquiterpenoid namespace: chebi_ontology def: "Any terpenoid derived from a sesquiterpene. The term includes compounds in which the C15 skeleton of the parent sesquiterpene has been rearranged or modified by the removal of one or more skeletal atoms (generally methyl groups)." [] subset: 3_STAR synonym: "sesquiterpenoides" RELATED [ChEBI] synonym: "sesquiterpenoids" RELATED [ChEBI] xref: LIPID_MAPS_class:LMPR0103 {source="LIPID MAPS"} is_a: CHEBI:26873 ! terpenoid relationship: has_parent_hydride CHEBI:35189 ! sesquiterpene [Term] id: CHEBI:26666 name: short-chain fatty acid namespace: chebi_ontology def: "An aliphatic monocarboxylic acid with a chain length of less than C6." [ANON:ANON] def: "An aliphatic monocarboxylic acid with a chain length of less than C6. If any non-hydrocarbon substituent is present, the compound is not normally regarded as a short-chain fatty acid." [] subset: 3_STAR synonym: "SCFA" RELATED [ChEBI] synonym: "SCFA" RELATED [ChEBI:] synonym: "SCFAs" RELATED [ChEBI:] synonym: "SCFAs" RELATED [ChEBI] synonym: "short-chain fatty acids" RELATED [ChEBI:] synonym: "short-chain fatty acids" RELATED [ChEBI] xref: PMID:16633129 {source="Europe PMC"} xref: PMID:16870803 {source="Europe PMC"} xref: PMID:18203540 {source="Europe PMC"} xref: PMID:20148677 {source="Europe PMC"} is_a: CHEBI:35366 ! fatty acid relationship: is_conjugate_acid_of CHEBI:58951 ! short-chain fatty acid anion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.017" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string [Term] id: CHEBI:26708 name: sodium atom namespace: chebi_ontology subset: 3_STAR synonym: "11Na" RELATED [IUPAC] synonym: "Na" RELATED [IUPAC] synonym: "Natrium" RELATED [ChemIDplus] synonym: "natrium" RELATED [IUPAC] synonym: "sodio" RELATED [ChemIDplus] synonym: "sodium" EXACT IUPAC_NAME [IUPAC] synonym: "sodium" RELATED [ChEBI] xref: CAS:7440-23-5 {source="ChemIDplus"} xref: Gmelin:16221 {source="Gmelin"} xref: KEGG:C01330 xref: WebElements:Na is_a: CHEBI:22314 ! alkali metal atom relationship: RO:0000087 CHEBI:33937 ! has role macronutrient relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Na" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Na" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KEAYESYHFKHZAL-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "22.98977" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "22.98977" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Na]" xsd:string [Term] id: CHEBI:26712 name: sodium molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "sodium compounds" RELATED [ChEBI] synonym: "sodium molecular entities" RELATED [ChEBI] is_a: CHEBI:33296 ! alkali metal molecular entity relationship: has_part CHEBI:26708 ! sodium atom [Term] id: CHEBI:26714 name: sodium salt namespace: chebi_ontology def: "Any alkali metal salt having sodium(1+) as the cation." [] subset: 3_STAR synonym: "Natriumsalz" RELATED [ChEBI] synonym: "Natriumsalze" RELATED [ChEBI] synonym: "sodium salts" RELATED [ChEBI] is_a: CHEBI:26712 ! sodium molecular entity is_a: CHEBI:35479 ! alkali metal salt relationship: has_part CHEBI:29101 ! sodium(1+) [Term] id: CHEBI:26739 name: sphingolipid namespace: chebi_ontology def: "Sphingolipids are a complex family of compounds that share a common structural feature, a sphingoid base backbone." [] subset: 3_STAR synonym: "sphingolipids" RELATED [ChEBI] is_a: CHEBI:18059 ! lipid is_a: CHEBI:35352 ! organonitrogen compound is_a: CHEBI:36963 ! organooxygen compound [Term] id: CHEBI:26764 name: steroid hormone namespace: chebi_ontology def: "Any steroid that acts as hormone." [] subset: 3_STAR synonym: "hormona esteroide" RELATED [ChEBI] synonym: "hormonas esteroideas" RELATED [ChEBI] synonym: "hormone steroide" RELATED [ChEBI] synonym: "hormones steroides" RELATED [ChEBI] synonym: "steroid hormones" RELATED [ChEBI] synonym: "Steroidhormon" RELATED [ChEBI] synonym: "Steroidhormone" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid relationship: RO:0000087 CHEBI:24621 ! has role hormone [Term] id: CHEBI:26819 name: sulfuric ester namespace: chebi_ontology def: "An ester of an alcohol and sulfuric acid." [] subset: 3_STAR synonym: "sulfate ester" RELATED [ChEBI] synonym: "sulfuric acid ester" RELATED [ChEBI] synonym: "sulfuric acid esters" RELATED [ChEBI] is_a: CHEBI:35701 ! ester is_a: CHEBI:37826 ! sulfuric acid derivative property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O4SR2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06300" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95173" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]OS(=O)(=O)O[*]" xsd:string [Term] id: CHEBI:26820 name: sulfates namespace: chebi_ontology def: "Salts and esters of sulfuric acid" [] subset: 3_STAR synonym: "sulfates" EXACT [ChEBI] synonym: "sulfuric acid derivative" RELATED [ChEBI] synonym: "sulphates" RELATED [ChEBI] is_a: CHEBI:37826 ! sulfuric acid derivative [Term] id: CHEBI:26833 name: sulfur atom namespace: chebi_ontology subset: 3_STAR synonym: "16S" RELATED [IUPAC] synonym: "azufre" RELATED [ChEBI] synonym: "Elemental sulfur" RELATED [KEGG_COMPOUND] synonym: "S" RELATED [KEGG_COMPOUND] synonym: "S" RELATED [IUPAC] synonym: "Schwefel" RELATED [ChEBI] synonym: "soufre" RELATED [ChEBI] synonym: "sulfur" EXACT IUPAC_NAME [IUPAC] synonym: "sulfur" RELATED [ChEBI] synonym: "sulfur" RELATED [UniProt] synonym: "sulphur" RELATED [ChEBI] synonym: "theion" RELATED [IUPAC] xref: CAS:7704-34-9 {source="ChemIDplus"} xref: CAS:7704-34-9 {source="NIST Chemistry WebBook"} xref: KEGG:C00087 xref: KEGG:D06527 xref: PPDB:605 xref: WebElements:S is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33303 ! chalcogen relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NINIDFKCEFEMDL-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "32.06600" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.97207" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[S]" xsd:string [Term] id: CHEBI:26835 name: sulfur molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "sulfur molecular entities" RELATED [ChEBI] synonym: "sulfur molecular entity" EXACT [ChEBI] is_a: CHEBI:33304 ! chalcogen molecular entity relationship: has_part CHEBI:26833 ! sulfur atom [Term] id: CHEBI:26836 name: sulfuric acid namespace: chebi_ontology def: "A sulfur oxoacid that consists of two oxo and two hydroxy groups joined covalently to a central sulfur atom." [] subset: 3_STAR synonym: "[S(OH)2O2]" RELATED [MolBase] synonym: "[SO2(OH)2]" RELATED [IUPAC] synonym: "Acide sulfurique" RELATED [ChemIDplus] synonym: "Acido sulfurico" RELATED [ChemIDplus] synonym: "Acidum sulfuricum" RELATED [ChemIDplus] synonym: "dihydrogen tetraoxosulfate" EXACT IUPAC_NAME [IUPAC] synonym: "dihydroxidodioxidosulfur" EXACT IUPAC_NAME [IUPAC] synonym: "H2SO4" RELATED [IUPAC] synonym: "hydrogen tetraoxosulfate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogen tetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC] synonym: "Schwefelsaeureloesungen" RELATED [ChemIDplus] synonym: "Sulfuric acid" EXACT [KEGG_COMPOUND] synonym: "sulfuric acid" EXACT IUPAC_NAME [IUPAC] synonym: "sulfuric acid" EXACT [ChEBI] synonym: "sulphuric acid" RELATED [MolBase] synonym: "tetraoxosulfuric acid" EXACT IUPAC_NAME [IUPAC] xref: CAS:7664-93-9 {source="ChemIDplus"} xref: CAS:7664-93-9 {source="KEGG COMPOUND"} xref: CAS:7664-93-9 {source="NIST Chemistry WebBook"} xref: Gmelin:2122 {source="Gmelin"} xref: KEGG:C00059 xref: KEGG:D05963 xref: KNApSAcK:C00007530 xref: MolBase:4 xref: PMID:13568755 {source="Europe PMC"} xref: PMID:16122922 {source="Europe PMC"} xref: PMID:19397353 {source="Europe PMC"} xref: PMID:22047659 {source="Europe PMC"} xref: PMID:22136045 {source="Europe PMC"} xref: PMID:22204399 {source="Europe PMC"} xref: PMID:22267186 {source="Europe PMC"} xref: PMID:22296037 {source="Europe PMC"} xref: PMID:22364556 {source="Europe PMC"} xref: PMID:22435616 {source="Europe PMC"} xref: PPDB:606 xref: Reaxys:2037554 {source="Reaxys"} xref: Wikipedia:Sulfuric_acid is_a: CHEBI:33402 ! sulfur oxoacid relationship: is_conjugate_acid_of CHEBI:45696 ! hydrogensulfate relationship: RO:0000087 CHEBI:35223 ! has role catalyst property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O4S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "98.07948" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "97.96738" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OS(=O)(=O)O[H]" xsd:string [Term] id: CHEBI:26873 name: terpenoid namespace: chebi_ontology def: "Any isoprenoid that is a natural product or related compound formally derived from isoprene units. Terpenoids may contain oxygen in various functional groups. This class is subdivided according to the number of carbon atoms in the parent terpene. The skeleton of terpenoids may differ from strict additivity of isoprene units by the loss or shift of a fragment, generally a methyl group." [] subset: 3_STAR synonym: "Terpenoid" EXACT [ChEBI] synonym: "terpenoide" RELATED [IUPAC] synonym: "terpenoides" RELATED [IUPAC] synonym: "terpenoids" EXACT IUPAC_NAME [IUPAC] xref: Wikipedia:Terpenoid is_a: CHEBI:24913 ! isoprenoid relationship: has_parent_hydride CHEBI:35186 ! terpene [Term] id: CHEBI:26932 name: tetrapyrrole namespace: chebi_ontology def: "A natural pigment containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next." [] subset: 3_STAR synonym: "a tetrapyrrole" RELATED [UniProt] synonym: "tetrapyrrole" EXACT IUPAC_NAME [IUPAC] synonym: "tetrapyrroles" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33833 ! heteroarene is_a: CHEBI:38077 ! polypyrrole [Term] id: CHEBI:27027 name: micronutrient namespace: chebi_ontology def: "Any nutrient required in small quantities by organisms throughout their life in order to orchestrate a range of physiological functions." [] subset: 3_STAR synonym: "micronutrients" RELATED [ChEBI] synonym: "trace elements" RELATED [ChEBI] xref: Wikipedia:Micronutrient is_a: CHEBI:33284 ! nutrient [Term] id: CHEBI:27081 name: transition element atom namespace: chebi_ontology def: "An element whose atom has an incomplete d sub-shell, or which can give rise to cations with an incomplete d sub-shell." [] subset: 3_STAR synonym: "metal de transicion" RELATED [ChEBI] synonym: "metal de transition" RELATED [ChEBI] synonym: "metales de transicion" RELATED [ChEBI] synonym: "metaux de transition" RELATED [ChEBI] synonym: "transition element" EXACT IUPAC_NAME [IUPAC] synonym: "transition element" RELATED [ChEBI] synonym: "transition elements" RELATED [ChEBI] synonym: "transition metal" RELATED [ChEBI] synonym: "transition metals" RELATED [ChEBI] synonym: "Uebergangselement" RELATED [ChEBI] synonym: "Uebergangsmetalle" RELATED [ChEBI] is_a: CHEBI:33521 ! metal atom [Term] id: CHEBI:27162 name: tryptamines namespace: chebi_ontology def: "Tryptamine and its substitution derivatives." [ANON:ANON] subset: 3_STAR is_a: CHEBI:24828 ! indoles [Term] id: CHEBI:27171 name: organic heterobicyclic compound namespace: chebi_ontology subset: 3_STAR synonym: "heterobicyclic compounds" RELATED [ChEBI:] synonym: "heterobicyclic compounds" RELATED [ChEBI] synonym: "organic heterobicyclic compounds" RELATED [ChEBI] synonym: "organic heterobicyclic compounds" RELATED [ChEBI:] is_a: CHEBI:33672 ! heterobicyclic compound is_a: CHEBI:38166 ! organic heteropolycyclic compound [Term] id: CHEBI:27207 name: univalent carboacyl group namespace: chebi_ontology def: "A univalent carboacyl group is a group formed by loss of OH from the carboxy group of a carboxylic acid." [] subset: 3_STAR synonym: "univalent acyl group" RELATED [ChEBI] synonym: "univalent carboacyl groups" RELATED [ChEBI] synonym: "univalent carboxylic acyl groups" RELATED [ChEBI] is_a: CHEBI:37838 ! carboacyl group [Term] id: CHEBI:27369 name: zwitterion namespace: chebi_ontology def: "A neutral compound having formal unit electrical charges of opposite sign on non-adjacent atoms. Sometimes referred to as inner salts, dipolar ions (a misnomer)." [] subset: 3_STAR synonym: "compose zwitterionique" RELATED [IUPAC] synonym: "compuestos zwitterionicos" RELATED [IUPAC] synonym: "zwitterion" EXACT IUPAC_NAME [IUPAC] synonym: "zwitteriones" RELATED [IUPAC] synonym: "zwitterionic compounds" RELATED [IUPAC] synonym: "zwitterions" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:51151 ! dipolar compound [Term] id: CHEBI:27584 name: aldosterone namespace: chebi_ontology alt_id: CHEBI:22306 alt_id: CHEBI:2563 alt_id: CHEBI:40919 def: "A pregnane-based steroidal hormone produced by the outer-section (zona glomerulosa) of the adrenal cortex in the adrenal gland, and acts on the distal tubules and collecting ducts of the kidney to cause the conservation of sodium, secretion of potassium, increased water retention, and increased blood pressure. The overall effect of aldosterone is to increase reabsorption of ions and water in the kidney." [] subset: 3_STAR synonym: "(+)-aldosterone" RELATED [NIST_Chemistry_WebBook] synonym: "(11beta)-11,21-dihydroxy-3,20-dioxopregn-4-en-18-al" RELATED [NIST_Chemistry_WebBook] synonym: "11beta,21-Dihydroxy-3,20-dioxo-4-pregnen-18-al" RELATED [KEGG_COMPOUND] synonym: "11beta,21-dihydroxy-3,20-dioxopregn-4-en-18-al" EXACT IUPAC_NAME [IUPAC] synonym: "ALDOSTERONE" EXACT [PDBeChem] synonym: "Aldosterone" EXACT [KEGG_COMPOUND] synonym: "aldosterone" EXACT [UniProt] xref: Beilstein:3224996 {source="ChemIDplus"} xref: CAS:52-39-1 {source="ChemIDplus"} xref: CAS:52-39-1 {source="NIST Chemistry WebBook"} xref: CAS:52-39-1 {source="KEGG COMPOUND"} xref: Drug_Central:111 {source="DrugCentral"} xref: DrugBank:DB04630 xref: HMDB:HMDB0000037 xref: KEGG:C01780 xref: LINCS:LSM-42770 xref: LIPID_MAPS_instance:LMST02030026 {source="LIPID MAPS"} xref: PDBeChem:AS4 xref: PMID:10438974 {source="Europe PMC"} xref: Reaxys:3224996 {source="Reaxys"} xref: Wikipedia:Aldosterone is_a: CHEBI:131565 ! steroid aldehyde is_a: CHEBI:139590 ! primary alpha-hydroxy ketone is_a: CHEBI:25354 ! mineralocorticoid is_a: CHEBI:35344 ! 21-hydroxy steroid is_a: CHEBI:35346 ! 11beta-hydroxy steroid is_a: CHEBI:36885 ! 20-oxo steroid is_a: CHEBI:36887 ! 18-oxo steroid is_a: CHEBI:47909 ! 3-oxo-Delta(4) steroid is_a: CHEBI:64600 ! C21-steroid hormone relationship: has_parent_hydride CHEBI:8386 ! pregnane relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H28O5" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H28O5/c1-20-7-6-13(24)8-12(20)2-3-14-15-4-5-16(18(26)10-22)21(15,11-23)9-17(25)19(14)20/h8,11,14-17,19,22,25H,2-7,9-10H2,1H3/t14-,15-,16+,17-,19+,20-,21+/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "PQSUYGKTWSAVDQ-ZVIOFETBSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "360.44400" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.19367" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4=CC(=O)CC[C@]4(C)[C@@]3([H])[C@@H](O)C[C@]12C=O)C(=O)CO" xsd:string [Term] id: CHEBI:27594 name: carbon atom namespace: chebi_ontology alt_id: CHEBI:23009 alt_id: CHEBI:3399 subset: 3_STAR synonym: "6C" RELATED [IUPAC] synonym: "C" RELATED [KEGG_COMPOUND] synonym: "C" RELATED [IUPAC] synonym: "Carbon" RELATED [KEGG_COMPOUND] synonym: "carbon" EXACT IUPAC_NAME [IUPAC] synonym: "carbon" RELATED [ChEBI] synonym: "carbone" RELATED [ChEBI] synonym: "carbonium" RELATED [ChEBI] synonym: "carbono" RELATED [ChEBI] synonym: "Kohlenstoff" RELATED [ChEBI] xref: CAS:7440-44-0 {source="ChemIDplus"} xref: CAS:7440-44-0 {source="KEGG COMPOUND"} xref: KEGG:C06265 xref: WebElements:C is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33306 ! carbon group element atom relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OKTJSMMVPCPJKN-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "12.01070" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "12.00000" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[C]" xsd:string [Term] id: CHEBI:28087 name: glycogen namespace: chebi_ontology alt_id: CHEBI:24379 alt_id: CHEBI:5466 def: "A polydisperse, highly branched glucan composed of chains of D-glucopyranose residues in alpha(1->4) glycosidic linkage, joined together by alpha(1->6) glycosidic linkages. A small number of alpha(1->3) glycosidic linkages and some cumulative alpha(1->6) links also may occur. The branches in glycogen typically contain 8 to 12 glucose residues." [] subset: 3_STAR synonym: "animal starch" RELATED [ChemIDplus] synonym: "Glycogen" EXACT [KEGG_COMPOUND] synonym: "liver starch" RELATED [ChemIDplus] synonym: "WURCS=2.0/1,4,3/[a2122h-1a_1-5]/1-1-1-1/a4-b1_b4-c1_b6-d1" RELATED [GlyTouCan] xref: CAS:9005-79-2 {source="KEGG COMPOUND"} xref: CAS:9005-79-2 {source="ChemIDplus"} xref: GlyGen:G99991IU xref: GlyTouCan:G99991IU xref: HMDB:HMDB0000757 xref: KEGG:C00182 xref: MetaCyc:CPD0-971 xref: Wikipedia:Glycogen is_a: CHEBI:24384 ! glycogens relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite [Term] id: CHEBI:28616 name: carbamic acid namespace: chebi_ontology alt_id: CHEBI:22504 alt_id: CHEBI:23002 alt_id: CHEBI:3386 alt_id: CHEBI:44573 def: "A one-carbon compound that is ammonia in which one of the hydrogens is replaced by a carboxy group. Although carbamic acid derivatives are common, carbamic acid itself has never been synthesised." [] subset: 3_STAR synonym: "Aminoameisensaeure" RELATED [ChEBI] synonym: "Aminoformic acid" RELATED [KEGG_COMPOUND] synonym: "Carbamate" RELATED [KEGG_COMPOUND] synonym: "CARBAMIC ACID" EXACT [PDBeChem] synonym: "Carbamic acid" EXACT [KEGG_COMPOUND] synonym: "carbamic acid" EXACT IUPAC_NAME [IUPAC] synonym: "Carbamidsaeure" RELATED [ChEBI] xref: Beilstein:1734754 {source="Beilstein"} xref: CAS:463-77-4 {source="KEGG COMPOUND"} xref: CAS:463-77-4 {source="ChemIDplus"} xref: DrugBank:DB04261 xref: Gmelin:130345 {source="Gmelin"} xref: KEGG:C01563 xref: PDBeChem:OUT xref: Wikipedia:Carbamic_acid is_a: CHEBI:35352 ! organonitrogen compound is_a: CHEBI:35605 ! carbon oxoacid is_a: CHEBI:64708 ! one-carbon compound relationship: is_conjugate_acid_of CHEBI:13941 ! carbamate relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH3NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH3NO2/c2-1(3)4/h2H2,(H,3,4)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "KXDHJXZQYSOELW-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "61.04006" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "61.01638" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(O)=O" xsd:string [Term] id: CHEBI:28659 name: phosphorus atom namespace: chebi_ontology alt_id: CHEBI:26080 alt_id: CHEBI:8168 subset: 3_STAR synonym: "15P" RELATED [IUPAC] synonym: "fosforo" RELATED [ChEBI] synonym: "P" RELATED [IUPAC] synonym: "P" RELATED [KEGG_COMPOUND] synonym: "Phosphor" RELATED [ChEBI] synonym: "phosphore" RELATED [ChEBI] synonym: "Phosphorus" RELATED [KEGG_COMPOUND] synonym: "phosphorus" EXACT IUPAC_NAME [IUPAC] synonym: "phosphorus" RELATED [ChEBI] xref: CAS:7723-14-0 {source="ChemIDplus"} xref: CAS:7723-14-0 {source="KEGG COMPOUND"} xref: Gmelin:16235 {source="Gmelin"} xref: KEGG:C06262 xref: WebElements:P is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33300 ! pnictogen relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "OAICVXFJPJFONN-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "30.97376" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "30.97376" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[P]" xsd:string [Term] id: CHEBI:28790 name: serotonin namespace: chebi_ontology alt_id: CHEBI:1420 alt_id: CHEBI:26652 alt_id: CHEBI:49894 def: "A primary amino compound that is the 5-hydroxy derivative of tryptamine." [] def: "The 5-hydroxy derivative of tryptamine." [ANON:ANON] subset: 3_STAR synonym: "3-(2-Aminoethyl)-1H-indol-5-ol" RELATED [KEGG COMPOUND:] synonym: "3-(2-Aminoethyl)-1H-indol-5-ol" RELATED [KEGG_COMPOUND] synonym: "3-(2-aminoethyl)-1H-indol-5-ol" EXACT IUPAC_NAME [IUPAC:] synonym: "3-(2-aminoethyl)-1H-indol-5-ol" EXACT IUPAC_NAME [IUPAC] synonym: "5-HT" RELATED [IUPHAR:] synonym: "5-HT" RELATED [IUPHAR] synonym: "5-Hydroxytryptamine" RELATED [KEGG COMPOUND:] synonym: "5-Hydroxytryptamine" RELATED [KEGG_COMPOUND] synonym: "C10H12N2O" RELATED FORMULA [KEGG COMPOUND:] synonym: "Enteramine" RELATED [KEGG COMPOUND:] synonym: "Enteramine" RELATED [KEGG_COMPOUND] synonym: "InChI=1S/C10H12N2O/c11-4-3-7-6-12-10-2-1-8(13)5-9(7)10/h1-2,5-6,12-13H,3-4,11H2" RELATED InChI [ChEBI:] synonym: "InChIKey=QZAYGJVTTNCVMB-UHFFFAOYSA-N" RELATED InChIKey [ChEBI:] synonym: "NCCc1c[nH]c2ccc(O)cc12" RELATED SMILES [ChEBI:] synonym: "SEROTONIN" EXACT [PDBeChem:] synonym: "SEROTONIN" EXACT [PDBeChem] synonym: "Serotonin" EXACT [KEGG COMPOUND:] synonym: "Serotonin" EXACT [KEGG_COMPOUND] synonym: "serotonine" RELATED [ChEBI:] synonym: "serotonine" RELATED [ChEBI] synonym: "thrombocytin" RELATED [ChemIDplus:] synonym: "thrombocytin" RELATED [ChemIDplus] synonym: "thrombotonin" RELATED [ChemIDplus] synonym: "thrombotonin" RELATED [ChemIDplus:] xref: Beilstein:143524 {source="Beilstein"} xref: CAS:50-67-9 {source="KEGG COMPOUND"} xref: CAS:50-67-9 {source="ChemIDplus"} xref: Gmelin:1861995 {source="Gmelin"} xref: HMDB:HMDB0000259 xref: KEGG:C00780 xref: KNApSAcK:C00001429 xref: LINCS:LSM-6589 xref: MetaCyc:SEROTONIN xref: PDBeChem:SRO xref: PMID:18593914 {source="Europe PMC"} xref: PMID:22770225 {source="Europe PMC"} xref: PMID:24136337 {source="Europe PMC"} xref: Reaxys:143524 {source="Reaxys"} xref: Wikipedia:Serotonin is_a: CHEBI:25375 ! monoamine molecular messenger is_a: CHEBI:27162 ! tryptamines is_a: CHEBI:33853 ! phenols is_a: CHEBI:50994 ! primary amino compound is_a: CHEBI:84729 ! hydroxyindoles relationship: has_functional_parent CHEBI:16765 ! tryptamine relationship: is_conjugate_base_of CHEBI:350546 ! serotonin(1+) relationship: RO:0000087 CHEBI:25512 ! has role neurotransmitter relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H12N2O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2O/c11-4-3-7-6-12-10-2-1-8(13)5-9(7)10/h1-2,5-6,12-13H,3-4,11H2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZAYGJVTTNCVMB-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "176.215" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "176.09496" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1=CC(=CC=2C(=CNC12)CCN)O" xsd:string [Term] id: CHEBI:28868 name: fatty acid anion namespace: chebi_ontology alt_id: CHEBI:13634 alt_id: CHEBI:24022 alt_id: CHEBI:4985 def: "The conjugate base of a fatty acid, arising from deprotonation of the carboxylic acid group of the corresponding fatty acid." [] subset: 3_STAR synonym: "a fatty acid" RELATED [UniProt] synonym: "acido graso anionico" RELATED [ChEBI] synonym: "acidos grasos anionicos" RELATED [ChEBI] synonym: "Alkanate" RELATED [KEGG_COMPOUND] synonym: "anion de l'acide gras" RELATED [ChEBI] synonym: "Fatty acid anion" EXACT [KEGG_COMPOUND] synonym: "fatty acid anions" RELATED [ChEBI] synonym: "Fettsaeureanion" RELATED [ChEBI] synonym: "Fettsaeureanionen" RELATED [ChEBI] xref: KEGG:C02403 xref: PMID:18628202 {source="Europe PMC"} is_a: CHEBI:18059 ! lipid is_a: CHEBI:35757 ! monocarboxylic acid anion relationship: is_conjugate_base_of CHEBI:35366 ! fatty acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.00950" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string [Term] id: CHEBI:28938 name: ammonium namespace: chebi_ontology alt_id: CHEBI:22534 alt_id: CHEBI:49783 alt_id: CHEBI:7435 def: "An onium cation obtained by protonation of ammonia." [] subset: 3_STAR synonym: "[NH4](+)" RELATED [MolBase] synonym: "ammonium" EXACT IUPAC_NAME [IUPAC] synonym: "ammonium" EXACT [ChEBI] synonym: "ammonium cation" RELATED [ChemIDplus] synonym: "ammonium ion" RELATED [PDBeChem] synonym: "Ammonium(1+)" RELATED [ChemIDplus] synonym: "azanium" EXACT IUPAC_NAME [IUPAC] synonym: "NH4(+)" RELATED [UniProt] synonym: "NH4(+)" RELATED [IUPAC] synonym: "NH4+" RELATED [KEGG_COMPOUND] xref: CAS:14798-03-9 {source="NIST Chemistry WebBook"} xref: CAS:14798-03-9 {source="ChemIDplus"} xref: Gmelin:84 {source="Gmelin"} xref: KEGG:C01342 xref: MetaCyc:AMMONIUM xref: MolBase:929 xref: PDBeChem:NH4 xref: PMID:11319011 {source="Europe PMC"} xref: PMID:11341317 {source="Europe PMC"} xref: PMID:12096804 {source="Europe PMC"} xref: PMID:14512268 {source="Europe PMC"} xref: PMID:14879753 {source="Europe PMC"} xref: PMID:16345391 {source="Europe PMC"} xref: PMID:16903292 {source="Europe PMC"} xref: PMID:17392693 {source="Europe PMC"} xref: PMID:18515490 {source="Europe PMC"} xref: PMID:19199063 {source="Europe PMC"} xref: PMID:19596600 {source="Europe PMC"} xref: PMID:19682559 {source="Europe PMC"} xref: PMID:19716251 {source="Europe PMC"} xref: PMID:21993530 {source="Europe PMC"} xref: PMID:22265469 {source="Europe PMC"} xref: PMID:22524020 {source="Europe PMC"} xref: PMID:22562341 {source="Europe PMC"} xref: PMID:22631217 {source="Europe PMC"} xref: Reaxys:16093784 {source="Reaxys"} xref: Wikipedia:Ammonium is_a: CHEBI:35106 ! nitrogen hydride is_a: CHEBI:50313 ! onium cation is_a: CHEBI:60242 ! monovalent inorganic cation relationship: is_conjugate_acid_of CHEBI:16134 ! ammonia relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H4N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3N/h1H3/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QGZKDVFQNNGYKY-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "18.03850" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "18.03383" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][N+]([H])([H])[H]" xsd:string [Term] id: CHEBI:28965 name: dicarboxylic acid dianion namespace: chebi_ontology alt_id: CHEBI:13632 alt_id: CHEBI:23688 alt_id: CHEBI:23689 alt_id: CHEBI:38711 def: "A carboxylic acid dianion obtained by deprotonation of both carboxy groups of any dicarboxylic acid." [] subset: 3_STAR synonym: "a dicarboxylate" RELATED [UniProt] synonym: "dicarboxylate" RELATED [ChEBI] synonym: "dicarboxylates" RELATED [ChEBI] synonym: "dicarboxylic acid dianion" EXACT [ChEBI] synonym: "dicarboxylic acid dianions" RELATED [ChEBI] is_a: CHEBI:35693 ! dicarboxylic acid anion is_a: CHEBI:38716 ! carboxylic acid dianion property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2O4R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "88.019" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.97966" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C(=O)[*]C([O-])=O" xsd:string [Term] id: CHEBI:28976 name: carbonic acid namespace: chebi_ontology alt_id: CHEBI:13351 alt_id: CHEBI:23017 alt_id: CHEBI:23744 alt_id: CHEBI:3401 subset: 3_STAR synonym: "[CO(OH)2]" RELATED [IUPAC] synonym: "Carbonic acid" EXACT [KEGG_COMPOUND] synonym: "carbonic acid" EXACT IUPAC_NAME [IUPAC] synonym: "Dihydrogen carbonate" RELATED [KEGG_COMPOUND] synonym: "dihydroxidooxidocarbon" EXACT IUPAC_NAME [IUPAC] synonym: "H2CO3" RELATED [KEGG_COMPOUND] synonym: "H2CO3" RELATED [IUPAC] synonym: "Koehlensaeure" RELATED [ChEBI] xref: CAS:463-79-6 {source="ChemIDplus"} xref: CAS:463-79-6 {source="KEGG COMPOUND"} xref: Gmelin:25554 {source="Gmelin"} xref: KEGG:C01353 xref: PDBeChem:CO3 is_a: CHEBI:35605 ! carbon oxoacid is_a: CHEBI:36961 ! chalcocarbonic acid relationship: is_conjugate_acid_of CHEBI:17544 ! hydrogencarbonate relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2O3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "62.02478" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "62.00039" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC(O)=O" xsd:string [Term] id: CHEBI:29057 name: keratan namespace: chebi_ontology alt_id: CHEBI:14490 alt_id: CHEBI:24954 subset: 1_STAR is_a: CHEBI:18085 ! glycosaminoglycan [Term] id: CHEBI:29067 name: carboxylic acid anion namespace: chebi_ontology alt_id: CHEBI:13626 alt_id: CHEBI:13945 alt_id: CHEBI:23026 alt_id: CHEBI:58657 def: "The conjugate base formed when the carboxy group of a carboxylic acid is deprotonated." [] subset: 3_STAR synonym: "a carboxylate" RELATED [UniProt] synonym: "carboxylic acid anions" RELATED [ChEBI] synonym: "carboxylic anions" RELATED [ChEBI] is_a: CHEBI:25696 ! organic anion is_a: CHEBI:35406 ! oxoanion relationship: is_conjugate_base_of CHEBI:33575 ! carboxylic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.00950" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string [Term] id: CHEBI:29101 name: sodium(1+) namespace: chebi_ontology alt_id: CHEBI:26717 alt_id: CHEBI:49766 alt_id: CHEBI:9175 def: "A monoatomic monocation obtained from sodium." [] subset: 3_STAR synonym: "Na(+)" RELATED [UniProt] synonym: "Na(+)" RELATED [IUPAC] synonym: "Na+" RELATED [KEGG_COMPOUND] synonym: "sodium cation" EXACT IUPAC_NAME [IUPAC] synonym: "SODIUM ION" RELATED [PDBeChem] synonym: "sodium(1+)" EXACT IUPAC_NAME [IUPAC] synonym: "sodium(1+) ion" EXACT IUPAC_NAME [IUPAC] synonym: "sodium(I) cation" EXACT IUPAC_NAME [IUPAC] xref: CAS:17341-25-2 {source="ChemIDplus"} xref: CAS:17341-25-2 {source="NIST Chemistry WebBook"} xref: Gmelin:15196 {source="Gmelin"} xref: KEGG:C01330 xref: PDBeChem:NA is_a: CHEBI:25414 ! monoatomic monocation is_a: CHEBI:33504 ! alkali metal cation is_a: CHEBI:37246 ! elemental sodium is_a: CHEBI:60242 ! monovalent inorganic cation relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Na" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Na/q+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FKNQFGJONOIPTF-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "22.98977" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "22.98922" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Na+]" xsd:string [Term] id: CHEBI:29108 name: calcium(2+) namespace: chebi_ontology alt_id: CHEBI:22988 alt_id: CHEBI:3308 alt_id: CHEBI:48760 subset: 3_STAR synonym: "Ca(2+)" RELATED [IUPAC] synonym: "Ca(2+)" RELATED [UniProt] synonym: "Ca2+" RELATED [KEGG_COMPOUND] synonym: "CALCIUM ION" RELATED [PDBeChem] synonym: "calcium(2+)" EXACT IUPAC_NAME [IUPAC] synonym: "calcium(2+) ion" EXACT IUPAC_NAME [IUPAC] synonym: "calcium(II) cation" EXACT IUPAC_NAME [IUPAC] synonym: "calcium, doubly charged positive ion" RELATED [NIST_Chemistry_WebBook] xref: CAS:14127-61-8 {source="ChemIDplus"} xref: CAS:14127-61-8 {source="NIST Chemistry WebBook"} xref: Gmelin:6850 {source="Gmelin"} xref: KEGG:C00076 xref: PDBeChem:CA is_a: CHEBI:30412 ! monoatomic dication is_a: CHEBI:39123 ! calcium cation is_a: CHEBI:60240 ! divalent metal cation relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/Ca/q+2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BHPQYMZQTOCNFJ-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "40.07800" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96149" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[Ca++]" xsd:string [Term] id: CHEBI:29337 name: azanide namespace: chebi_ontology subset: 3_STAR synonym: "amide" EXACT IUPAC_NAME [IUPAC] synonym: "azanide" EXACT IUPAC_NAME [IUPAC] synonym: "dihydridonitrate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "NH2(-)" RELATED [IUPAC] is_a: CHEBI:35106 ! nitrogen hydride is_a: CHEBI:79389 ! monovalent inorganic anion relationship: is_conjugate_acid_of CHEBI:29340 ! hydridonitrate(2-) relationship: is_conjugate_base_of CHEBI:16134 ! ammonia property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H2N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2N/h1H2/q-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "HYGWNUKOUCZBND-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "16.02262" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "16.01927" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][N-][H]" xsd:string [Term] id: CHEBI:29340 name: hydridonitrate(2-) namespace: chebi_ontology def: "A divalent inorganic anion resulting from the removal of two protons from ammonia." [] subset: 3_STAR synonym: "azanediide" EXACT IUPAC_NAME [IUPAC] synonym: "hydridonitrate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "imide" RELATED [IUPAC] synonym: "NH(2-)" RELATED [IUPAC] is_a: CHEBI:35106 ! nitrogen hydride is_a: CHEBI:79388 ! divalent inorganic anion relationship: is_conjugate_base_of CHEBI:29337 ! azanide property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HN" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/HN/h1H/q-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DZQYTNGKSBCIOE-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "15.01468" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.01200" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[N--][H]" xsd:string [Term] id: CHEBI:29412 name: oxonium namespace: chebi_ontology subset: 3_STAR synonym: "[OH3](+)" RELATED [MolBase] synonym: "aquahydrogen(1+)" EXACT IUPAC_NAME [IUPAC] synonym: "H3O(+)" RELATED [IUPAC] synonym: "Hydronium cation" RELATED [NIST_Chemistry_WebBook] synonym: "Hydronium ion" RELATED [ChemIDplus] synonym: "oxidanium" EXACT IUPAC_NAME [IUPAC] synonym: "oxonium" EXACT IUPAC_NAME [IUPAC] synonym: "trihydridooxygen(1+)" EXACT IUPAC_NAME [IUPAC] xref: CAS:13968-08-6 {source="ChemIDplus"} xref: CAS:13968-08-6 {source="NIST Chemistry WebBook"} xref: Gmelin:141 {source="Gmelin"} xref: MolBase:1646 is_a: CHEBI:33693 ! oxygen hydride is_a: CHEBI:50313 ! onium cation relationship: is_conjugate_acid_of CHEBI:15377 ! water property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H3O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O/h1H2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XLYOFNOQVPJJNP-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "19.02322" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "19.01784" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][O+]([H])[H]" xsd:string [Term] id: CHEBI:29793 name: hydridodioxygen(1+) namespace: chebi_ontology subset: 3_STAR synonym: "[HO2](+)" RELATED [ChEBI] synonym: "dioxidenium" EXACT IUPAC_NAME [IUPAC] synonym: "HO2(+)" RELATED [IUPAC] synonym: "HOO(+)" RELATED [ChEBI] synonym: "hydridodioxygen(1+)" EXACT IUPAC_NAME [IUPAC] xref: Gmelin:508 {source="Gmelin"} is_a: CHEBI:33693 ! oxygen hydride relationship: is_conjugate_acid_of CHEBI:15379 ! dioxygen property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/O2/c1-2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MYMOFIZGZYHOMD-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "33.00674" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "32.99711" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][O+]=O" xsd:string [Term] id: CHEBI:29987 name: glutamate(2-) namespace: chebi_ontology def: "A dicarboxylic acid dianion that is the conjugate base of glutamate(1-)." [] subset: 3_STAR synonym: "2-aminopentanedioate" EXACT IUPAC_NAME [IUPAC] synonym: "glutamate" EXACT IUPAC_NAME [IUPAC] synonym: "glutamate(2-)" EXACT [JCBN] synonym: "glutamic acid dianion" RELATED [JCBN] xref: Beilstein:4134100 {source="Beilstein"} xref: Gmelin:327903 {source="Gmelin"} xref: Reaxys:4134100 {source="Reaxys"} is_a: CHEBI:28965 ! dicarboxylic acid dianion relationship: is_conjugate_base_of CHEBI:14321 ! glutamate(1-) relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H7NO4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/p-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "WHUUTDBJXJRKMK-UHFFFAOYSA-L" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "145.11342" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "145.03860" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC(CCC([O-])=O)C([O-])=O" xsd:string [Term] id: CHEBI:30089 name: acetate namespace: chebi_ontology alt_id: CHEBI:13704 alt_id: CHEBI:22165 alt_id: CHEBI:40480 def: "A monocarboxylic acid anion resulting from the removal of a proton from the carboxy group of acetic acid." [] subset: 3_STAR synonym: "acetate" EXACT [UniProt] synonym: "acetate" EXACT IUPAC_NAME [IUPAC] synonym: "ACETATE ION" RELATED [PDBeChem] synonym: "acetic acid, ion(1-)" RELATED [ChemIDplus] synonym: "Azetat" RELATED [ChEBI] synonym: "CH3-COO(-)" RELATED [IUPAC] synonym: "Ethanoat" RELATED [ChEBI] synonym: "ethanoate" RELATED [ChEBI] synonym: "MeCO2 anion" RELATED [NIST_Chemistry_WebBook] xref: Beilstein:1901470 {source="Beilstein"} xref: CAS:71-50-1 {source="ChemIDplus"} xref: CAS:71-50-1 {source="NIST Chemistry WebBook"} xref: DrugBank:DB03166 xref: Gmelin:1379 {source="Gmelin"} xref: KEGG:C00033 xref: MetaCyc:ACET xref: PDBeChem:ACT xref: PMID:17190852 {source="Europe PMC"} xref: PMID:22211106 {source="Europe PMC"} xref: PMID:22371380 {source="Europe PMC"} xref: Reaxys:1901470 {source="Reaxys"} xref: UM-BBD_compID:c0050 {source="UM-BBD"} xref: Wikipedia:Acetate is_a: CHEBI:35757 ! monocarboxylic acid anion relationship: is_conjugate_base_of CHEBI:15366 ! acetic acid relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H4O2/c1-2(3)4/h1H3,(H,3,4)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QTBSBXVTEAMEQO-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "59.04402" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01385" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC([O-])=O" xsd:string [Term] id: CHEBI:30212 name: photon namespace: chebi_ontology alt_id: CHEBI:10581 alt_id: CHEBI:14383 def: "Particle of zero charge, zero rest mass, spin quantum number 1, energy hnu and momentum hnu/c (h is the Planck constant, nu the frequency of radiation and c the speed of light), carrier of electromagnetic force." [] subset: 3_STAR synonym: "foton" RELATED [ChEBI] synonym: "gamma" RELATED [IUPAC] synonym: "hnu" RELATED [IUPAC] synonym: "hnu" RELATED [UniProt] synonym: "Lichtquant" RELATED [ChEBI] synonym: "Light" RELATED [KEGG_COMPOUND] synonym: "light quantum" RELATED [ChEBI] synonym: "photon" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C00205 is_a: CHEBI:36341 ! boson property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "0.0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "0.0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*" xsd:string [Term] id: CHEBI:30412 name: monoatomic dication namespace: chebi_ontology alt_id: CHEBI:23856 alt_id: CHEBI:4665 subset: 3_STAR synonym: "Divalent cation" RELATED [KEGG_COMPOUND] synonym: "divalent inorganic cations" RELATED [ChEBI] synonym: "monoatomic dications" RELATED [ChEBI] xref: KEGG:C00572 is_a: CHEBI:23906 ! monoatomic cation property_value: http://purl.obolibrary.org/obo/chebi/charge "+2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "0.00000" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*++]" xsd:string [Term] id: CHEBI:30566 name: gamma-aminobutyrate namespace: chebi_ontology alt_id: CHEBI:11961 alt_id: CHEBI:20317 def: "An gamma-amino acid anion resulting from the deprotonation of the carboxy group of gamma-aminobutyric acid." [] subset: 3_STAR synonym: "4-Amino-butyrat" RELATED [ChEBI] synonym: "4-aminobutanoate" EXACT IUPAC_NAME [IUPAC] synonym: "4-aminobutanoic acid ion (1-)" RELATED [ChEBI] synonym: "4-Aminobutylate" RELATED [KEGG_COMPOUND] synonym: "4-aminobutyrate" RELATED [ChEBI] synonym: "gamma-aminobutanoate" RELATED [ChEBI] synonym: "gamma-aminobutyrate anion" RELATED [ChEBI] xref: Beilstein:3536873 {source="Beilstein"} xref: Gmelin:559138 {source="Gmelin"} xref: KEGG:C00334 xref: PMID:12509893 {source="Europe PMC"} xref: Reaxys:3536873 {source="Reaxys"} is_a: CHEBI:71666 ! gamma-amino acid anion relationship: has_functional_parent CHEBI:17968 ! butyrate relationship: is_conjugate_base_of CHEBI:16865 ! gamma-aminobutyric acid relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H8NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "102.11186" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "102.05605" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCCCC([O-])=O" xsd:string [Term] id: CHEBI:30751 name: formic acid namespace: chebi_ontology alt_id: CHEBI:24082 alt_id: CHEBI:42460 alt_id: CHEBI:5145 def: "The simplest carboxylic acid, containing a single carbon. Occurs naturally in various sources including the venom of bee and ant stings, and is a useful organic synthetic reagent. Principally used as a preservative and antibacterial agent in livestock feed. Induces severe metabolic acidosis and ocular injury in human subjects." [] subset: 3_STAR synonym: "Acide formique" RELATED [ChemIDplus] synonym: "Ameisensaeure" RELATED [ChemIDplus] synonym: "aminic acid" RELATED [ChemIDplus] synonym: "bilorin" RELATED [ChemIDplus] synonym: "FORMIC ACID" EXACT [PDBeChem] synonym: "Formic acid" EXACT [KEGG_COMPOUND] synonym: "formic acid" EXACT IUPAC_NAME [IUPAC] synonym: "formylic acid" RELATED [ChemIDplus] synonym: "H-COOH" RELATED [IUPAC] synonym: "HCO2H" RELATED [ChEBI] synonym: "HCOOH" RELATED [NIST_Chemistry_WebBook] synonym: "hydrogen carboxylic acid" RELATED [ChemIDplus] synonym: "Methanoic acid" RELATED [KEGG_COMPOUND] synonym: "methoic acid" RELATED [ChEBI] xref: Beilstein:1209246 {source="Beilstein"} xref: BPDB:1749 xref: CAS:64-18-6 {source="NIST Chemistry WebBook"} xref: CAS:64-18-6 {source="ChemIDplus"} xref: CAS:64-18-6 {source="KEGG COMPOUND"} xref: DrugBank:DB01942 xref: Gmelin:1008 {source="Gmelin"} xref: HMDB:HMDB0000142 xref: KEGG:C00058 xref: KNApSAcK:C00001182 xref: LIPID_MAPS_instance:LMFA01010040 {source="LIPID MAPS"} xref: MetaCyc:FORMATE xref: Patent:CN101481304 xref: PDBeChem:FMT xref: PMID:12591956 {source="Europe PMC"} xref: PMID:14637377 {source="Europe PMC"} xref: PMID:15811469 {source="Europe PMC"} xref: PMID:16120414 {source="Europe PMC"} xref: PMID:16185830 {source="Europe PMC"} xref: PMID:16222862 {source="Europe PMC"} xref: PMID:16230297 {source="Europe PMC"} xref: PMID:16445901 {source="Europe PMC"} xref: PMID:16465784 {source="Europe PMC"} xref: PMID:18034701 {source="Europe PMC"} xref: PMID:18397576 {source="Europe PMC"} xref: PMID:22080171 {source="Europe PMC"} xref: PMID:22280475 {source="Europe PMC"} xref: PMID:22304812 {source="Europe PMC"} xref: PMID:22385261 {source="Europe PMC"} xref: PMID:22447125 {source="Europe PMC"} xref: PMID:22483350 {source="Europe PMC"} xref: PMID:22499553 {source="Europe PMC"} xref: PMID:22540994 {source="Europe PMC"} xref: PMID:22606986 {source="Europe PMC"} xref: PMID:22622393 {source="Europe PMC"} xref: PMID:3946945 {source="Europe PMC"} xref: PMID:7361809 {source="Europe PMC"} xref: Reaxys:1209246 {source="Reaxys"} xref: Wikipedia:Formic_acid is_a: CHEBI:25384 ! monocarboxylic acid relationship: is_conjugate_acid_of CHEBI:15740 ! formate relationship: RO:0000087 CHEBI:25212 ! has role metabolite relationship: RO:0000087 CHEBI:33282 ! has role antibacterial agent relationship: RO:0000087 CHEBI:48356 ! has role protic solvent relationship: RO:0000087 CHEBI:74783 ! has role astringent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CH2O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O2/c2-1-3/h1H,(H,2,3)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BDAGIHXWWSANSR-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "46.02538" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "46.00548" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C(O)=O" xsd:string [Term] id: CHEBI:30772 name: butyric acid namespace: chebi_ontology alt_id: CHEBI:113450 alt_id: CHEBI:22948 alt_id: CHEBI:3234 alt_id: CHEBI:41208 def: "A straight-chain saturated fatty acid that is butane in which one of the terminal methyl groups has been oxidised to a carboxy group." [] subset: 3_STAR synonym: "1-butanoic acid" RELATED [HMDB] synonym: "1-butyric acid" RELATED [HMDB] synonym: "1-propanecarboxylic acid" RELATED [MetaCyc] synonym: "4:0" RELATED [ChEBI] synonym: "acide butanoique" RELATED [IUPAC] synonym: "acide butyrique" RELATED [ChEBI] synonym: "butanic acid" RELATED [ChEBI] synonym: "Butanoate" RELATED [KEGG_COMPOUND] synonym: "BUTANOIC ACID" RELATED [PDBeChem] synonym: "Butanoic acid" RELATED [KEGG_COMPOUND] synonym: "butanoic acid" EXACT IUPAC_NAME [IUPAC] synonym: "butoic acid" RELATED [ChEBI] synonym: "Buttersaeure" RELATED [ChEBI] synonym: "Butyric acid" EXACT [KEGG_COMPOUND] synonym: "butyric acid" EXACT [IUPAC] synonym: "C4:0" RELATED [ChEBI] synonym: "CH3-[CH2]2-COOH" RELATED [IUPAC] synonym: "ethylacetic acid" RELATED [NIST_Chemistry_WebBook] synonym: "n-butanoic acid" RELATED [NIST_Chemistry_WebBook] synonym: "n-butyric acid" RELATED [NIST_Chemistry_WebBook] synonym: "propanecarboxylic acid" RELATED [HMDB] synonym: "propylformic acid" RELATED [MetaCyc] xref: Beilstein:906770 {source="Beilstein"} xref: CAS:107-92-6 {source="ChemIDplus"} xref: CAS:107-92-6 {source="NIST Chemistry WebBook"} xref: CAS:107-92-6 {source="KEGG COMPOUND"} xref: DrugBank:DB03568 xref: Gmelin:26242 {source="Gmelin"} xref: HMDB:HMDB0000039 xref: KEGG:C00246 xref: KNApSAcK:C00001180 xref: LIPID_MAPS_instance:LMFA01010004 {source="LIPID MAPS"} xref: MetaCyc:BUTYRIC_ACID xref: PDBeChem:BUA xref: PMID:10736622 {source="Europe PMC"} xref: PMID:10956204 {source="ChEMBL"} xref: PMID:11201044 {source="Europe PMC"} xref: PMID:11208715 {source="Europe PMC"} xref: PMID:11238216 {source="Europe PMC"} xref: PMID:11305323 {source="Europe PMC"} xref: PMID:12068484 {source="Europe PMC"} xref: PMID:13678314 {source="Europe PMC"} xref: PMID:14962641 {source="Europe PMC"} xref: PMID:1542095 {source="ChEMBL"} xref: PMID:15809727 {source="Europe PMC"} xref: PMID:15810631 {source="Europe PMC"} xref: PMID:15938880 {source="Europe PMC"} xref: PMID:19318247 {source="Europe PMC"} xref: PMID:19366864 {source="Europe PMC"} xref: PMID:19703412 {source="Europe PMC"} xref: PMID:21699495 {source="Europe PMC"} xref: PMID:22038864 {source="Europe PMC"} xref: PMID:22194341 {source="Europe PMC"} xref: PMID:22322557 {source="Europe PMC"} xref: PMID:22339023 {source="Europe PMC"} xref: PMID:22466881 {source="Europe PMC"} xref: Reaxys:906770 {source="Reaxys"} xref: Wikipedia:Butyric_acid is_a: CHEBI:140601 ! fatty acid 4:0 is_a: CHEBI:39418 ! straight-chain saturated fatty acid relationship: is_conjugate_acid_of CHEBI:17968 ! butyrate relationship: RO:0000087 CHEBI:131604 ! has role Mycoplasma genitalium metabolite relationship: RO:0000087 CHEBI:84087 ! has role human urinary metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H8O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H8O2/c1-2-3-4(5)6/h2-3H2,1H3,(H,5,6)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "FERIUCNNQQJTOY-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "88.10510" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "88.05243" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCCC(O)=O" xsd:string [Term] id: CHEBI:30879 name: alcohol namespace: chebi_ontology alt_id: CHEBI:13804 alt_id: CHEBI:22288 alt_id: CHEBI:2553 def: "A compound in which a hydroxy group, -OH, is attached to a saturated carbon atom." [ANON:ANON] subset: 3_STAR synonym: "Alcohol" EXACT [KEGG COMPOUND:] synonym: "Alcohol" EXACT [KEGG_COMPOUND] synonym: "alcohols" EXACT IUPAC_NAME [IUPAC] synonym: "alcohols" EXACT IUPAC_NAME [IUPAC:] synonym: "an alcohol" RELATED [UniProt] synonym: "CHOR3" RELATED FORMULA [ChEBI:] synonym: "HOR" RELATED FORMULA [KEGG COMPOUND:] synonym: "OC([*])([*])[*]" RELATED SMILES [ChEBI:] xref: KEGG:C00069 is_a: CHEBI:33822 ! organic hydroxy compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HOR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "17.007" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00274" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "O[*]" xsd:string [Term] id: CHEBI:3098 name: bile acid namespace: chebi_ontology def: "Any member of a group of hydroxy-5beta-cholanic acids occuring in bile, where they are present as the sodium salts of their amides with glycine or taurine. In mammals bile acids almost invariably have 5beta-configuration." [] subset: 3_STAR synonym: "5beta-bile acid" RELATED [ChEBI] synonym: "5beta-bile acids" RELATED [ChEBI] synonym: "Bile acid" EXACT [KEGG_COMPOUND] synonym: "bile acids" RELATED [ChEBI] synonym: "Bile salt" RELATED [KEGG_COMPOUND] synonym: "Gallensaeure" RELATED [ChEBI] synonym: "Gallensaeuren" RELATED [ChEBI] xref: KEGG:C01558 is_a: CHEBI:138366 ! bile acids is_a: CHEBI:24663 ! hydroxy-5beta-cholanic acid [Term] id: CHEBI:32507 name: glycinium namespace: chebi_ontology def: "An alpha-amino-acid cation that is the conjugate acid of glycine, arising from protonation of the amino." [] subset: 3_STAR synonym: "carboxymethanaminium" RELATED [IUPAC] synonym: "glycine cation" RELATED [JCBN] synonym: "glycinium" EXACT IUPAC_NAME [IUPAC] synonym: "H2gly(+)" RELATED [IUPAC] synonym: "NH3(+)-CH2-COOH" RELATED [IUPAC] xref: Gmelin:323509 {source="Gmelin"} is_a: CHEBI:33719 ! alpha-amino-acid cation relationship: is_conjugate_acid_of CHEBI:15428 ! glycine relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H6NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "76.07458" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "76.03930" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CC(O)=O" xsd:string [Term] id: CHEBI:32508 name: glycinate namespace: chebi_ontology def: "An alpha-amino-acid anion that is the conjugate base of glycine, arising from deprotonation of the carboxy group." [] subset: 3_STAR synonym: "aminoacetate" RELATED [IUPAC] synonym: "gly(-)" RELATED [IUPAC] synonym: "glycinate" EXACT IUPAC_NAME [IUPAC] synonym: "glycine anion" RELATED [JCBN] synonym: "H2N-CH2-COO(-)" RELATED [IUPAC] xref: Beilstein:1852023 {source="Beilstein"} xref: Gmelin:81890 {source="Gmelin"} xref: Reaxys:1852023 {source="Reaxys"} xref: UM-BBD_compID:c0559 {source="UM-BBD"} is_a: CHEBI:33558 ! alpha-amino-acid anion relationship: is_conjugate_base_of CHEBI:15428 ! glycine relationship: RO:0000087 CHEBI:78675 ! has role fundamental metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02475" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC([O-])=O" xsd:string [Term] id: CHEBI:32952 name: amine namespace: chebi_ontology alt_id: CHEBI:13814 alt_id: CHEBI:22474 alt_id: CHEBI:2641 def: "A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups." [ANON:ANON] subset: 3_STAR synonym: "Amin" RELATED [ChEBI] synonym: "Amin" RELATED [ChEBI:] synonym: "Amine" EXACT [KEGG_COMPOUND] synonym: "Amine" EXACT [KEGG COMPOUND:] synonym: "amines" EXACT IUPAC_NAME [IUPAC:] synonym: "amines" EXACT IUPAC_NAME [IUPAC] synonym: "an amine" RELATED [UniProt:] synonym: "Substituted amine" RELATED [KEGG_COMPOUND] xref: KEGG:C00706 is_a: CHEBI:50047 ! organic amino compound [Term] id: CHEBI:32988 name: amide namespace: chebi_ontology alt_id: CHEBI:22473 alt_id: CHEBI:2633 def: "An amide is a derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group." [ANON:ANON] subset: 3_STAR synonym: "Amide" EXACT [KEGG_COMPOUND] synonym: "Amide" EXACT [KEGG COMPOUND:] synonym: "amides" EXACT IUPAC_NAME [IUPAC] synonym: "amides" EXACT IUPAC_NAME [IUPAC:] xref: KEGG:C00241 is_a: CHEBI:51143 ! nitrogen molecular entity [Term] id: CHEBI:3306 name: calcitonin namespace: chebi_ontology def: "A 32-membered heterodetic cyclic peptide comprising the sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 cyclised by a disulfide bridge between the two Cys residues at positions 1 and 7." [] subset: 3_STAR synonym: "Calcitonin" EXACT [KEGG_COMPOUND] synonym: "calcitonin" RELATED INN [ChemIDplus] synonym: "Calcitonin, salmon" RELATED [KEGG_COMPOUND] synonym: "Cibacalcin" RELATED [KEGG_COMPOUND] synonym: "cyclo-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2" RELATED [ChEBI] synonym: "N-{[(4R,7S,10S,13S,16S,19S,22R)-22-amino-16-(2-amino-2-oxoethyl)-7-[(1R)-1-hydroxyethyl]-10,19-bis(hydroxymethyl)-13-isobutyl-6,9,12,15,18,21-hexaoxo-1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosan-4-yl]carbonyl}-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparaginyl-L-threonylglycyl-L-serylglycyl-L-threonyl-L-prolinamide" EXACT IUPAC_NAME [IUPAC] synonym: "Salmon calcitonin" RELATED [ChemIDplus] synonym: "Salmon calcitonin-(1-32)" RELATED [ChemIDplus] synonym: "Salmotonin" RELATED [DrugBank] synonym: "Thyrocalcitonin (salmon)" RELATED [ChemIDplus] xref: CAS:47931-85-1 {source="ChemIDplus"} xref: CAS:47931-85-1 {source="KEGG COMPOUND"} xref: CAS:9007-12-9 {source="KEGG COMPOUND"} xref: Drug_Central:2989 {source="DrugCentral"} xref: DrugBank:DB00017 xref: KEGG:C06865 xref: KEGG:D00249 xref: Reaxys:8186880 {source="Reaxys"} xref: Wikipedia:Calcitonin is_a: CHEBI:15841 ! polypeptide is_a: CHEBI:24533 ! heterodetic cyclic peptide is_a: CHEBI:25905 ! peptide hormone relationship: RO:0000087 CHEBI:25212 ! has role metabolite relationship: RO:0000087 CHEBI:50646 ! has role bone density conservation agent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C145H240N44O48S2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C145H240N44O48S2/c1-65(2)45-86(175-139(232)110(70(11)12)183-136(229)99-63-239-238-62-79(148)117(210)178-96(59-191)134(227)174-92(52-104(151)202)131(224)172-90(49-69(9)10)129(222)180-98(61-193)135(228)187-114(74(16)197)142(235)181-99)118(211)158-55-106(204)162-80(25-18-20-40-146)120(213)169-89(48-68(7)8)128(221)179-97(60-192)133(226)167-83(34-37-102(149)200)122(215)165-85(36-39-109(207)208)123(216)171-88(47-67(5)6)127(220)173-91(51-77-54-156-64-161-77)130(223)164-81(26-19-21-41-147)121(214)170-87(46-66(3)4)126(219)166-84(35-38-103(150)201)125(218)186-113(73(15)196)141(234)177-94(50-76-30-32-78(199)33-31-76)143(236)189-44-24-29-101(189)137(230)168-82(27-22-42-157-145(154)155)124(217)185-112(72(14)195)140(233)176-93(53-105(152)203)132(225)184-111(71(13)194)138(231)160-56-107(205)163-95(58-190)119(212)159-57-108(206)182-115(75(17)198)144(237)188-43-23-28-100(188)116(153)209/h30-33,54,64-75,79-101,110-115,190-199H,18-29,34-53,55-63,146-148H2,1-17H3,(H2,149,200)(H2,150,201)(H2,151,202)(H2,152,203)(H2,153,209)(H,156,161)(H,158,211)(H,159,212)(H,160,231)(H,162,204)(H,163,205)(H,164,223)(H,165,215)(H,166,219)(H,167,226)(H,168,230)(H,169,213)(H,170,214)(H,171,216)(H,172,224)(H,173,220)(H,174,227)(H,175,232)(H,176,233)(H,177,234)(H,178,210)(H,179,221)(H,180,222)(H,181,235)(H,182,206)(H,183,229)(H,184,225)(H,185,217)(H,186,218)(H,187,228)(H,207,208)(H4,154,155,157)/t71-,72-,73-,74-,75-,79+,80+,81+,82+,83+,84+,85+,86+,87+,88+,89+,90+,91+,92+,93+,94+,95+,96+,97+,98+,99+,100+,101+,110+,111+,112+,113+,114+,115+/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BBBFJLBPOGFECG-VJVYQDLKSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "3431.85300" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3429.71331" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1)C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O" xsd:string [Term] id: CHEBI:33232 name: application namespace: chebi_ontology def: "Intended use of the molecular entity or part thereof by humans." [] subset: 3_STAR is_a: BFO:0000023 ! role is_a: CHEBI:50906 ! role [Term] id: CHEBI:33233 name: fundamental particle namespace: chebi_ontology def: "A particle not known to have substructure." [] subset: 3_STAR synonym: "elementary particle" EXACT IUPAC_NAME [IUPAC] synonym: "elementary particles" RELATED [ChEBI] is_a: CHEBI:36342 ! subatomic particle [Term] id: CHEBI:33238 name: monoatomic entity namespace: chebi_ontology def: "A monoatomic entity is a molecular entity consisting of a single atom." [] subset: 3_STAR synonym: "atomic entity" RELATED [ChEBI] synonym: "monoatomic entities" RELATED [ChEBI] is_a: CHEBI:33259 ! elemental molecular entity [Term] id: CHEBI:33241 name: oxoacid derivative namespace: chebi_ontology subset: 3_STAR synonym: "oxoacid derivatives" RELATED [ChEBI] is_a: CHEBI:37577 ! heteroatomic molecular entity relationship: has_functional_parent CHEBI:24833 ! oxoacid [Term] id: CHEBI:33242 name: inorganic hydride namespace: chebi_ontology subset: 3_STAR synonym: "inorganic hydrides" RELATED [ChEBI] is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:33692 ! hydrides [Term] id: CHEBI:33245 name: organic fundamental parent namespace: chebi_ontology def: "An organic fundamental parent is a structure used as a basis for substitutive names in organic nomenclature, containing, in addition to one or more hydrogen atoms, a single atom of an element, a number of atoms (alike or different) linked together to form an unbranched chain, a monocyclic or polycyclic ring system, or a ring assembly or ring/chain system." [] subset: 3_STAR synonym: "organic fundamental parents" RELATED [ChEBI] synonym: "organic parent hydrides" RELATED [ChEBI] is_a: CHEBI:37175 ! organic hydride is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33246 name: inorganic group namespace: chebi_ontology def: "Any substituent group which does not contain carbon." [] subset: 3_STAR synonym: "inorganic groups" RELATED [ChEBI] is_a: CHEBI:24433 ! group [Term] id: CHEBI:33247 name: organic group namespace: chebi_ontology def: "Any substituent group or skeleton containing carbon." [] subset: 3_STAR synonym: "organic groups" RELATED [ChEBI] is_a: CHEBI:24433 ! group relationship: is_substituent_group_from CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33249 name: organyl group namespace: chebi_ontology def: "Any organic substituent group, regardless of functional type, having one free valence at a carbon atom." [] subset: 3_STAR synonym: "groupe organyle" RELATED [IUPAC] synonym: "grupo organilo" RELATED [IUPAC] synonym: "grupos organilo" RELATED [IUPAC] synonym: "organyl group" EXACT IUPAC_NAME [IUPAC] synonym: "organyl groups" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:51447 ! organic univalent group [Term] id: CHEBI:33250 name: atom namespace: chebi_ontology alt_id: CHEBI:22671 alt_id: CHEBI:23907 def: "A chemical entity constituting the smallest component of an element having the chemical properties of the element." [] subset: 3_STAR synonym: "atom" EXACT IUPAC_NAME [IUPAC] synonym: "atome" RELATED [IUPAC] synonym: "atomo" RELATED [IUPAC] synonym: "atoms" RELATED [ChEBI] synonym: "atomus" RELATED [ChEBI] synonym: "element" RELATED [ChEBI] synonym: "elements" RELATED [ChEBI] is_a: CHEBI:24431 ! chemical entity relationship: has_part CHEBI:10545 ! electron relationship: has_part CHEBI:33252 ! atomic nucleus [Term] id: CHEBI:33252 name: atomic nucleus namespace: chebi_ontology def: "A nucleus is the positively charged central portion of an atom, excluding the orbital electrons." [] subset: 3_STAR synonym: "Atomkern" RELATED [ChEBI] synonym: "Kern" RELATED [ChEBI] synonym: "noyau" RELATED [IUPAC] synonym: "noyau atomique" RELATED [ChEBI] synonym: "nuclei" RELATED [ChEBI] synonym: "nucleo" RELATED [IUPAC] synonym: "nucleo atomico" RELATED [ChEBI] synonym: "nucleus" EXACT IUPAC_NAME [IUPAC] synonym: "nucleus atomi" RELATED [ChEBI] is_a: CHEBI:36347 ! nuclear particle relationship: has_part CHEBI:33253 ! nucleon [Term] id: CHEBI:33253 name: nucleon namespace: chebi_ontology def: "Heavy nuclear particle: proton or neutron." [] subset: 3_STAR synonym: "nucleon" EXACT [IUPAC] synonym: "nucleon" EXACT IUPAC_NAME [IUPAC] synonym: "nucleons" RELATED [ChEBI] synonym: "Nukleon" RELATED [ChEBI] synonym: "Nukleonen" RELATED [ChEBI] is_a: CHEBI:36339 ! baryon is_a: CHEBI:36347 ! nuclear particle [Term] id: CHEBI:33256 name: primary amide namespace: chebi_ontology def: "A derivative of an oxoacid RkE(=O)l(OH)m (l =/= 0) in which an acidic hydroxy group has been replaced by an amino or substituted amino group." [ANON:ANON] subset: 3_STAR synonym: "primary amide" EXACT [IUPAC:] synonym: "primary amide" EXACT [IUPAC] synonym: "primary amides" EXACT IUPAC_NAME [IUPAC] synonym: "primary amides" EXACT IUPAC_NAME [IUPAC:] is_a: CHEBI:32988 ! amide [Term] id: CHEBI:33259 name: elemental molecular entity namespace: chebi_ontology def: "A molecular entity all atoms of which have the same atomic number." [] subset: 3_STAR synonym: "homoatomic entity" RELATED [ChEBI] synonym: "homoatomic molecular entities" RELATED [ChEBI] synonym: "homoatomic molecular entity" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity [Term] id: CHEBI:33262 name: elemental oxygen namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:25806 ! oxygen molecular entity is_a: CHEBI:33259 ! elemental molecular entity [Term] id: CHEBI:33263 name: diatomic oxygen namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:33262 ! elemental oxygen property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "31.999" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "31.98983" xsd:string [Term] id: CHEBI:33273 name: polyatomic anion namespace: chebi_ontology def: "An anion consisting of more than one atom." [] subset: 3_STAR synonym: "polyatomic anions" RELATED [ChEBI] is_a: CHEBI:22563 ! anion is_a: CHEBI:36358 ! polyatomic ion [Term] id: CHEBI:33280 name: molecular messenger namespace: chebi_ontology subset: 3_STAR synonym: "chemical messenger" RELATED [ChEBI] is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:33281 name: antimicrobial agent namespace: chebi_ontology alt_id: CHEBI:22582 def: "A substance that kills or slows the growth of microorganisms, including bacteria, viruses, fungi and protozoans." [] subset: 3_STAR synonym: "antibiotic" RELATED [ChEBI] synonym: "antibiotics" RELATED [ChEBI] synonym: "Antibiotika" RELATED [ChEBI] synonym: "Antibiotikum" RELATED [ChEBI] synonym: "antibiotique" RELATED [IUPAC] synonym: "antimicrobial" RELATED [ChEBI] synonym: "antimicrobial agents" RELATED [ChEBI] synonym: "antimicrobials" RELATED [ChEBI] synonym: "microbicide" RELATED [ChEBI] synonym: "microbicides" RELATED [ChEBI] xref: PMID:12964249 {source="Europe PMC"} xref: PMID:22117953 {source="Europe PMC"} xref: PMID:22439833 {source="Europe PMC"} xref: PMID:22849268 {source="Europe PMC"} xref: PMID:22849276 {source="Europe PMC"} xref: PMID:22958833 {source="Europe PMC"} is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:33282 name: antibacterial agent namespace: chebi_ontology def: "A substance (or active part thereof) that kills or slows the growth of bacteria." [] subset: 3_STAR synonym: "antibacterial agents" RELATED [ChEBI] synonym: "antibacterials" RELATED [ChEBI] synonym: "bactericide" RELATED [ChEBI] synonym: "bactericides" RELATED [ChEBI] is_a: CHEBI:33281 ! antimicrobial agent [Term] id: CHEBI:33284 name: nutrient namespace: chebi_ontology def: "A nutrient is a food component that an organism uses to survive and grow." [] subset: 3_STAR synonym: "nutrients" RELATED [ChEBI] is_a: CHEBI:78295 ! food component [Term] id: CHEBI:33285 name: heteroorganic entity namespace: chebi_ontology def: "A heteroorganic entity is an organic molecular entity in which carbon atoms or organic groups are bonded directly to one or more heteroatoms." [ANON:ANON] subset: 3_STAR synonym: "heteroorganic entities" RELATED [ChEBI:] synonym: "heteroorganic entities" RELATED [ChEBI] synonym: "organoelement compounds" RELATED [ChEBI:] synonym: "organoelement compounds" RELATED [ChEBI] is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33286 name: agrochemical namespace: chebi_ontology def: "An agrochemical is a substance that is used in agriculture or horticulture." [] subset: 3_STAR synonym: "agrichemical" RELATED [ChEBI] synonym: "agrichemicals" RELATED [ChEBI] synonym: "agricultural chemicals" RELATED [ChEBI] synonym: "agrochemicals" RELATED [ChEBI] xref: Wikipedia:Agrochemical is_a: CHEBI:33232 ! application [Term] id: CHEBI:33287 name: fertilizer namespace: chebi_ontology def: "A fertilizer is any substance that is added to soil or water to assist the growth of plants." [] subset: 3_STAR synonym: "fertiliser" RELATED [ChEBI] synonym: "fertilizers" RELATED [ChEBI] is_a: CHEBI:33286 ! agrochemical [Term] id: CHEBI:33295 name: diagnostic agent namespace: chebi_ontology def: "A substance administered to aid diagnosis of a disease." [] subset: 3_STAR synonym: "diagnostic aid" RELATED [ChEBI] is_a: CHEBI:52217 ! pharmaceutical [Term] id: CHEBI:33296 name: alkali metal molecular entity namespace: chebi_ontology def: "A molecular entity containing one or more atoms of an alkali metal." [] subset: 3_STAR synonym: "alkali metal molecular entities" RELATED [ChEBI] is_a: CHEBI:33674 ! s-block molecular entity relationship: has_part CHEBI:22314 ! alkali metal atom [Term] id: CHEBI:33299 name: alkaline earth molecular entity namespace: chebi_ontology def: "An alkaline earth molecular entity is a molecular entity containing one or more atoms of an alkaline earth metal." [] subset: 3_STAR synonym: "alkaline earth compounds" RELATED [ChEBI] synonym: "alkaline earth molecular entities" RELATED [ChEBI] synonym: "alkaline earth molecular entity" EXACT [ChEBI] synonym: "alkaline-earth compounds" RELATED [ChEBI] is_a: CHEBI:33674 ! s-block molecular entity relationship: has_part CHEBI:22313 ! alkaline earth metal atom [Term] id: CHEBI:33300 name: pnictogen namespace: chebi_ontology def: "Any p-block element atom that is in group 15 of the periodic table: nitrogen, phosphorus, arsenic, antimony and bismuth." [] subset: 3_STAR synonym: "group 15 elements" RELATED [ChEBI] synonym: "group V elements" RELATED [ChEBI] synonym: "nitrogenoideos" RELATED [ChEBI] synonym: "nitrogenoides" RELATED [ChEBI] synonym: "pnictogene" RELATED [ChEBI] synonym: "pnictogenes" RELATED [ChEBI] synonym: "pnictogens" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33560 ! p-block element atom [Term] id: CHEBI:33302 name: pnictogen molecular entity namespace: chebi_ontology def: "A p-block molecular entity containing any pnictogen." [] subset: 3_STAR synonym: "pnictogen molecular entities" RELATED [ChEBI:] synonym: "pnictogen molecular entities" RELATED [ChEBI] synonym: "pnictogen molecular entity" EXACT [ChEBI] synonym: "pnictogen molecular entity" EXACT [ChEBI:] is_a: CHEBI:33675 ! p-block molecular entity relationship: has_part CHEBI:33300 ! pnictogen [Term] id: CHEBI:33303 name: chalcogen namespace: chebi_ontology def: "Any p-block element belonging to the group 16 family of the periodic table." [] subset: 3_STAR synonym: "anfigeno" RELATED [ChEBI] synonym: "anfigenos" RELATED [ChEBI] synonym: "calcogeno" RELATED [ChEBI] synonym: "calcogenos" RELATED [ChEBI] synonym: "chalcogen" EXACT IUPAC_NAME [IUPAC] synonym: "chalcogene" RELATED [ChEBI] synonym: "chalcogenes" RELATED [ChEBI] synonym: "chalcogens" EXACT IUPAC_NAME [IUPAC] synonym: "Chalkogen" RELATED [ChEBI] synonym: "Chalkogene" RELATED [ChEBI] synonym: "group 16 elements" RELATED [ChEBI] synonym: "group VI elements" RELATED [ChEBI] xref: PMID:17084588 {source="Europe PMC"} is_a: CHEBI:33560 ! p-block element atom [Term] id: CHEBI:33304 name: chalcogen molecular entity namespace: chebi_ontology def: "Any p-block molecular entity containing a chalcogen." [ANON:ANON] subset: 3_STAR synonym: "chalcogen compounds" RELATED [ChEBI:] synonym: "chalcogen compounds" RELATED [ChEBI] synonym: "chalcogen molecular entities" RELATED [ChEBI:] synonym: "chalcogen molecular entities" RELATED [ChEBI] synonym: "chalcogen molecular entity" EXACT [ChEBI] synonym: "chalcogen molecular entity" EXACT [ChEBI:] is_a: CHEBI:33675 ! p-block molecular entity relationship: has_part CHEBI:33303 ! chalcogen [Term] id: CHEBI:33306 name: carbon group element atom namespace: chebi_ontology subset: 3_STAR synonym: "carbon group element" RELATED [ChEBI] synonym: "carbon group elements" RELATED [ChEBI] synonym: "carbonoides" RELATED [ChEBI] synonym: "cristallogene" RELATED [ChEBI] synonym: "cristallogenes" RELATED [ChEBI] synonym: "group 14 elements" EXACT IUPAC_NAME [IUPAC] synonym: "group IV elements" RELATED [ChEBI] is_a: CHEBI:33560 ! p-block element atom [Term] id: CHEBI:33308 name: carboxylic ester namespace: chebi_ontology alt_id: CHEBI:13204 alt_id: CHEBI:23028 alt_id: CHEBI:3408 def: "An ester of a carboxylic acid, R(1)C(=O)OR(2), where R(1) = H or organyl and R(2) = organyl." [] def: "An ester of a carboxylic acid." [ANON:ANON] subset: 3_STAR synonym: "a carboxylic ester" RELATED [UniProt] synonym: "carboxylic acid esters" RELATED [ChEBI] synonym: "carboxylic acid esters" RELATED [ChEBI:] synonym: "Carboxylic ester" EXACT [KEGG_COMPOUND] synonym: "Carboxylic ester" EXACT [KEGG COMPOUND:] synonym: "carboxylic ester" EXACT [UniProt:] synonym: "carboxylic esters" EXACT IUPAC_NAME [IUPAC:] synonym: "carboxylic esters" EXACT IUPAC_NAME [IUPAC] synonym: "CO2R2" RELATED FORMULA [KEGG COMPOUND:] xref: KEGG:C02391 xref: Wikipedia:Ester is_a: CHEBI:35701 ! ester is_a: CHEBI:36586 ! carbonyl compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.010" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C(=O)O[*]" xsd:string [Term] id: CHEBI:33318 name: main group element atom namespace: chebi_ontology def: "An atom belonging to one of the main groups (found in the s- and p- blocks) of the periodic table." [] subset: 3_STAR synonym: "Hauptgruppenelement" RELATED [ChEBI] synonym: "Hauptgruppenelemente" RELATED [ChEBI] synonym: "main group element" RELATED [ChEBI] synonym: "main group elements" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33250 ! atom [Term] id: CHEBI:33356 name: iron group element atom namespace: chebi_ontology subset: 3_STAR synonym: "group 8 elements" EXACT IUPAC_NAME [IUPAC] synonym: "iron group element" RELATED [ChEBI] synonym: "iron group elements" RELATED [ChEBI] is_a: CHEBI:33561 ! d-block element atom [Term] id: CHEBI:33402 name: sulfur oxoacid namespace: chebi_ontology subset: 3_STAR synonym: "oxoacids of sulfur" RELATED [ChEBI] synonym: "sulfur oxoacids" RELATED [ChEBI] is_a: CHEBI:26835 ! sulfur molecular entity is_a: CHEBI:33484 ! chalcogen oxoacid [Term] id: CHEBI:33408 name: pnictogen oxoacid namespace: chebi_ontology subset: 3_STAR synonym: "pnictogen oxoacids" RELATED [ChEBI] is_a: CHEBI:24833 ! oxoacid is_a: CHEBI:33302 ! pnictogen molecular entity relationship: RO:0000087 CHEBI:138103 ! has role inorganic acid [Term] id: CHEBI:33424 name: sulfur oxoacid derivative namespace: chebi_ontology subset: 3_STAR synonym: "sulfur oxoacid derivative" EXACT [ChEBI] synonym: "sulfur oxoacid derivatives" RELATED [ChEBI] is_a: CHEBI:26835 ! sulfur molecular entity is_a: CHEBI:33241 ! oxoacid derivative [Term] id: CHEBI:33457 name: phosphorus oxoacid namespace: chebi_ontology def: "A pnictogen oxoacid which contains phosphorus and oxygen, at least one hydrogen atom bound to oxygen, and forms an ion by the loss of one or more protons." [] subset: 3_STAR synonym: "oxoacids of phosphorus" RELATED [ChEBI] synonym: "Oxosaeure des Phosphors" RELATED [ChEBI] synonym: "phosphorus oxoacid" EXACT [ChEBI] synonym: "phosphorus oxoacids" RELATED [ChEBI] is_a: CHEBI:33408 ! pnictogen oxoacid is_a: CHEBI:36360 ! phosphorus oxoacids and derivatives [Term] id: CHEBI:33459 name: pnictogen oxoanion namespace: chebi_ontology subset: 3_STAR synonym: "pnictogen oxoanion" EXACT [ChEBI] synonym: "pnictogen oxoanions" RELATED [ChEBI] is_a: CHEBI:33302 ! pnictogen molecular entity is_a: CHEBI:35406 ! oxoanion [Term] id: CHEBI:33461 name: phosphorus oxoanion namespace: chebi_ontology subset: 3_STAR synonym: "oxoanions of phosphorus" RELATED [ChEBI] synonym: "phosphorus oxoanion" EXACT [ChEBI] synonym: "phosphorus oxoanions" RELATED [ChEBI] is_a: CHEBI:24834 ! inorganic anion is_a: CHEBI:26082 ! phosphorus molecular entity is_a: CHEBI:33459 ! pnictogen oxoanion [Term] id: CHEBI:33482 name: sulfur oxoanion namespace: chebi_ontology subset: 3_STAR synonym: "oxoanions of sulfur" RELATED [ChEBI] synonym: "sulfur oxoanion" EXACT [ChEBI] synonym: "sulfur oxoanions" RELATED [ChEBI] is_a: CHEBI:26835 ! sulfur molecular entity is_a: CHEBI:33485 ! chalcogen oxoanion [Term] id: CHEBI:33484 name: chalcogen oxoacid namespace: chebi_ontology subset: 3_STAR synonym: "chalcogen oxoacid" EXACT [ChEBI] synonym: "chalcogen oxoacids" RELATED [ChEBI] is_a: CHEBI:24833 ! oxoacid relationship: RO:0000087 CHEBI:138103 ! has role inorganic acid [Term] id: CHEBI:33485 name: chalcogen oxoanion namespace: chebi_ontology subset: 3_STAR synonym: "chalcogen oxoanion" EXACT [ChEBI] synonym: "chalcogen oxoanions" RELATED [ChEBI] is_a: CHEBI:35406 ! oxoanion [Term] id: CHEBI:33497 name: transition element molecular entity namespace: chebi_ontology def: "A molecular entity containing one or more atoms of a transition element." [] subset: 3_STAR synonym: "transition element molecular entities" RELATED [ChEBI] synonym: "transition metal molecular entity" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity relationship: has_part CHEBI:27081 ! transition element atom [Term] id: CHEBI:33504 name: alkali metal cation namespace: chebi_ontology subset: 3_STAR synonym: "alkali metal cations" RELATED [ChEBI] is_a: CHEBI:25213 ! metal cation [Term] id: CHEBI:33513 name: alkaline earth cation namespace: chebi_ontology subset: 3_STAR synonym: "alkaline earth cations" RELATED [ChEBI] synonym: "alkaline earth metal cation" RELATED [ChEBI] synonym: "alkaline-earth metal cations" RELATED [ChEBI] is_a: CHEBI:25213 ! metal cation is_a: CHEBI:33299 ! alkaline earth molecular entity [Term] id: CHEBI:33515 name: transition element cation namespace: chebi_ontology subset: 3_STAR synonym: "transition element cations" RELATED [ChEBI] synonym: "transition metal cation" RELATED [ChEBI] is_a: CHEBI:25213 ! metal cation [Term] id: CHEBI:33521 name: metal atom namespace: chebi_ontology alt_id: CHEBI:25217 alt_id: CHEBI:6788 def: "An atom of an element that exhibits typical metallic properties, being typically shiny, with high electrical and thermal conductivity." [] subset: 3_STAR synonym: "elemental metal" RELATED [ChEBI] synonym: "elemental metals" RELATED [ChEBI] synonym: "metal element" RELATED [ChEBI] synonym: "metal elements" RELATED [ChEBI] synonym: "metals" RELATED [ChEBI] xref: KEGG:C00050 xref: PMID:21784043 {source="Europe PMC"} xref: Wikipedia:Metal is_a: CHEBI:33250 ! atom [Term] id: CHEBI:33558 name: alpha-amino-acid anion namespace: chebi_ontology def: "An amino-acid anion obtained by deprotonation of any alpha-amino acid." [] subset: 3_STAR synonym: "alpha-amino acid anions" RELATED [ChEBI] synonym: "alpha-amino-acid anion" EXACT [ChEBI] synonym: "alpha-amino-acid anions" RELATED [ChEBI] is_a: CHEBI:37022 ! amino-acid anion relationship: is_conjugate_base_of CHEBI:33704 ! alpha-amino acid [Term] id: CHEBI:33559 name: s-block element atom namespace: chebi_ontology subset: 3_STAR synonym: "s-block element" RELATED [ChEBI] synonym: "s-block elements" RELATED [ChEBI] is_a: CHEBI:33250 ! atom [Term] id: CHEBI:33560 name: p-block element atom namespace: chebi_ontology def: "Any main group element atom belonging to the p-block of the periodic table." [] subset: 3_STAR synonym: "p-block element" RELATED [ChEBI] synonym: "p-block elements" RELATED [ChEBI] is_a: CHEBI:33318 ! main group element atom [Term] id: CHEBI:33561 name: d-block element atom namespace: chebi_ontology subset: 3_STAR synonym: "d-block element" RELATED [ChEBI] synonym: "d-block elements" RELATED [ChEBI] is_a: CHEBI:27081 ! transition element atom [Term] id: CHEBI:33563 name: glycolipid namespace: chebi_ontology alt_id: CHEBI:24393 alt_id: CHEBI:5476 def: "Any member of class of 1,2-di-O-acylglycerols joined at oxygen 3 by a glycosidic linkage to a carbohydrate part (usually a mono-, di- or tri-saccharide). Some substances classified as bacterial glycolipids have the sugar part acylated by one or more fatty acids and the glycerol part may be absent." [] subset: 3_STAR synonym: "Glycolipid" EXACT [KEGG_COMPOUND] synonym: "glycolipids" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C05005 xref: Wikipedia:Glycolipids is_a: CHEBI:35740 ! liposaccharide [Term] id: CHEBI:33566 name: catechols namespace: chebi_ontology alt_id: CHEBI:134187 alt_id: CHEBI:13628 alt_id: CHEBI:18862 def: "Any compound containing an o-diphenol component." [] subset: 3_STAR synonym: "1,2-benzenediols" RELATED [ChEBI] synonym: "a catechol" RELATED [UniProt] synonym: "benzene-1,2-diols" RELATED [ChEBI] xref: KEGG:C15571 is_a: CHEBI:33570 ! benzenediols property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H2O2R4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "106.079" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "106.00548" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC1=C(O)C(*)=C(*)C(*)=C1*" xsd:string [Term] id: CHEBI:33567 name: catecholamine namespace: chebi_ontology alt_id: CHEBI:23056 alt_id: CHEBI:3468 def: "4-(2-Aminoethyl)pyrocatechol [4-(2-aminoethyl)benzene-1,2-diol] and derivatives formed by substitution." [ANON:ANON] subset: 3_STAR synonym: "C8H9NO2R2" RELATED FORMULA [KEGG COMPOUND:] synonym: "Catecholamine" EXACT [KEGG_COMPOUND] synonym: "Catecholamine" EXACT [KEGG COMPOUND:] synonym: "catecholamines" EXACT IUPAC_NAME [IUPAC] synonym: "catecholamines" EXACT IUPAC_NAME [IUPAC:] synonym: "catecholamines" RELATED [ChEBI] synonym: "catecholamines" RELATED [ChEBI:] xref: KEGG:C02012 is_a: CHEBI:25375 ! monoamine molecular messenger is_a: CHEBI:33566 ! catechols property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H9NO2R2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "151.163" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "151.06333" xsd:string [Term] id: CHEBI:33568 name: adrenaline namespace: chebi_ontology def: "A catecholamine in which the aminoethyl side-chain is hydroxy-substituted at C-1 and methylated on nitrogen." [] subset: 3_STAR synonym: "(+-)-adrenaline" RELATED [IUPHAR] synonym: "(+-)-epinephrine" RELATED [ChemIDplus] synonym: "2-(methylamino)-1-(3,4-dihydroxyphenyl)ethanol" RELATED [ChemIDplus] synonym: "4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC] synonym: "dl-adrenaline" RELATED [ChemIDplus] synonym: "epinephrine racemic" RELATED [ChemIDplus] synonym: "racepinefrina" RELATED INN [ChemIDplus] synonym: "racepinefrine" RELATED INN [ChemIDplus] synonym: "racepinefrinum" RELATED INN [ChemIDplus] xref: Beilstein:2212160 {source="ChemIDplus"} xref: CAS:329-65-7 {source="ChemIDplus"} xref: Drug_Central:4508 {source="DrugCentral"} xref: Gmelin:51559 {source="Gmelin"} xref: LINCS:LSM-4958 xref: PMID:10052027 {source="Europe PMC"} xref: PMID:24252294 {source="Europe PMC"} xref: PMID:24719616 {source="Europe PMC"} xref: Reaxys:2212160 {source="Reaxys"} is_a: CHEBI:33567 ! catecholamine relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C9H13NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C9H13NO3/c1-10-5-9(13)6-2-3-7(11)8(12)4-6/h2-4,9-13H,5H2,1H3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "UCTWMZQNUQWSLP-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "183.20446" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "183.08954" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CNCC(O)c1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:33569 name: noradrenaline namespace: chebi_ontology def: "A catecholamine in which C-1 of the aminoethyl side-chain is hydroxy-substituted." [] subset: 3_STAR synonym: "4-(2-amino-1-hydroxyethyl)benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC] synonym: "noradrenalina" RELATED [ChEBI] synonym: "norepinephrine" RELATED [ChEBI] xref: Beilstein:2210994 {source="Beilstein"} xref: CAS:138-65-8 {source="NIST Chemistry WebBook"} xref: CAS:138-65-8 {source="ChemIDplus"} xref: Gmelin:863925 {source="Gmelin"} xref: LINCS:LSM-5181 is_a: CHEBI:33567 ! catecholamine relationship: is_conjugate_base_of CHEBI:166902 ! noradrenaline(1+) relationship: RO:0000087 CHEBI:76967 ! has role human xenobiotic metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "169.17788" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "169.07389" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NCC(O)c1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:33570 name: benzenediols namespace: chebi_ontology alt_id: CHEBI:22705 alt_id: CHEBI:22711 subset: 3_STAR is_a: CHEBI:33853 ! phenols [Term] id: CHEBI:33571 name: (S)-noradrenaline namespace: chebi_ontology def: "The S-enantiomer of noradrenaline." [] subset: 3_STAR synonym: "4-[(1S)-2-amino-1-hydroxyethyl]benzene-1,2-diol" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:2937999 {source="Beilstein"} xref: LINCS:LSM-37072 xref: Reaxys:2937999 {source="Reaxys"} is_a: CHEBI:33569 ! noradrenaline relationship: is_enantiomer_of CHEBI:18357 ! (R)-noradrenaline property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H11NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2/t8-/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-MRVPVSSYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "169.17788" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "169.07389" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC[C@@H](O)c1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:33575 name: carboxylic acid namespace: chebi_ontology alt_id: CHEBI:13428 alt_id: CHEBI:13627 alt_id: CHEBI:23027 def: "A carbon oxoacid acid carrying at least one -C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid." [] def: "An oxoacid acid carrying at least one -C(=O)OH group and having the structure RC(=O)OH, where R is any any monovalent functional group. Carboxylic acids are the most common type of organic acid." [ANON:ANON] subset: 3_STAR synonym: "acide carboxylique" RELATED [IUPAC] synonym: "acide carboxylique" RELATED [IUPAC:] synonym: "acides carboxyliques" RELATED [IUPAC] synonym: "acides carboxyliques" RELATED [IUPAC:] synonym: "acido carboxilico" RELATED [IUPAC:] synonym: "acido carboxilico" RELATED [IUPAC] synonym: "acidos carboxilicos" RELATED [IUPAC] synonym: "acidos carboxilicos" RELATED [IUPAC:] synonym: "Carbonsaeure" RELATED [ChEBI] synonym: "Carbonsaeure" RELATED [ChEBI:] synonym: "Carbonsaeuren" RELATED [ChEBI:] synonym: "Carbonsaeuren" RELATED [ChEBI] synonym: "carboxylic acid" EXACT IUPAC_NAME [IUPAC:] synonym: "carboxylic acid" EXACT IUPAC_NAME [IUPAC] synonym: "carboxylic acids" EXACT IUPAC_NAME [IUPAC:] synonym: "carboxylic acids" EXACT IUPAC_NAME [IUPAC] synonym: "CHO2R" RELATED FORMULA [ChEBI:] synonym: "Karbonsaeure" RELATED [ChEBI] synonym: "Karbonsaeure" RELATED [ChEBI:] synonym: "OC([*])=O" RELATED SMILES [ChEBI:] synonym: "RC(=O)OH" RELATED [IUPAC] synonym: "RC(=O)OH" RELATED [IUPAC:] xref: PMID:17147560 {source="Europe PMC"} xref: PMID:18433345 {source="Europe PMC"} xref: Wikipedia:Carboxylic_acid is_a: CHEBI:35605 ! carbon oxoacid is_a: CHEBI:36586 ! carbonyl compound is_a: CHEBI:64709 ! organic acid relationship: has_part CHEBI:46883 ! carboxy group relationship: is_conjugate_acid_of CHEBI:29067 ! carboxylic acid anion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01740" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string [Term] id: CHEBI:33579 name: main group molecular entity namespace: chebi_ontology def: "A molecular entity containing one or more atoms from any of groups 1, 2, 13, 14, 15, 16, 17, and 18 of the periodic table." [ANON:ANON] subset: 3_STAR synonym: "main group compounds" RELATED [ChEBI:] synonym: "main group compounds" RELATED [ChEBI] synonym: "main group molecular entities" RELATED [ChEBI:] synonym: "main group molecular entities" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity relationship: has_part CHEBI:33318 ! main group element atom [Term] id: CHEBI:33582 name: carbon group molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "carbon group molecular entities" RELATED [ChEBI:] synonym: "carbon group molecular entities" RELATED [ChEBI] synonym: "carbon group molecular entity" EXACT [ChEBI] synonym: "carbon group molecular entity" EXACT [ChEBI:] is_a: CHEBI:33675 ! p-block molecular entity relationship: has_part CHEBI:33306 ! carbon group element atom [Term] id: CHEBI:33595 name: cyclic compound namespace: chebi_ontology def: "Any molecule that consists of a series of atoms joined together to form a ring." [] subset: 3_STAR synonym: "cyclic compounds" RELATED [ChEBI] synonym: "cyclic compounds" RELATED [ChEBI:] xref: Wikipedia:Cyclic_compound is_a: CHEBI:25367 ! molecule [Term] id: CHEBI:33608 name: hydrogen molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "hydrogen compounds" RELATED [ChEBI:] synonym: "hydrogen compounds" RELATED [ChEBI] synonym: "hydrogen molecular entities" RELATED [ChEBI] synonym: "hydrogen molecular entities" RELATED [ChEBI:] is_a: CHEBI:33674 ! s-block molecular entity relationship: has_part CHEBI:49637 ! hydrogen atom [Term] id: CHEBI:33635 name: polycyclic compound namespace: chebi_ontology subset: 3_STAR synonym: "polycyclic compounds" RELATED [ChEBI] is_a: CHEBI:33595 ! cyclic compound [Term] id: CHEBI:33636 name: bicyclic compound namespace: chebi_ontology def: "A molecule that features two fused rings." [ANON:ANON] subset: 3_STAR synonym: "bicyclic compounds" RELATED [ChEBI] synonym: "bicyclic compounds" RELATED [ChEBI:] is_a: CHEBI:33595 ! cyclic compound [Term] id: CHEBI:33653 name: aliphatic compound namespace: chebi_ontology def: "Any acyclic or cyclic, saturated or unsaturated carbon compound, excluding aromatic compounds." [] subset: 3_STAR synonym: "aliphatic compounds" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33655 name: aromatic compound namespace: chebi_ontology def: "A cyclically conjugated molecular entity with a stability (due to delocalization) significantly greater than that of a hypothetical localized structure (e.g. Kekule structure) is said to possess aromatic character." [ANON:ANON] subset: 3_STAR synonym: "aromatic compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "aromatic compounds" EXACT IUPAC_NAME [IUPAC] synonym: "aromatic molecular entity" EXACT IUPAC_NAME [IUPAC] synonym: "aromatic molecular entity" EXACT IUPAC_NAME [IUPAC:] synonym: "aromatics" RELATED [ChEBI] synonym: "aromatics" RELATED [ChEBI:] synonym: "aromatische Verbindungen" RELATED [ChEBI:] synonym: "aromatische Verbindungen" RELATED [ChEBI] is_a: CHEBI:33595 ! cyclic compound [Term] id: CHEBI:33659 name: organic aromatic compound namespace: chebi_ontology subset: 3_STAR synonym: "organic aromatic compounds" RELATED [ChEBI] synonym: "organic aromatic compounds" RELATED [ChEBI:] is_a: CHEBI:33655 ! aromatic compound is_a: CHEBI:33832 ! organic cyclic compound [Term] id: CHEBI:33671 name: heteropolycyclic compound namespace: chebi_ontology def: "A polycyclic compound in which at least one of the rings contains at least one non-carbon atom." [] subset: 3_STAR synonym: "heteropolycyclic compounds" EXACT IUPAC_NAME [IUPAC] synonym: "polyheterocyclic compounds" RELATED [ChEBI] is_a: CHEBI:33635 ! polycyclic compound is_a: CHEBI:5686 ! heterocyclic compound [Term] id: CHEBI:33672 name: heterobicyclic compound namespace: chebi_ontology def: "A bicyclic compound in which at least one of the rings contains at least one skeletal heteroatom." [ANON:ANON] subset: 3_STAR synonym: "heterobicyclic compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "heterobicyclic compounds" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33636 ! bicyclic compound is_a: CHEBI:5686 ! heterocyclic compound [Term] id: CHEBI:33674 name: s-block molecular entity namespace: chebi_ontology def: "An s-block molecular entity is a molecular entity containing one or more atoms of an s-block element." [ANON:ANON] subset: 3_STAR synonym: "s-block compounds" RELATED [ChEBI] synonym: "s-block compounds" RELATED [ChEBI:] synonym: "s-block molecular entities" RELATED [ChEBI] synonym: "s-block molecular entities" RELATED [ChEBI:] synonym: "s-block molecular entity" EXACT [ChEBI:] synonym: "s-block molecular entity" EXACT [ChEBI] is_a: CHEBI:33579 ! main group molecular entity relationship: has_part CHEBI:33559 ! s-block element atom [Term] id: CHEBI:33675 name: p-block molecular entity namespace: chebi_ontology def: "A main group molecular entity that contains one or more atoms of a p-block element." [] def: "A p-block molecular entity is a molecular entity containing one or more atoms of a p-block element." [ANON:ANON] subset: 3_STAR synonym: "p-block compounds" RELATED [ChEBI] synonym: "p-block compounds" RELATED [ChEBI:] synonym: "p-block molecular entities" RELATED [ChEBI:] synonym: "p-block molecular entities" RELATED [ChEBI] synonym: "p-block molecular entitiy" RELATED [ChEBI] synonym: "p-block molecular entitiy" RELATED [ChEBI:] is_a: CHEBI:33579 ! main group molecular entity relationship: has_part CHEBI:33560 ! p-block element atom [Term] id: CHEBI:33676 name: d-block molecular entity namespace: chebi_ontology def: "A d-block molecular entity is a molecular entity containing one or more atoms of a d-block element." [] subset: 3_STAR synonym: "d-block compounds" RELATED [ChEBI] synonym: "d-block molecular entities" RELATED [ChEBI] synonym: "d-block molecular entity" EXACT [ChEBI] is_a: CHEBI:33497 ! transition element molecular entity relationship: has_part CHEBI:33561 ! d-block element atom [Term] id: CHEBI:33692 name: hydrides namespace: chebi_ontology def: "Hydrides are chemical compounds of hydrogen with other chemical elements." [] subset: 3_STAR is_a: CHEBI:33608 ! hydrogen molecular entity is_a: CHEBI:37577 ! heteroatomic molecular entity [Term] id: CHEBI:33693 name: oxygen hydride namespace: chebi_ontology subset: 3_STAR synonym: "hydrides of oxygen" RELATED [ChEBI] synonym: "oxygen hydride" EXACT [ChEBI] synonym: "oxygen hydrides" RELATED [ChEBI] is_a: CHEBI:36902 ! chalcogen hydride [Term] id: CHEBI:33694 name: biomacromolecule namespace: chebi_ontology def: "A macromolecule formed by a living organism." [] subset: 3_STAR synonym: "biomacromolecules" RELATED [ChEBI] synonym: "biopolymer" EXACT IUPAC_NAME [IUPAC] synonym: "Biopolymere" RELATED [ChEBI] synonym: "biopolymers" RELATED [ChEBI] is_a: CHEBI:33839 ! macromolecule is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33695 name: information biomacromolecule namespace: chebi_ontology subset: 3_STAR synonym: "genetically encoded biomacromolecules" RELATED [ChEBI] synonym: "genetically encoded biopolymers" RELATED [ChEBI] synonym: "information biomacromolecules" RELATED [ChEBI] synonym: "information biopolymers" RELATED [ChEBI] synonym: "information macromolecule" RELATED [ChEBI] synonym: "information macromolecules" RELATED [ChEBI] is_a: CHEBI:33694 ! biomacromolecule [Term] id: CHEBI:33696 name: nucleic acid namespace: chebi_ontology def: "A macromolecule made up of nucleotide units and hydrolysable into certain pyrimidine or purine bases (usually adenine, cytosine, guanine, thymine, uracil), D-ribose or 2-deoxy-D-ribose and phosphoric acid." [] subset: 3_STAR synonym: "acide nucleique" RELATED [ChEBI] synonym: "acides nucleiques" RELATED [ChEBI] synonym: "acido nucleico" RELATED [ChEBI] synonym: "acidos nucleicos" RELATED [ChEBI] synonym: "NA" RELATED [ChEBI] synonym: "nucleic acids" EXACT IUPAC_NAME [IUPAC] synonym: "Nukleinsaeure" RELATED [ChEBI] synonym: "Nukleinsaeuren" RELATED [ChEBI] is_a: CHEBI:15986 ! polynucleotide relationship: has_part CHEBI:33791 ! canonical nucleoside residue relationship: has_part CHEBI:50297 ! canonical nucleotide residue [Term] id: CHEBI:33697 name: ribonucleic acid namespace: chebi_ontology def: "High molecular weight, linear polymers, composed of nucleotides containing ribose and linked by phosphodiester bonds; RNA is central to the synthesis of proteins." [] subset: 3_STAR synonym: "pentosenucleic acids" RELATED [ChemIDplus] synonym: "ribonucleic acid" EXACT [IUPAC] synonym: "ribonucleic acids" EXACT IUPAC_NAME [IUPAC] synonym: "ribonucleic acids" RELATED [ChEBI] synonym: "Ribonukleinsaeure" RELATED [ChEBI] synonym: "ribose nucleic acid" RELATED [ChEBI] synonym: "RNA" RELATED [UniProt] synonym: "RNA" RELATED [IUPAC] synonym: "RNS" RELATED [ChEBI] synonym: "yeast nucleic acid" RELATED [ChEBI] xref: CAS:63231-63-0 {source="ChemIDplus"} is_a: CHEBI:33696 ! nucleic acid relationship: has_part CHEBI:33792 ! canonical ribonucleoside residue relationship: has_part CHEBI:50299 ! canonical ribonucleotide residue [Term] id: CHEBI:33700 name: proteinogenic amino-acid residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical amino-acid residue" RELATED [ChEBI] synonym: "canonical amino-acid residues" RELATED [ChEBI] synonym: "common amino acid residues" RELATED [ChEBI] synonym: "proteinogenic amino-acid residues" RELATED [ChEBI] synonym: "standard amino acid residues" RELATED [ChEBI] synonym: "standard amino-acid residues" RELATED [ChEBI] is_a: CHEBI:33710 ! alpha-amino-acid residue [Term] id: CHEBI:33702 name: polyatomic cation namespace: chebi_ontology def: "A cation consisting of more than one atom." [ANON:ANON] subset: 3_STAR synonym: "polyatomic cations" RELATED [ChEBI:] synonym: "polyatomic cations" RELATED [ChEBI] is_a: CHEBI:36358 ! polyatomic ion is_a: CHEBI:36916 ! cation [Term] id: CHEBI:33703 name: amino-acid cation namespace: chebi_ontology subset: 3_STAR synonym: "amino acid cation" RELATED [ChEBI] synonym: "amino-acid cation" EXACT [ChEBI] synonym: "amino-acid cations" RELATED [ChEBI] is_a: CHEBI:33702 ! polyatomic cation [Term] id: CHEBI:33704 name: alpha-amino acid namespace: chebi_ontology alt_id: CHEBI:10208 alt_id: CHEBI:13779 alt_id: CHEBI:22442 alt_id: CHEBI:2642 def: "An amino acid in which the amino group is located on the carbon atom at the position alpha to the carboxy group." [] subset: 3_STAR synonym: "alpha-amino acid" EXACT IUPAC_NAME [IUPAC:] synonym: "alpha-amino acid" EXACT IUPAC_NAME [IUPAC] synonym: "alpha-amino acids" RELATED [JCBN:] synonym: "alpha-amino acids" RELATED [ChEBI] synonym: "alpha-amino acids" RELATED [ChEBI:] synonym: "alpha-amino acids" RELATED [JCBN] synonym: "alpha-amino carboxylic acids" RELATED [IUPAC:] synonym: "alpha-amino carboxylic acids" RELATED [IUPAC] synonym: "Amino acid" RELATED [KEGG_COMPOUND] synonym: "Amino acid" RELATED [KEGG COMPOUND:] synonym: "Amino acids" RELATED [KEGG_COMPOUND] synonym: "an alpha-amino acid" RELATED [UniProt:] xref: KEGG:C00045 xref: KEGG:C05167 is_a: CHEBI:33709 ! amino acid relationship: is_conjugate_acid_of CHEBI:33558 ! alpha-amino-acid anion relationship: is_tautomer_of CHEBI:78608 ! alpha-amino acid zwitterion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.05870" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "NC([*])C(O)=O" xsd:string [Term] id: CHEBI:33707 name: gamma-amino acid namespace: chebi_ontology def: "A non-proteinogenic amino-acid in which the amino group is located on the carbon atom at the position gamma to the carboxy group." [] subset: 3_STAR synonym: "gamma-amino acid" EXACT [ChEBI] synonym: "gamma-amino acid" EXACT [ChEBI:] synonym: "gamma-amino acids" RELATED [ChEBI:] synonym: "gamma-amino acids" RELATED [ChEBI] is_a: CHEBI:83820 ! non-proteinogenic amino acid relationship: is_conjugate_acid_of CHEBI:71666 ! gamma-amino acid anion [Term] id: CHEBI:33708 name: amino-acid residue namespace: chebi_ontology def: "When two or more amino acids combine to form a peptide, the elements of water are removed, and what remains of each amino acid is called an amino-acid residue." [] subset: 3_STAR synonym: "amino acid residue" RELATED [ChEBI] synonym: "amino-acid residue" EXACT IUPAC_NAME [IUPAC] synonym: "amino-acid residues" RELATED [JCBN] is_a: CHEBI:33247 ! organic group relationship: is_substituent_group_from CHEBI:33709 ! amino acid [Term] id: CHEBI:33709 name: amino acid namespace: chebi_ontology alt_id: CHEBI:13815 alt_id: CHEBI:22477 def: "A carboxylic acid containing one or more amino groups." [ANON:ANON] subset: 3_STAR synonym: "amino acids" RELATED [ChEBI] synonym: "amino acids" RELATED [ChEBI:] synonym: "Aminocarbonsaeure" RELATED [ChEBI:] synonym: "Aminocarbonsaeure" RELATED [ChEBI] synonym: "Aminokarbonsaeure" RELATED [ChEBI] synonym: "Aminokarbonsaeure" RELATED [ChEBI:] synonym: "Aminosaeure" RELATED [ChEBI] synonym: "Aminosaeure" RELATED [ChEBI:] xref: Wikipedia:Amino_acid is_a: CHEBI:33575 ! carboxylic acid is_a: CHEBI:50047 ! organic amino compound relationship: is_conjugate_acid_of CHEBI:37022 ! amino-acid anion [Term] id: CHEBI:33710 name: alpha-amino-acid residue namespace: chebi_ontology subset: 3_STAR synonym: "alpha-amino-acid residues" RELATED [ChEBI] is_a: CHEBI:33708 ! amino-acid residue relationship: is_substituent_group_from CHEBI:33704 ! alpha-amino acid [Term] id: CHEBI:33719 name: alpha-amino-acid cation namespace: chebi_ontology subset: 3_STAR synonym: "alpha-amino acid cations" RELATED [ChEBI] synonym: "alpha-amino-acid cation" EXACT [ChEBI] synonym: "alpha-amino-acid cations" RELATED [ChEBI] is_a: CHEBI:33703 ! amino-acid cation [Term] id: CHEBI:33720 name: carbohydrate acid namespace: chebi_ontology subset: 3_STAR synonym: "carbohydrate acid" EXACT [ChEBI] synonym: "carbohydrate acids" RELATED [ChEBI] is_a: CHEBI:16646 ! carbohydrate is_a: CHEBI:33575 ! carboxylic acid relationship: is_conjugate_acid_of CHEBI:33721 ! carbohydrate acid anion [Term] id: CHEBI:33721 name: carbohydrate acid anion namespace: chebi_ontology subset: 3_STAR synonym: "carbohydrate acid anion" EXACT [ChEBI] synonym: "carbohydrate acid anions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion relationship: is_conjugate_base_of CHEBI:33720 ! carbohydrate acid [Term] id: CHEBI:33744 name: iron group molecular entity namespace: chebi_ontology subset: 3_STAR synonym: "iron group molecular entities" RELATED [ChEBI] synonym: "iron group molecular entity" EXACT [ChEBI] is_a: CHEBI:33676 ! d-block molecular entity relationship: has_part CHEBI:33356 ! iron group element atom [Term] id: CHEBI:33791 name: canonical nucleoside residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical nucleoside residues" RELATED [ChEBI] synonym: "common nucleoside residues" RELATED [CBN] synonym: "nucleoside residue" RELATED [CBN] synonym: "standard nucleoside residues" RELATED [ChEBI] is_a: CHEBI:50320 ! nucleoside residue [Term] id: CHEBI:33792 name: canonical ribonucleoside residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical ribonucleoside residues" RELATED [ChEBI] synonym: "common ribonucleoside residue" RELATED [CBN] synonym: "common ribonucleoside residues" RELATED [CBN] synonym: "N" RELATED [CBN] synonym: "Nuc" RELATED [CBN] synonym: "standard ribonucleoside residues" RELATED [ChEBI] is_a: CHEBI:33791 ! canonical nucleoside residue [Term] id: CHEBI:33793 name: canonical deoxyribonucleoside residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical deoxyribonucleoside residues" RELATED [ChEBI] synonym: "common 2'-deoxyribonucleoside residue" RELATED [CBN] synonym: "common 2'-deoxyribonucleoside residues" RELATED [CBN] synonym: "dN" RELATED [CBN] synonym: "dNuc" RELATED [CBN] synonym: "standard deoxyribonucleoside residues" RELATED [ChEBI] is_a: CHEBI:33791 ! canonical nucleoside residue [Term] id: CHEBI:33822 name: organic hydroxy compound namespace: chebi_ontology alt_id: CHEBI:64710 def: "An organic compound having at least one hydroxy group attached to a carbon atom." [ANON:ANON] subset: 3_STAR synonym: "hydroxy compounds" EXACT IUPAC_NAME [IUPAC] synonym: "hydroxy compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "organic alcohol" RELATED [ChEBI] synonym: "organic hydroxy compounds" RELATED [ChEBI:] synonym: "organic hydroxy compounds" RELATED [ChEBI] is_a: CHEBI:24651 ! hydroxides is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:33832 name: organic cyclic compound namespace: chebi_ontology def: "Any organic molecule that consists of atoms connected in the form of a ring." [] subset: 3_STAR synonym: "organic cyclic compounds" RELATED [ChEBI:] synonym: "organic cyclic compounds" RELATED [ChEBI] is_a: CHEBI:33595 ! cyclic compound is_a: CHEBI:72695 ! organic molecule [Term] id: CHEBI:33833 name: heteroarene namespace: chebi_ontology def: "A heterocyclic compound formally derived from an arene by replacement of one or more methine (-C=) and/or vinylene (-CH=CH-) groups by trivalent or divalent heteroatoms, respectively, in such a way as to maintain the continuous pi-electron system characteristic of aromatic systems and a number of out-of-plane pi-electrons corresponding to the Hueckel rule (4n+2)." [ANON:ANON] subset: 3_STAR synonym: "hetarenes" RELATED [IUPAC:] synonym: "hetarenes" RELATED [IUPAC] synonym: "heteroarenes" EXACT IUPAC_NAME [IUPAC:] synonym: "heteroarenes" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:24532 ! organic heterocyclic compound is_a: CHEBI:33659 ! organic aromatic compound [Term] id: CHEBI:33837 name: conjugated protein namespace: chebi_ontology def: "Conjugated protein is a protein that contains a non-peptide component, usually in stoichiometric proportion." [] subset: 3_STAR synonym: "complex protein" RELATED [COMe] synonym: "conjugated proteins" EXACT IUPAC_NAME [IUPAC] xref: COMe:PRX000001 is_a: CHEBI:36080 ! protein is_a: PR:000000001 ! protein [Term] id: CHEBI:33839 name: macromolecule namespace: chebi_ontology def: "A macromolecule is a molecule of high relative molecular mass, the structure of which essentially comprises the multiple repetition of units derived, actually or conceptually, from molecules of low relative molecular mass." [] subset: 3_STAR synonym: "macromolecule" EXACT IUPAC_NAME [IUPAC] synonym: "macromolecules" RELATED [ChEBI] synonym: "polymer" RELATED [ChEBI] synonym: "polymer molecule" RELATED [IUPAC] synonym: "polymers" RELATED [ChEBI] xref: Wikipedia:Macromolecule is_a: CHEBI:36357 ! polyatomic entity [Term] id: CHEBI:33853 name: phenols namespace: chebi_ontology alt_id: CHEBI:13664 alt_id: CHEBI:13825 alt_id: CHEBI:25969 alt_id: CHEBI:2857 def: "Compounds having one or more hydroxy groups attached to a benzene or other arene ring." [ANON:ANON] def: "Organic aromatic compounds having one or more hydroxy groups attached to a benzene or other arene ring." [] subset: 3_STAR synonym: "a phenol" RELATED [UniProt] synonym: "arenols" RELATED [IUPAC] synonym: "arenols" RELATED [IUPAC:] synonym: "Aryl alcohol" RELATED [KEGG COMPOUND:] synonym: "Aryl alcohol" RELATED [KEGG_COMPOUND] synonym: "aryl alcohol" RELATED [UniProt:] synonym: "phenols" EXACT IUPAC_NAME [IUPAC] synonym: "phenols" EXACT IUPAC_NAME [IUPAC:] xref: KEGG:C15584 xref: MetaCyc:Phenols xref: Wikipedia:Phenols is_a: CHEBI:33659 ! organic aromatic compound is_a: CHEBI:33822 ! organic hydroxy compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C6HOR5" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "89.072" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "89.00274" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1(=C(C(=C(C(=C1*)*)*)*)*)O" xsd:string [Term] id: CHEBI:33893 name: reagent namespace: chebi_ontology def: "A substance used in a chemical reaction to detect, measure, examine, or produce other substances." [] subset: 3_STAR synonym: "reactif" RELATED [IUPAC] synonym: "reactivo" RELATED [IUPAC] synonym: "reagent" EXACT IUPAC_NAME [IUPAC] synonym: "reagents" RELATED [ChEBI] is_a: CHEBI:33232 ! application [Term] id: CHEBI:33917 name: aldohexose namespace: chebi_ontology alt_id: CHEBI:2558 def: "A hexose with a (potential) aldehyde group at one end." [] subset: 3_STAR synonym: "aldohexose" EXACT [ChEBI] synonym: "aldohexoses" RELATED [ChEBI] is_a: CHEBI:15693 ! aldose is_a: CHEBI:18133 ! hexose [Term] id: CHEBI:33937 name: macronutrient namespace: chebi_ontology def: "Any nutrient required in large quantities by organisms throughout their life in order to orchestrate a range of physiological functions. Macronutrients are usually chemical elements (carbon, hydrogen, nitrogen, oxygen, phosphorus and sulfur) that humans consume in the largest quantities. Calcium, sodium, magnesium and potassium are sometimes included as macronutrients because they are required in relatively large quantities compared with other vitamins and minerals." [] subset: 3_STAR synonym: "macronutrients" RELATED [ChEBI] is_a: CHEBI:33284 ! nutrient [Term] id: CHEBI:350546 name: serotonin(1+) namespace: chebi_ontology def: "An ammonium ion that is the conjugate acid of serotonin; major species at pH 7.3." [] subset: 3_STAR synonym: "2-(5-hydroxy-1H-indol-3-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "serotonin" RELATED [UniProt] synonym: "serotonin cation" RELATED [ChEBI] is_a: CHEBI:35274 ! ammonium ion derivative relationship: is_conjugate_acid_of CHEBI:28790 ! serotonin relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H13N2O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2O/c11-4-3-7-6-12-10-2-1-8(13)5-9(7)10/h1-2,5-6,12-13H,3-4,11H2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZAYGJVTTNCVMB-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "177.22250" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "177.10224" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]c2ccc(O)cc12" xsd:string [Term] id: CHEBI:35106 name: nitrogen hydride namespace: chebi_ontology subset: 3_STAR synonym: "nitrogen hydrides" RELATED [ChEBI] is_a: CHEBI:35881 ! pnictogen hydride is_a: CHEBI:51143 ! nitrogen molecular entity [Term] id: CHEBI:35107 name: azane namespace: chebi_ontology def: "Saturated acyclic nitrogen hydrides having the general formula NnHn+2." [] subset: 3_STAR synonym: "azanes" RELATED [ChEBI] is_a: CHEBI:35106 ! nitrogen hydride [Term] id: CHEBI:35155 name: elemental calcium namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:22985 ! calcium molecular entity [Term] id: CHEBI:35186 name: terpene namespace: chebi_ontology def: "A hydrocarbon of biological origin having carbon skeleton formally derived from isoprene [CH2=C(CH3)CH=CH2]." [] subset: 3_STAR synonym: "Terpen" RELATED [ChEBI] synonym: "terpene" EXACT [IUPAC] synonym: "terpenes" EXACT IUPAC_NAME [IUPAC] synonym: "terpenes" RELATED [IUPAC] synonym: "terpeno" RELATED [IUPAC] synonym: "terpenos" RELATED [IUPAC] is_a: CHEBI:24632 ! hydrocarbon is_a: CHEBI:24913 ! isoprenoid [Term] id: CHEBI:35189 name: sesquiterpene namespace: chebi_ontology def: "A C15 terpene." [] subset: 3_STAR synonym: "Sesquiterpen" RELATED [ChEBI] synonym: "sesquiterpenes" EXACT IUPAC_NAME [IUPAC] synonym: "sesquiterpenes" RELATED [IUPAC] synonym: "sesquiterpeno" RELATED [IUPAC] synonym: "sesquiterpenos" RELATED [IUPAC] is_a: CHEBI:35186 ! terpene [Term] id: CHEBI:35191 name: triterpene namespace: chebi_ontology def: "A C30 terpene." [] subset: 3_STAR synonym: "Triterpen" RELATED [ChEBI] synonym: "triterpenes" EXACT IUPAC_NAME [IUPAC] synonym: "triterpenes" RELATED [IUPAC] synonym: "triterpeno" RELATED [IUPAC] synonym: "triterpenos" RELATED [IUPAC] is_a: CHEBI:35186 ! terpene [Term] id: CHEBI:35196 name: nitrogen oxide namespace: chebi_ontology subset: 3_STAR synonym: "nitrogen oxides" RELATED [ChEBI] synonym: "oxides of nitrogen" RELATED [ChEBI] is_a: CHEBI:24836 ! inorganic oxide is_a: CHEBI:51143 ! nitrogen molecular entity [Term] id: CHEBI:35222 name: inhibitor namespace: chebi_ontology def: "A substance that diminishes the rate of a chemical reaction." [] subset: 3_STAR synonym: "inhibidor" RELATED [ChEBI] synonym: "inhibiteur" RELATED [ChEBI] synonym: "inhibitor" EXACT IUPAC_NAME [IUPAC] synonym: "inhibitors" RELATED [ChEBI] is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:35223 name: catalyst namespace: chebi_ontology def: "A substance that increases the rate of a reaction without modifying the overall standard Gibbs energy change in the reaction." [] subset: 3_STAR synonym: "catalizador" RELATED [ChEBI] synonym: "catalyseur" RELATED [ChEBI] synonym: "catalyst" EXACT IUPAC_NAME [IUPAC] synonym: "Katalysator" RELATED [ChEBI] is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:35238 name: amino acid zwitterion namespace: chebi_ontology def: "The zwitterionic form of an amino acid having a negatively charged carboxyl group and a positively charged amino group." [] subset: 3_STAR synonym: "amino acid zwitterion" EXACT [ChEBI] is_a: CHEBI:27369 ! zwitterion [Term] id: CHEBI:35267 name: quaternary ammonium ion namespace: chebi_ontology alt_id: CHEBI:26470 alt_id: CHEBI:8693 def: "A derivative of ammonium, NH4(+), in which all four of the hydrogens bonded to nitrogen have been replaced with univalent (usually hydrocarbyl) groups." [ANON:ANON] def: "A derivative of ammonium, NH4(+), in which all four of the hydrogens bonded to nitrogen have been replaced with univalent (usually organyl) groups." [] subset: 3_STAR synonym: "[*][N+]([*])([*])[*]" RELATED SMILES [ChEBI:] synonym: "NR4" RELATED FORMULA [ChEBI:] synonym: "Quaternary amine" RELATED [KEGG COMPOUND:] synonym: "Quaternary amine" RELATED [KEGG_COMPOUND] synonym: "quaternary ammonium" RELATED [UniProt] synonym: "quaternary ammonium ion" EXACT IUPAC_NAME [IUPAC] synonym: "quaternary ammonium ion" EXACT IUPAC_NAME [IUPAC:] synonym: "quaternary ammonium ions" RELATED [ChEBI:] synonym: "quaternary ammonium ions" RELATED [ChEBI] xref: KEGG:C06703 is_a: CHEBI:25697 ! organic cation is_a: CHEBI:35274 ! ammonium ion derivative property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "NR4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "14.00670" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "14.00307" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*][N+]([*])([*])[*]" xsd:string [Term] id: CHEBI:35274 name: ammonium ion derivative namespace: chebi_ontology def: "A derivative of ammonium, NH4(+), in which one (or more) of the hydrogens bonded to the nitrogen have been replaced with univalent organyl groups. The substituting carbon of the organyl group must not itself be directly attached to a heteroatom (thereby excluding protonated amides, hemiaminals, etc)." [] def: "Ammonium, NH4(+), and derivatives formed by substitution by univalent groups." [ANON:ANON] subset: 3_STAR synonym: "ammonium ion derivatives" RELATED [ChEBI] synonym: "ammonium ions" RELATED [ChEBI:] synonym: "azanium ion derivative" RELATED [ChEBI] synonym: "azanium ion derivatives" RELATED [ChEBI] synonym: "azanium ions" RELATED [ChEBI:] is_a: CHEBI:33702 ! polyatomic cation is_a: CHEBI:51143 ! nitrogen molecular entity relationship: has_parent_hydride CHEBI:28938 ! ammonium [Term] id: CHEBI:35287 name: acylcholine namespace: chebi_ontology alt_id: CHEBI:13245 alt_id: CHEBI:22227 alt_id: CHEBI:2463 def: "A choline ester formed from choline and a carboxylic acid." [ANON:ANON] subset: 3_STAR synonym: "acylcholine" EXACT [UniProt:] synonym: "acylcholines" RELATED [ChEBI:] synonym: "acylcholines" RELATED [ChEBI] synonym: "an acylcholine" RELATED [UniProt] synonym: "C6H13NO2R" RELATED FORMULA [KEGG COMPOUND:] synonym: "C[N+](C)(C)CCOC([*])=O" RELATED SMILES [ChEBI:] xref: KEGG:C01777 is_a: CHEBI:35267 ! quaternary ammonium ion property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C6H13NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "131.17290" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "131.09463" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[N+](C)(C)CCOC([*])=O" xsd:string [Term] id: CHEBI:35341 name: steroid namespace: chebi_ontology alt_id: CHEBI:13687 alt_id: CHEBI:26768 alt_id: CHEBI:9263 def: "Any of naturally occurring compounds and synthetic analogues, based on the cyclopenta[a]phenanthrene carbon skeleton, partially or completely hydrogenated; there are usually methyl groups at C-10 and C-13, and often an alkyl group at C-17. By extension, one or more bond scissions, ring expansions and/or ring contractions of the skeleton may have occurred. Natural steroids are derived biogenetically from squalene which is a triterpene." [] subset: 3_STAR synonym: "a steroid" RELATED [UniProt] synonym: "Steroid" EXACT [KEGG_COMPOUND] synonym: "steroids" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C00377 xref: MetaCyc:Steroids is_a: CHEBI:18059 ! lipid is_a: CHEBI:51958 ! organic polycyclic compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H31R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "259.450" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "259.24258" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCCC4)C" xsd:string [Term] id: CHEBI:35343 name: 17beta-hydroxy steroid namespace: chebi_ontology alt_id: CHEBI:19176 alt_id: CHEBI:794 def: "A 17-hydroxy steroid in which the hydroxy group at position 17 has a beta-configuration." [] subset: 3_STAR synonym: "17beta-hydroxy steroids" RELATED [ChEBI] synonym: "17beta-hydroxysteroid" RELATED [KEGG_COMPOUND] synonym: "17beta-hydroxysteroids" RELATED [ChEBI] synonym: "a 17beta-hydroxy steroid" RELATED [UniProt] xref: KEGG:C03051 xref: MetaCyc:17-beta-Hydroxysteroids is_a: CHEBI:36838 ! 17-hydroxy steroid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C18H29OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "261.423" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "261.22184" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC12CCC3C(CCC4CCCCC34[*])C1CC[C@@H]2O" xsd:string [Term] id: CHEBI:35344 name: 21-hydroxy steroid namespace: chebi_ontology alt_id: CHEBI:1300 alt_id: CHEBI:13596 alt_id: CHEBI:19803 subset: 3_STAR synonym: "21-hydroxy steroids" RELATED [ChEBI] synonym: "21-Hydroxysteroid" RELATED [KEGG_COMPOUND] synonym: "21-hydroxysteroids" RELATED [ChEBI] xref: KEGG:C02506 is_a: CHEBI:35350 ! hydroxy steroid [Term] id: CHEBI:35346 name: 11beta-hydroxy steroid namespace: chebi_ontology alt_id: CHEBI:13774 alt_id: CHEBI:19134 alt_id: CHEBI:738 def: "Any 11-hydroxy steroid in which the hydroxy group at position 11 has beta- configuration." [] subset: 3_STAR synonym: "11beta-hydroxy steroids" RELATED [ChEBI] synonym: "11beta-Hydroxysteroid" RELATED [KEGG_COMPOUND] synonym: "11beta-hydroxysteroids" RELATED [ChEBI] synonym: "an 11beta-hydroxysteroid" RELATED [UniProt] xref: KEGG:C01058 is_a: CHEBI:36841 ! 11-hydroxy steroid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H31OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "275.450" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "275.23749" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12(CCCCC1CCC3C2[C@H](CC4(C3CCC4*)C)O)C" xsd:string [Term] id: CHEBI:35350 name: hydroxy steroid namespace: chebi_ontology alt_id: CHEBI:24748 alt_id: CHEBI:5814 subset: 3_STAR synonym: "hydroxy steroids" RELATED [ChEBI] synonym: "Hydroxysteroid" RELATED [KEGG_COMPOUND] synonym: "hydroxysteroids" RELATED [ChEBI] xref: KEGG:C02159 is_a: CHEBI:33822 ! organic hydroxy compound is_a: CHEBI:35341 ! steroid [Term] id: CHEBI:35352 name: organonitrogen compound namespace: chebi_ontology def: "Any heteroorganic entity containing at least one carbon-nitrogen bond." [ANON:ANON] subset: 3_STAR synonym: "organonitrogen compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "organonitrogen compounds" EXACT IUPAC_NAME [IUPAC] synonym: "organonitrogens" RELATED [ChEBI:] synonym: "organonitrogens" RELATED [ChEBI] is_a: CHEBI:33285 ! heteroorganic entity is_a: CHEBI:51143 ! nitrogen molecular entity [Term] id: CHEBI:35366 name: fatty acid namespace: chebi_ontology alt_id: CHEBI:13633 alt_id: CHEBI:24024 alt_id: CHEBI:4984 def: "Any aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax." [ANON:ANON] def: "Any aliphatic monocarboxylic acid derived from or contained in esterified form in an animal or vegetable fat, oil or wax. Natural fatty acids commonly have a chain of 4 to 28 carbons (usually unbranched and even-numbered), which may be saturated or unsaturated. By extension, the term is sometimes used to embrace all acyclic aliphatic carboxylic acids." [] subset: 3_STAR synonym: "acide gras" RELATED [ChEBI:] synonym: "acide gras" RELATED [ChEBI] synonym: "acides gras" RELATED [ChemIDplus] synonym: "acides gras" RELATED [ChemIDplus:] synonym: "acido graso" RELATED [ChEBI:] synonym: "acido graso" RELATED [ChEBI] synonym: "acidos grasos" RELATED [ChEBI:] synonym: "acidos grasos" RELATED [ChEBI] synonym: "CHO2R" RELATED FORMULA [KEGG COMPOUND:] synonym: "Fatty acid" EXACT [KEGG COMPOUND:] synonym: "Fatty acid" EXACT [KEGG_COMPOUND] synonym: "fatty acids" EXACT IUPAC_NAME [IUPAC] synonym: "fatty acids" EXACT IUPAC_NAME [IUPAC:] synonym: "fatty acids" RELATED [ChEBI:] synonym: "fatty acids" RELATED [ChEBI] synonym: "Fettsaeure" RELATED [ChEBI:] synonym: "Fettsaeure" RELATED [ChEBI] synonym: "Fettsaeuren" RELATED [ChEBI:] synonym: "Fettsaeuren" RELATED [ChEBI] synonym: "OC([*])=O" RELATED SMILES [ChEBI:] xref: KEGG:C00162 xref: PMID:14287444 {source="Europe PMC"} xref: PMID:14300208 {source="Europe PMC"} xref: PMID:14328676 {source="Europe PMC"} xref: Wikipedia:Fatty_acid is_a: CHEBI:18059 ! lipid is_a: CHEBI:25384 ! monocarboxylic acid relationship: is_conjugate_acid_of CHEBI:28868 ! fatty acid anion property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01740" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OC([*])=O" xsd:string [Term] id: CHEBI:35381 name: monosaccharide namespace: chebi_ontology alt_id: CHEBI:25407 alt_id: CHEBI:6984 def: "Parent monosaccharides are polyhydroxy aldehydes H[CH(OH)]nC(=O)H or polyhydroxy ketones H-[CHOH]n-C(=O)[CHOH]m-H with three or more carbon atoms. The generic term 'monosaccharide' (as opposed to oligosaccharide or polysaccharide) denotes a single unit, without glycosidic connection to other such units. It includes aldoses, dialdoses, aldoketoses, ketoses and diketoses, as well as deoxy sugars, provided that the parent compound has a (potential) carbonyl group." [] subset: 3_STAR synonym: "monosacarido" RELATED [ChEBI] synonym: "monosacaridos" RELATED [IUPAC] synonym: "Monosaccharid" RELATED [ChEBI] synonym: "Monosaccharide" EXACT [KEGG_COMPOUND] synonym: "monosaccharides" EXACT IUPAC_NAME [IUPAC] synonym: "Monosacharid" RELATED [ChEBI] xref: KEGG:C06698 is_a: CHEBI:16646 ! carbohydrate [Term] id: CHEBI:35406 name: oxoanion namespace: chebi_ontology alt_id: CHEBI:33274 alt_id: CHEBI:33436 def: "An oxoanion is an anion derived from an oxoacid by loss of hydron(s) bound to oxygen." [] subset: 3_STAR synonym: "oxoacid anions" RELATED [ChEBI] synonym: "oxoanion" EXACT [ChEBI] synonym: "oxoanions" RELATED [ChEBI] is_a: CHEBI:25741 ! oxide is_a: CHEBI:33273 ! polyatomic anion [Term] id: CHEBI:35470 name: central nervous system drug namespace: chebi_ontology def: "A class of drugs producing both physiological and psychological effects through a variety of mechanisms involving the central nervous system." [] subset: 3_STAR synonym: "central nervous system agents" RELATED [ChEBI] synonym: "CNS agent" RELATED [ChEBI] synonym: "CNS drugs" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:35472 name: anti-inflammatory drug namespace: chebi_ontology def: "A substance that reduces or suppresses inflammation." [] subset: 3_STAR synonym: "anti-inflammatory drugs" RELATED [ChEBI] synonym: "antiinflammatory agent" RELATED [ChEBI] synonym: "antiinflammatory drug" RELATED [ChEBI] synonym: "antiinflammatory drugs" RELATED [ChEBI] is_a: CHEBI:23888 ! drug is_a: CHEBI:67079 ! anti-inflammatory agent [Term] id: CHEBI:35479 name: alkali metal salt namespace: chebi_ontology subset: 3_STAR synonym: "alkali metal salts" RELATED [ChEBI] is_a: CHEBI:24866 ! salt is_a: CHEBI:33296 ! alkali metal molecular entity [Term] id: CHEBI:35488 name: central nervous system depressant namespace: chebi_ontology def: "A loosely defined group of drugs that tend to reduce the activity of the central nervous system." [] subset: 3_STAR synonym: "central nervous system depressants" RELATED [ChEBI] synonym: "CNS depressants" RELATED [ChEBI] is_a: CHEBI:35470 ! central nervous system drug [Term] id: CHEBI:35507 name: natural product fundamental parent namespace: chebi_ontology subset: 3_STAR synonym: "natural product fundamental parents" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33245 ! organic fundamental parent [Term] id: CHEBI:35508 name: steroid fundamental parent namespace: chebi_ontology subset: 3_STAR synonym: "steroid fundamental parents" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid is_a: CHEBI:35507 ! natural product fundamental parent [Term] id: CHEBI:35509 name: androstane namespace: chebi_ontology subset: 3_STAR synonym: "androstane" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:5247532 {source="Beilstein"} xref: CAS:24887-75-0 {source="ChemIDplus"} xref: LIPID_MAPS_instance:LMST02020000 {source="LIPID MAPS"} is_a: CHEBI:35508 ! steroid fundamental parent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H32" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C19H32/c1-18-11-5-7-16(18)15-9-8-14-6-3-4-12-19(14,2)17(15)10-13-18/h14-17H,3-13H2,1-2H3/t14?,15-,16-,17-,18-,19-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QZLYKIGBANMMBK-FZFXZXLVSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "260.45738" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "260.25040" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCC3CCCC[C@]3(C)[C@@]1([H])CC[C@]1(C)CCC[C@@]21[H]" xsd:string [Term] id: CHEBI:35519 name: cholane namespace: chebi_ontology subset: 3_STAR synonym: "cholane" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:35508 ! steroid fundamental parent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H42" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H42/c1-5-8-17(2)20-12-13-21-19-11-10-18-9-6-7-15-23(18,3)22(19)14-16-24(20,21)4/h17-22H,5-16H2,1-4H3/t17-,18?,19+,20-,21+,22+,23+,24-/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QSHQKIURKJITMZ-BRPMRXRMSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "330.59028" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "330.32865" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC" xsd:string [Term] id: CHEBI:35522 name: beta-adrenergic agonist namespace: chebi_ontology def: "An agent that selectively binds to and activates beta-adrenergic receptors." [] subset: 3_STAR synonym: "beta-adrenergic agonists" RELATED [ChEBI] synonym: "beta-adrenergic receptor agonist" RELATED [ChEBI] synonym: "beta-adrenoceptor agonists" RELATED [IUPHAR] is_a: CHEBI:37886 ! adrenergic agonist is_a: CHEBI:48540 ! beta-adrenergic drug [Term] id: CHEBI:35523 name: bronchodilator agent namespace: chebi_ontology def: "An agent that causes an increase in the expansion of a bronchus or bronchial tubes." [] subset: 3_STAR synonym: "bronchodilator" RELATED [ChEBI] synonym: "bronchodilator agents" RELATED [ChEBI] synonym: "broncholytic agent" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:35524 name: sympathomimetic agent namespace: chebi_ontology def: "A drug that mimics the effects of stimulating postganglionic adrenergic sympathetic nerves. Included in this class are drugs that directly stimulate adrenergic receptors and drugs that act indirectly by provoking the release of adrenergic transmitters." [] subset: 3_STAR synonym: "sympathomimetic" RELATED [ChEBI] synonym: "sympathomimetics" RELATED [ChEBI] is_a: CHEBI:37962 ! adrenergic agent [Term] id: CHEBI:35554 name: cardiovascular drug namespace: chebi_ontology def: "A drug that affects the rate or intensity of cardiac contraction, blood vessel diameter or blood volume." [] subset: 3_STAR synonym: "cardiovascular agent" RELATED [ChEBI] synonym: "cardiovascular drugs" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:35569 name: alpha-adrenergic agonist namespace: chebi_ontology def: "An agent that selectively binds to and activates alpha-adrenergic receptors." [] subset: 3_STAR synonym: "alpha-adrenergic agonists" RELATED [ChEBI] synonym: "alpha-adrenergic receptor agonist" RELATED [ChEBI] synonym: "alpha-adrenoceptor agonists" RELATED [IUPHAR] is_a: CHEBI:37886 ! adrenergic agonist is_a: CHEBI:48539 ! alpha-adrenergic drug [Term] id: CHEBI:35604 name: carbon oxoanion namespace: chebi_ontology def: "A negative ion consisting solely of carbon and oxygen atoms, and therefore having the general formula CxOy(n-) for some integers x, y and n." [] subset: 3_STAR synonym: "carbon oxoanion" EXACT [ChEBI] synonym: "carbon oxoanions" RELATED [ChEBI] synonym: "oxocarbon anion" RELATED [ChEBI] synonym: "oxocarbon anions" RELATED [ChEBI] is_a: CHEBI:25696 ! organic anion is_a: CHEBI:35406 ! oxoanion is_a: CHEBI:36963 ! organooxygen compound [Term] id: CHEBI:35605 name: carbon oxoacid namespace: chebi_ontology subset: 3_STAR synonym: "carbon oxoacids" RELATED [ChEBI] synonym: "oxoacids of carbon" RELATED [ChEBI] is_a: CHEBI:24833 ! oxoacid is_a: CHEBI:36963 ! organooxygen compound [Term] id: CHEBI:35610 name: antineoplastic agent namespace: chebi_ontology def: "A substance that inhibits or prevents the proliferation of neoplasms." [] subset: 3_STAR synonym: "anticancer agent" RELATED [ChEBI] synonym: "anticancer agents" RELATED [ChEBI] synonym: "antineoplastic" RELATED [ChEBI] synonym: "antineoplastic agents" RELATED [ChEBI] synonym: "cytostatic" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:35620 name: vasodilator agent namespace: chebi_ontology def: "A drug used to cause dilation of the blood vessels." [] subset: 3_STAR synonym: "vasodilator" RELATED [ChEBI] synonym: "vasodilator agents" RELATED [ChEBI] is_a: CHEBI:35554 ! cardiovascular drug [Term] id: CHEBI:35623 name: anticonvulsant namespace: chebi_ontology def: "A drug used to prevent seizures or reduce their severity." [] subset: 3_STAR synonym: "anti-convulsant" RELATED [ChEBI] synonym: "anti-convulsants" RELATED [ChEBI] synonym: "anti-convulsive agent" RELATED [ChEBI] synonym: "anti-convulsive agents" RELATED [ChEBI] synonym: "anticonvulsants" RELATED [ChEBI] synonym: "anticonvulsive agent" RELATED [ChEBI] synonym: "anticonvulsive agents" RELATED [ChEBI] synonym: "antiepileptic" RELATED [ChEBI] synonym: "antiepileptics" RELATED [ChEBI] synonym: "Antiepileptika" RELATED [ChEBI] synonym: "Antiepileptikum" RELATED [ChEBI] synonym: "antiepileptique" RELATED [ChEBI] synonym: "antiepileptiques" RELATED [ChEBI] synonym: "Antikonvulsiva" RELATED [ChEBI] synonym: "Antikonvulsivum" RELATED [ChEBI] is_a: CHEBI:35488 ! central nervous system depressant [Term] id: CHEBI:35692 name: dicarboxylic acid namespace: chebi_ontology alt_id: CHEBI:23692 alt_id: CHEBI:36172 alt_id: CHEBI:4501 def: "Any carboxylic acid containing two carboxy groups." [] subset: 3_STAR synonym: "Dicarboxylic acid" EXACT [KEGG_COMPOUND] synonym: "dicarboxylic acids" RELATED [ChEBI] xref: KEGG:C02028 is_a: CHEBI:131927 ! dicarboxylic acids and O-substituted derivatives is_a: CHEBI:33575 ! carboxylic acid relationship: is_conjugate_acid_of CHEBI:35693 ! dicarboxylic acid anion [Term] id: CHEBI:35693 name: dicarboxylic acid anion namespace: chebi_ontology subset: 3_STAR synonym: "dicarboxylic acid anion" EXACT [ChEBI] synonym: "dicarboxylic acid anions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion relationship: is_conjugate_base_of CHEBI:35692 ! dicarboxylic acid [Term] id: CHEBI:35701 name: ester namespace: chebi_ontology alt_id: CHEBI:23960 alt_id: CHEBI:4859 def: "A compound formally derived from an oxoacid RkE(=O)l(OH)m (l > 0) and an alcohol, phenol, heteroarenol, or enol by linking with formal loss of water from an acidic hydroxy group of the former and a hydroxy group of the latter." [ANON:ANON] subset: 3_STAR synonym: "Ester" EXACT [KEGG_COMPOUND] synonym: "Ester" EXACT [KEGG COMPOUND:] synonym: "esters" RELATED [ChEBI:] synonym: "esters" RELATED [ChEBI] xref: KEGG:C00287 xref: Wikipedia:Ester is_a: CHEBI:36963 ! organooxygen compound [Term] id: CHEBI:35722 name: sulfated glycosaminoglycan namespace: chebi_ontology subset: 3_STAR synonym: "glycosaminoglycan sulfate" RELATED [ChEBI] synonym: "glycosaminoglycan sulfates" RELATED [ChEBI] synonym: "sulfated glycosaminoglycans" RELATED [ChEBI] is_a: CHEBI:18085 ! glycosaminoglycan is_a: CHEBI:35724 ! carbohydrate sulfate [Term] id: CHEBI:35724 name: carbohydrate sulfate namespace: chebi_ontology subset: 3_STAR synonym: "carbohydrate sulfates" RELATED [ChEBI] synonym: "carbohydrate sulphates" RELATED [ChEBI] is_a: CHEBI:25704 ! organic sulfate is_a: CHEBI:26819 ! sulfuric ester is_a: CHEBI:63299 ! carbohydrate derivative [Term] id: CHEBI:35740 name: liposaccharide namespace: chebi_ontology subset: 3_STAR synonym: "liposaccharides" RELATED [ChEBI] is_a: CHEBI:18059 ! lipid is_a: CHEBI:63299 ! carbohydrate derivative [Term] id: CHEBI:35757 name: monocarboxylic acid anion namespace: chebi_ontology alt_id: CHEBI:13657 alt_id: CHEBI:25382 alt_id: CHEBI:3407 def: "A carboxylic acid anion formed when the carboxy group of a monocarboxylic acid is deprotonated." [] subset: 3_STAR synonym: "a monocarboxylate" RELATED [UniProt] synonym: "Carboxylate" RELATED [KEGG_COMPOUND] synonym: "Monocarboxylate" RELATED [KEGG_COMPOUND] synonym: "monocarboxylates" RELATED [ChEBI] synonym: "monocarboxylic acid anions" RELATED [ChEBI] xref: KEGG:C00060 is_a: CHEBI:29067 ! carboxylic acid anion relationship: is_conjugate_base_of CHEBI:25384 ! monocarboxylic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.01000" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string [Term] id: CHEBI:35780 name: phosphate ion namespace: chebi_ontology def: "A phosphorus oxoanion that is the conjugate base of phosphoric acid." [] subset: 3_STAR synonym: "phosphate" RELATED [ChEBI] synonym: "phosphate ions" RELATED [ChEBI] synonym: "Pi" RELATED [ChEBI] is_a: CHEBI:33461 ! phosphorus oxoanion relationship: is_conjugate_base_of CHEBI:26078 ! phosphoric acid relationship: RO:0000087 CHEBI:77746 ! has role human metabolite [Term] id: CHEBI:35789 name: oxo steroid namespace: chebi_ontology alt_id: CHEBI:24979 alt_id: CHEBI:25804 subset: 3_STAR synonym: "keto steroids" RELATED [ChEBI] synonym: "ketosteroids" RELATED [ChEBI] synonym: "oxo steroids" RELATED [ChEBI] synonym: "oxosteroids" RELATED [ChEBI] is_a: CHEBI:17087 ! ketone is_a: CHEBI:35341 ! steroid [Term] id: CHEBI:35881 name: pnictogen hydride namespace: chebi_ontology subset: 3_STAR synonym: "pnictogen hydride" EXACT [ChEBI] synonym: "pnictogen hydrides" RELATED [ChEBI] is_a: CHEBI:33242 ! inorganic hydride is_a: CHEBI:33302 ! pnictogen molecular entity [Term] id: CHEBI:35942 name: neurotransmitter agent namespace: chebi_ontology def: "A substance used for its pharmacological action on any aspect of neurotransmitter systems. Neurotransmitter agents include agonists, antagonists, degradation inhibitors, uptake inhibitors, depleters, precursors, and modulators of receptor function." [] subset: 3_STAR synonym: "neurotransmitter agents" RELATED [ChEBI] is_a: CHEBI:23888 ! drug is_a: CHEBI:52210 ! pharmacological role [Term] id: CHEBI:36063 name: oxytocic namespace: chebi_ontology def: "A drug that stimulates contraction of the myometrium. Oxytocics are used to induce labour, obstetric at term, to prevent or control postpartum or postabortion haemorrhage, and to assess foetal status in high risk pregnancies. They may also be used alone or with other drugs to induce abortions (abortifacients)." [] subset: 3_STAR synonym: "oxytocic" EXACT [ChEBI] synonym: "oxytocic agents" RELATED [ChEBI] synonym: "oxytocic drugs" RELATED [ChEBI] synonym: "uterine stimulants" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:36078 name: cholanoid namespace: chebi_ontology alt_id: CHEBI:22867 alt_id: CHEBI:50419 subset: 3_STAR synonym: "bile acids and derivatives" RELATED [LIPID_MAPS] synonym: "cholanoids" RELATED [ChEBI] xref: LIPID_MAPS_class:LMST04 {source="LIPID MAPS"} is_a: CHEBI:35341 ! steroid relationship: has_parent_hydride CHEBI:35519 ! cholane [Term] id: CHEBI:36080 name: protein namespace: chebi_ontology alt_id: CHEBI:13677 alt_id: CHEBI:14911 def: "A biological macromolecule minimally consisting of one polypeptide chain synthesized at the ribosome." [] subset: 3_STAR synonym: "proteins" EXACT IUPAC_NAME [IUPAC] is_a: PR:000000001 ! protein equivalent_to: PR:000000001 ! protein [Term] id: CHEBI:36235 name: bile acid anion namespace: chebi_ontology subset: 3_STAR synonym: "bile acid anions" RELATED [ChEBI] is_a: CHEBI:35757 ! monocarboxylic acid anion is_a: CHEBI:50160 ! steroid acid anion [Term] id: CHEBI:36237 name: cholanic acid namespace: chebi_ontology def: "A steroid acid that consists of cholane having a carboxy group in place of the methyl group at position 24." [] subset: 3_STAR synonym: "cholan-24-oic acid" EXACT IUPAC_NAME [IUPAC] xref: CAS:25312-65-6 {source="ChemIDplus"} xref: Patent:JP2008069152 xref: Reaxys:13246008 {source="Reaxys"} is_a: CHEBI:36278 ! cholanic acids property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H40O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17?,18+,19-,20+,21+,23+,24-/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RPKLZQLYODPWTM-KBMWBBLPSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "360.57320" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.30283" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]1(CC[C@@]2([H])[C@]3([H])CCC4CCCC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)CCC(O)=O" xsd:string [Term] id: CHEBI:36238 name: 5beta-cholanic acid namespace: chebi_ontology subset: 3_STAR synonym: "(5beta)-cholan-24-oic acid" RELATED [ChemIDplus] synonym: "(5beta,17beta)-gamma-methylandrostane-17-butanoic acid" RELATED [ChemIDplus] synonym: "5beta-cholan-24-oic acid" EXACT IUPAC_NAME [IUPAC] synonym: "5beta-cholanic acid" EXACT [ChemIDplus] synonym: "5beta-cholanoic acid" RELATED [ChemIDplus] synonym: "ursocholanic acid" RELATED [ChemIDplus] xref: Beilstein:3214794 {source="Beilstein"} xref: CAS:546-18-9 {source="ChemIDplus"} xref: LIPID_MAPS_instance:LMST04010441 {source="LIPID MAPS"} is_a: CHEBI:36237 ! cholanic acid is_a: CHEBI:36248 ! 5beta-cholanic acids property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C24H40O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C24H40O2/c1-16(7-12-22(25)26)19-10-11-20-18-9-8-17-6-4-5-14-23(17,2)21(18)13-15-24(19,20)3/h16-21H,4-15H2,1-3H3,(H,25,26)/t16-,17+,18+,19-,20+,21+,23+,24-/m1/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "RPKLZQLYODPWTM-LVVAJZGHSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "360.57320" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "360.30283" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@@]12CCCC[C@]1(C)[C@@]1([H])CC[C@]3(C)[C@]([H])(CC[C@@]3([H])[C@]1([H])CC2)[C@H](C)CCC(O)=O" xsd:string [Term] id: CHEBI:36248 name: 5beta-cholanic acids namespace: chebi_ontology def: "Members of the class of cholanic acids based on a 5beta-cholane skeleton." [] subset: 3_STAR is_a: CHEBI:136889 ! 5beta steroid is_a: CHEBI:36278 ! cholanic acids relationship: has_parent_hydride CHEBI:20664 ! 5beta-cholane [Term] id: CHEBI:36277 name: bile acid salt namespace: chebi_ontology def: "A salt of a bile acid." [] subset: 3_STAR synonym: "bile acid salts" RELATED [ChEBI] is_a: CHEBI:24868 ! organic salt is_a: CHEBI:36078 ! cholanoid [Term] id: CHEBI:36278 name: cholanic acids namespace: chebi_ontology alt_id: CHEBI:23166 alt_id: CHEBI:23211 subset: 1_STAR is_a: CHEBI:36078 ! cholanoid is_a: CHEBI:47891 ! steroid acid [Term] id: CHEBI:36338 name: lepton namespace: chebi_ontology def: "Lepton is a fermion that does not experience the strong force (strong interaction). The term is derived from the Greek lambdaepsilonpitauomicronsigma (small, thin)." [] subset: 3_STAR synonym: "leptons" RELATED [ChEBI] is_a: CHEBI:33233 ! fundamental particle is_a: CHEBI:36340 ! fermion [Term] id: CHEBI:36339 name: baryon namespace: chebi_ontology def: "Baryon is a fermion that does experience the strong force (strong interaction). The term is derived from the Greek betaalpharhoupsilonsigma (heavy)." [] subset: 3_STAR synonym: "baryons" RELATED [ChEBI] is_a: CHEBI:36340 ! fermion is_a: CHEBI:36344 ! hadron [Term] id: CHEBI:36340 name: fermion namespace: chebi_ontology def: "Particle of half-integer spin quantum number following Fermi-Dirac statistics. Fermions are named after Enrico Fermi." [] subset: 3_STAR synonym: "fermion" EXACT IUPAC_NAME [IUPAC] synonym: "fermions" RELATED [ChEBI] is_a: CHEBI:36342 ! subatomic particle [Term] id: CHEBI:36341 name: boson namespace: chebi_ontology def: "Particle of integer spin quantum number following Bose-Einstein statistics. Bosons are named after Satyendra Nath Bose." [] subset: 3_STAR synonym: "boson" EXACT IUPAC_NAME [IUPAC] synonym: "bosons" RELATED [ChEBI] is_a: CHEBI:36342 ! subatomic particle [Term] id: CHEBI:36342 name: subatomic particle namespace: chebi_ontology def: "A particle smaller than an atom." [] subset: 3_STAR synonym: "subatomic particles" RELATED [ChEBI] xref: Wikipedia:Subatomic_particle [Term] id: CHEBI:36343 name: composite particle namespace: chebi_ontology def: "A subatomic particle known to have substructure (i.e. consisting of smaller particles)." [] subset: 3_STAR synonym: "composite particles" RELATED [ChEBI] is_a: CHEBI:36342 ! subatomic particle [Term] id: CHEBI:36344 name: hadron namespace: chebi_ontology def: "Hadron is a subatomic particle which experiences the strong force." [] subset: 3_STAR synonym: "hadrons" RELATED [ChEBI] is_a: CHEBI:36343 ! composite particle [Term] id: CHEBI:36347 name: nuclear particle namespace: chebi_ontology def: "A nucleus or any of its constituents in any of their energy states." [] subset: 3_STAR synonym: "nuclear particle" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:36342 ! subatomic particle [Term] id: CHEBI:36357 name: polyatomic entity namespace: chebi_ontology def: "Any molecular entity consisting of more than one atom." [ANON:ANON] subset: 3_STAR synonym: "polyatomic entities" RELATED [ChEBI:] synonym: "polyatomic entities" RELATED [ChEBI] is_a: CHEBI:23367 ! molecular entity relationship: has_part CHEBI:24433 ! group [Term] id: CHEBI:36358 name: polyatomic ion namespace: chebi_ontology def: "An ion consisting of more than one atom." [ANON:ANON] subset: 3_STAR synonym: "polyatomic ions" RELATED [ChEBI] synonym: "polyatomic ions" RELATED [ChEBI:] is_a: CHEBI:24870 ! ion is_a: CHEBI:36357 ! polyatomic entity [Term] id: CHEBI:36359 name: phosphorus oxoacid derivative namespace: chebi_ontology subset: 3_STAR synonym: "phosphorus oxoacid derivative" EXACT [ChEBI] is_a: CHEBI:33241 ! oxoacid derivative is_a: CHEBI:36360 ! phosphorus oxoacids and derivatives relationship: has_functional_parent CHEBI:33457 ! phosphorus oxoacid [Term] id: CHEBI:36360 name: phosphorus oxoacids and derivatives namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:26082 ! phosphorus molecular entity [Term] id: CHEBI:36586 name: carbonyl compound namespace: chebi_ontology def: "Any compound containing the carbonyl group, C=O. The term is commonly used in the restricted sense of aldehydes and ketones, although it actually includes carboxylic acids and derivatives." [ANON:ANON] subset: 3_STAR synonym: "carbonyl compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "carbonyl compounds" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:36587 ! organic oxo compound is_a: CHEBI:36963 ! organooxygen compound relationship: has_part CHEBI:23019 ! carbonyl group [Term] id: CHEBI:36587 name: organic oxo compound namespace: chebi_ontology def: "Organic compounds containing an oxygen atom, =O, doubly bonded to carbon or another element." [ANON:ANON] subset: 3_STAR synonym: "organic oxo compounds" RELATED [ChEBI] synonym: "organic oxo compounds" RELATED [ChEBI:] synonym: "oxo compounds" EXACT IUPAC_NAME [IUPAC:] synonym: "oxo compounds" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:72695 ! organic molecule relationship: has_part CHEBI:46629 ! oxo group [Term] id: CHEBI:36699 name: corticosteroid hormone namespace: chebi_ontology def: "Any of a class of steroid hormones that are produced in the adrenal cortex." [] subset: 3_STAR synonym: "adrenal cortex hormones" RELATED [ChEBI] synonym: "corticosteroid hormones" RELATED [ChEBI] is_a: CHEBI:26764 ! steroid hormone is_a: CHEBI:50858 ! corticosteroid [Term] id: CHEBI:36735 name: biladienes namespace: chebi_ontology def: "Compounds based on a biladiene skeleton." [] subset: 3_STAR is_a: CHEBI:25046 ! linear tetrapyrrole [Term] id: CHEBI:36756 name: farnesane namespace: chebi_ontology def: "A sesquiterpene that is dodecane substituted by methyl groups at positions 2, 6 and 10." [] subset: 3_STAR synonym: "2,6,10-trimethyldodecane" EXACT IUPAC_NAME [IUPAC] synonym: "Farnesan" RELATED [NIST_Chemistry_WebBook] synonym: "farnesane" EXACT [NIST_Chemistry_WebBook] xref: Beilstein:1719672 {source="Beilstein"} xref: CAS:3891-98-3 {source="NIST Chemistry WebBook"} xref: CAS:3891-98-3 {source="ChemIDplus"} xref: LIPID_MAPS_instance:LMPR0103010000 {source="LIPID MAPS"} xref: MetaCyc:CPD-8764 xref: Patent:US2008098645 xref: Patent:US7399323 xref: Reaxys:1719672 {source="Reaxys"} is_a: CHEBI:18310 ! alkane is_a: CHEBI:35189 ! sesquiterpene relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C15H32" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C15H32/c1-6-14(4)10-8-12-15(5)11-7-9-13(2)3/h13-15H,6-12H2,1-5H3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YFHFHLSMISYUAQ-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "212.41458" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "212.25040" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CCC(C)CCCC(C)CCCC(C)C" xsd:string [Term] id: CHEBI:36757 name: farnesane sesquiterpenoid namespace: chebi_ontology subset: 3_STAR synonym: "farnesane sesquiterpenoid" EXACT [ChEBI] synonym: "farnesane sesquiterpenoids" RELATED [ChEBI] is_a: CHEBI:26658 ! sesquiterpenoid relationship: has_parent_hydride CHEBI:36756 ! farnesane [Term] id: CHEBI:36834 name: 3-hydroxy steroid namespace: chebi_ontology def: "Any hydroxy steroid carrying a hydroxy group at position 3." [] subset: 3_STAR synonym: "3-hydroxy steroids" RELATED [ChEBI] is_a: CHEBI:35350 ! hydroxy steroid [Term] id: CHEBI:36838 name: 17-hydroxy steroid namespace: chebi_ontology def: "A hydroxy steroid carrying a hydroxy group at position 17." [] subset: 3_STAR synonym: "17-hydroxy steroids" RELATED [ChEBI] is_a: CHEBI:35350 ! hydroxy steroid [Term] id: CHEBI:36841 name: 11-hydroxy steroid namespace: chebi_ontology subset: 3_STAR synonym: "11-hydroxy steroids" RELATED [ChEBI] is_a: CHEBI:35350 ! hydroxy steroid [Term] id: CHEBI:36871 name: inorganic radical namespace: chebi_ontology subset: 3_STAR synonym: "inorganic radicals" RELATED [ChEBI] is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:26519 ! radical [Term] id: CHEBI:36873 name: radical anion namespace: chebi_ontology subset: 3_STAR synonym: "anion radical" RELATED [IUPAC] synonym: "radical anion" EXACT IUPAC_NAME [IUPAC] synonym: "radical anions" RELATED [ChEBI] is_a: CHEBI:22563 ! anion is_a: CHEBI:36875 ! radical ion [Term] id: CHEBI:36875 name: radical ion namespace: chebi_ontology def: "A radical that carries an electric charge." [] subset: 3_STAR synonym: "ion radical" RELATED [IUPAC] synonym: "radical ion" EXACT IUPAC_NAME [IUPAC] synonym: "radical ions" RELATED [IUPAC] is_a: CHEBI:24870 ! ion is_a: CHEBI:26519 ! radical [Term] id: CHEBI:36876 name: inorganic radical anion namespace: chebi_ontology subset: 3_STAR synonym: "inorganic anion radical" RELATED [ChEBI] synonym: "inorganic radical anions" RELATED [ChEBI] is_a: CHEBI:36873 ! radical anion is_a: CHEBI:36878 ! inorganic radical ion [Term] id: CHEBI:36878 name: inorganic radical ion namespace: chebi_ontology subset: 3_STAR synonym: "inorganic ion radical" RELATED [ChEBI] synonym: "inorganic radical ions" RELATED [ChEBI] is_a: CHEBI:36871 ! inorganic radical is_a: CHEBI:36875 ! radical ion [Term] id: CHEBI:36885 name: 20-oxo steroid namespace: chebi_ontology def: "An oxo steroid carrying an oxo group at position 20." [] subset: 3_STAR synonym: "20-oxo steroids" RELATED [ChEBI] is_a: CHEBI:35789 ! oxo steroid [Term] id: CHEBI:36887 name: 18-oxo steroid namespace: chebi_ontology subset: 3_STAR synonym: "18-oxo steroids" RELATED [ChEBI] is_a: CHEBI:35789 ! oxo steroid [Term] id: CHEBI:36902 name: chalcogen hydride namespace: chebi_ontology subset: 3_STAR synonym: "chalcogen hydride" EXACT [ChEBI] synonym: "chalcogen hydrides" RELATED [ChEBI] is_a: CHEBI:33242 ! inorganic hydride is_a: CHEBI:33304 ! chalcogen molecular entity [Term] id: CHEBI:36914 name: inorganic ion namespace: chebi_ontology subset: 3_STAR synonym: "inorganic ions" RELATED [ChEBI] is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:24870 ! ion [Term] id: CHEBI:36915 name: inorganic cation namespace: chebi_ontology subset: 3_STAR synonym: "inorganic cations" RELATED [ChEBI] is_a: CHEBI:36914 ! inorganic ion is_a: CHEBI:36916 ! cation [Term] id: CHEBI:36916 name: cation namespace: chebi_ontology alt_id: CHEBI:23058 alt_id: CHEBI:3473 def: "A monoatomic or polyatomic species having one or more elementary charges of the proton." [ANON:ANON] subset: 3_STAR synonym: "Cation" EXACT [KEGG_COMPOUND] synonym: "Cation" EXACT [KEGG COMPOUND:] synonym: "cation" EXACT IUPAC_NAME [IUPAC] synonym: "cation" EXACT [ChEBI:] synonym: "cation" EXACT [ChEBI] synonym: "cation" EXACT IUPAC_NAME [IUPAC:] synonym: "cationes" RELATED [ChEBI] synonym: "cationes" RELATED [ChEBI:] synonym: "cations" RELATED [ChEBI] synonym: "cations" RELATED [ChEBI:] synonym: "Kation" RELATED [ChEBI:] synonym: "Kation" RELATED [ChEBI] synonym: "Kationen" RELATED [ChEBI:] synonym: "Kationen" RELATED [ChEBI] xref: KEGG:C01373 is_a: CHEBI:24870 ! ion [Term] id: CHEBI:36961 name: chalcocarbonic acid namespace: chebi_ontology subset: 3_STAR synonym: "chalcocarbonic acid" EXACT [ChEBI] synonym: "chalcocarbonic acids" EXACT IUPAC_NAME [IUPAC] synonym: "chalcocarbonic acids" RELATED [ChEBI] is_a: CHEBI:36962 ! organochalcogen compound [Term] id: CHEBI:36962 name: organochalcogen compound namespace: chebi_ontology def: "An organochalcogen compound is a compound containing at least one carbon-chalcogen bond." [ANON:ANON] subset: 3_STAR synonym: "organochalcogen compound" EXACT [ChEBI] synonym: "organochalcogen compound" EXACT [ChEBI:] synonym: "organochalcogen compounds" RELATED [ChEBI] synonym: "organochalcogen compounds" RELATED [ChEBI:] is_a: CHEBI:33285 ! heteroorganic entity is_a: CHEBI:33304 ! chalcogen molecular entity [Term] id: CHEBI:36963 name: organooxygen compound namespace: chebi_ontology def: "An organochalcogen compound containing at least one carbon-oxygen bond." [ANON:ANON] subset: 3_STAR synonym: "organooxygen compound" EXACT [ChEBI:] synonym: "organooxygen compound" EXACT [ChEBI] synonym: "organooxygen compounds" RELATED [ChEBI] synonym: "organooxygen compounds" RELATED [ChEBI:] xref: PMID:17586126 {source="Europe PMC"} is_a: CHEBI:25806 ! oxygen molecular entity is_a: CHEBI:36962 ! organochalcogen compound [Term] id: CHEBI:37022 name: amino-acid anion namespace: chebi_ontology subset: 3_STAR synonym: "amino acid anions" RELATED [ChEBI] synonym: "amino-acid anion" EXACT [ChEBI] synonym: "amino-acid anions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion is_a: CHEBI:35352 ! organonitrogen compound relationship: is_conjugate_base_of CHEBI:33709 ! amino acid [Term] id: CHEBI:37163 name: glucan namespace: chebi_ontology alt_id: CHEBI:24255 alt_id: CHEBI:5392 def: "A polysaccharide composed of glucose residues." [] subset: 3_STAR synonym: "Glucan" EXACT [KEGG_COMPOUND] synonym: "glucan" EXACT IUPAC_NAME [IUPAC] synonym: "glucans" RELATED [ChEBI] xref: CAS:9037-91-6 {source="ChemIDplus"} xref: KEGG:C01379 is_a: CHEBI:37164 ! homopolysaccharide property_value: http://purl.obolibrary.org/obo/chebi/formula "C12H22O11(C6H10O5)n" xsd:string [Term] id: CHEBI:37164 name: homopolysaccharide namespace: chebi_ontology def: "Glycans composed of a single type of monosaccharide residue. They are named by replacing the ending '-ose' of the sugar by '-an'." [] subset: 3_STAR synonym: "homoglycan" RELATED [IUPAC] synonym: "homopolysaccharide" EXACT IUPAC_NAME [IUPAC] synonym: "homopolysaccharides" RELATED [ChEBI] is_a: CHEBI:18154 ! polysaccharide [Term] id: CHEBI:37175 name: organic hydride namespace: chebi_ontology subset: 3_STAR synonym: "organic hydrides" RELATED [ChEBI] is_a: CHEBI:33692 ! hydrides [Term] id: CHEBI:37176 name: mononuclear parent hydride namespace: chebi_ontology subset: 3_STAR synonym: "mononuclear hydride" RELATED [ChEBI] synonym: "mononuclear hydrides" RELATED [IUPAC] synonym: "mononuclear parent hydrides" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:33692 ! hydrides [Term] id: CHEBI:37246 name: elemental sodium namespace: chebi_ontology subset: 3_STAR is_a: CHEBI:26712 ! sodium molecular entity [Term] id: CHEBI:37395 name: mucopolysaccharide namespace: chebi_ontology alt_id: CHEBI:25425 alt_id: CHEBI:7011 def: "Any of the group of polysaccharides composed of alternating units from uronic acids and glycosamines, and commonly partially esterified with sulfuric acid." [] subset: 3_STAR synonym: "mucopolisacarido" RELATED [ChEBI] synonym: "mucopolisacaridos" RELATED [IUPAC] synonym: "Mucopolysaccharid" RELATED [ChEBI] synonym: "Mucopolysaccharide" EXACT [KEGG_COMPOUND] synonym: "mucopolysaccharides" EXACT IUPAC_NAME [IUPAC] synonym: "Mukopolysaccharid" RELATED [ChEBI] xref: KEGG:C05114 is_a: CHEBI:18085 ! glycosaminoglycan [Term] id: CHEBI:37396 name: proteoglycan namespace: chebi_ontology alt_id: CHEBI:26351 alt_id: CHEBI:8582 def: "A glycoprotein in which the carbohydrate units are polysaccharides that contain amino sugars. The protein is glycosylated by one or more (up to about 100) glycosaminoglycans." [] subset: 3_STAR synonym: "Proteoglycan" EXACT [KEGG_COMPOUND] synonym: "proteoglycans" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C00866 is_a: CHEBI:17089 ! glycoprotein is_a: CHEBI:65212 ! polysaccharide derivative [Term] id: CHEBI:37397 name: chondroitin sulfate namespace: chebi_ontology alt_id: CHEBI:23224 alt_id: CHEBI:3676 def: "Any of a class of 10--60 kDa glycosaminoglycan sulfates, widely distributed in cartilage and other mammalian connective tissues." [] subset: 3_STAR synonym: "chondroitin polysulfate" RELATED [ChemIDplus] synonym: "Chondroitin sulfate" EXACT [KEGG_COMPOUND] synonym: "chondroitin sulfates" RELATED [ChemIDplus] synonym: "chondroitin sulfuric acid" RELATED [ChemIDplus] synonym: "chondroitin sulphate" RELATED [ChemIDplus] synonym: "Chondroitinsulfat" RELATED [ChEBI] xref: CAS:9007-28-7 {source="ChemIDplus"} xref: CAS:9007-28-7 {source="KEGG COMPOUND"} xref: KEGG:C00607 xref: PMID:11514091 {source="Europe PMC"} xref: PMID:7538297 {source="Europe PMC"} is_a: CHEBI:35722 ! sulfated glycosaminoglycan is_a: CHEBI:37395 ! mucopolysaccharide relationship: has_functional_parent CHEBI:16137 ! chondroitin D-glucuronate [Term] id: CHEBI:37527 name: acid namespace: chebi_ontology alt_id: CHEBI:13800 alt_id: CHEBI:13801 alt_id: CHEBI:22209 alt_id: CHEBI:2426 def: "An acid is a molecular entity capable of donating a hydron (Bronsted acid) or capable of forming a covalent bond with an electron pair (Lewis acid)." [] subset: 3_STAR synonym: "Acid" EXACT [KEGG_COMPOUND] synonym: "acid" EXACT IUPAC_NAME [IUPAC] synonym: "acide" RELATED [IUPAC] synonym: "acido" RELATED [ChEBI] synonym: "acids" RELATED [ChEBI] synonym: "Saeure" RELATED [ChEBI] synonym: "Saeuren" RELATED [ChEBI] xref: KEGG:C00174 is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:37577 name: heteroatomic molecular entity namespace: chebi_ontology def: "A molecular entity consisting of two or more chemical elements." [ANON:ANON] subset: 3_STAR synonym: "chemical compound" RELATED [ChEBI] synonym: "chemical compound" RELATED [ChEBI:] synonym: "heteroatomic molecular entities" RELATED [ChEBI] synonym: "heteroatomic molecular entities" RELATED [ChEBI:] is_a: CHEBI:36357 ! polyatomic entity [Term] id: CHEBI:37622 name: carboxamide namespace: chebi_ontology alt_id: CHEBI:35354 alt_id: CHEBI:35355 def: "An amide of a carboxylic acid, having the structure RC(=O)NR2. The term is used as a suffix in systematic name formation to denote the -C(=O)NH2 group including its carbon atom." [ANON:ANON] subset: 3_STAR synonym: "[*]C(=O)N([*])[*]" RELATED SMILES [ChEBI:] synonym: "carboxamides" EXACT IUPAC_NAME [IUPAC:] synonym: "carboxamides" EXACT IUPAC_NAME [IUPAC] synonym: "carboxamides" RELATED [ChEBI] synonym: "carboxamides" RELATED [ChEBI:] synonym: "primary carboxamide" RELATED [ChEBI] synonym: "primary carboxamide" RELATED [ChEBI:] is_a: CHEBI:33256 ! primary amide is_a: CHEBI:35352 ! organonitrogen compound is_a: CHEBI:36963 ! organooxygen compound relationship: has_part CHEBI:23004 ! carbamoyl group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CNOR3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "42.01680" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "41.99799" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]C(=O)N([*])[*]" xsd:string [Term] id: CHEBI:37826 name: sulfuric acid derivative namespace: chebi_ontology subset: 3_STAR synonym: "sulfuric acid derivative" EXACT [ChEBI] synonym: "sulfuric acid derivatives" RELATED [ChEBI] is_a: CHEBI:33424 ! sulfur oxoacid derivative relationship: has_functional_parent CHEBI:26836 ! sulfuric acid [Term] id: CHEBI:37838 name: carboacyl group namespace: chebi_ontology def: "A carboacyl group is a group formed by loss of at least one OH from the carboxy group of a carboxylic acid." [] subset: 3_STAR synonym: "carboacyl groups" EXACT IUPAC_NAME [IUPAC] synonym: "carboxylic acyl group" EXACT IUPAC_NAME [IUPAC] synonym: "carboxylic acyl groups" RELATED [IUPAC] is_a: CHEBI:22221 ! acyl group relationship: is_substituent_group_from CHEBI:33575 ! carboxylic acid [Term] id: CHEBI:37886 name: adrenergic agonist namespace: chebi_ontology def: "An agent that selectively binds to and activates adrenergic receptors." [] subset: 3_STAR synonym: "adrenergic agonists" RELATED [ChEBI] synonym: "adrenergic receptor agonist" RELATED [ChEBI] synonym: "adrenoceptor agonists" RELATED [IUPHAR] synonym: "adrenomimetic" RELATED [ChEBI] synonym: "adrenomimetics" RELATED [ChEBI] is_a: CHEBI:37962 ! adrenergic agent [Term] id: CHEBI:37962 name: adrenergic agent namespace: chebi_ontology def: "Any agent that acts on an adrenergic receptor or affects the life cycle of an adrenergic transmitter." [] subset: 3_STAR synonym: "adrenergic agents" RELATED [ChEBI] synonym: "adrenergic drug" RELATED [ChEBI] synonym: "adrenergic drugs" RELATED [ChEBI] synonym: "adrenergic neuron agents" RELATED [ChEBI] synonym: "adrenergics" RELATED [ChEBI] is_a: CHEBI:35942 ! neurotransmitter agent [Term] id: CHEBI:38077 name: polypyrrole namespace: chebi_ontology def: "A compound composed of two or more pyrrole units." [] subset: 3_STAR synonym: "poly(pyrrole)s" RELATED [ChEBI] synonym: "polypyrroles" RELATED [ChEBI] synonym: "PPys" RELATED [ChEBI] xref: Beilstein:8538310 {source="Beilstein"} is_a: CHEBI:38101 ! organonitrogen heterocyclic compound [Term] id: CHEBI:38101 name: organonitrogen heterocyclic compound namespace: chebi_ontology def: "Any organonitrogen compound containing a cyclic component with nitrogen and at least one other element as ring member atoms." [ANON:ANON] subset: 3_STAR synonym: "heterocyclic organonitrogen compounds" RELATED [ChEBI:] synonym: "heterocyclic organonitrogen compounds" RELATED [ChEBI] synonym: "organonitrogen heterocyclic compounds" RELATED [ChEBI] synonym: "organonitrogen heterocyclic compounds" RELATED [ChEBI:] is_a: CHEBI:24532 ! organic heterocyclic compound is_a: CHEBI:35352 ! organonitrogen compound [Term] id: CHEBI:38147 name: cardiotonic drug namespace: chebi_ontology def: "A drug that has a strengthening effect on the heart or that can increase cardiac output." [] subset: 3_STAR synonym: "cardiotonic drugs" RELATED [ChEBI] is_a: CHEBI:35554 ! cardiovascular drug [Term] id: CHEBI:38166 name: organic heteropolycyclic compound namespace: chebi_ontology alt_id: CHEBI:25429 alt_id: CHEBI:38075 subset: 3_STAR synonym: "organic heteropolycyclic compounds" RELATED [ChEBI] is_a: CHEBI:24532 ! organic heterocyclic compound is_a: CHEBI:33671 ! heteropolycyclic compound [Term] id: CHEBI:38179 name: monocyclic heteroarene namespace: chebi_ontology subset: 3_STAR synonym: "monocyclic heteroarenes" RELATED [ChEBI] is_a: CHEBI:33833 ! heteroarene [Term] id: CHEBI:38180 name: polycyclic heteroarene namespace: chebi_ontology subset: 3_STAR synonym: "polycyclic heteroarenes" RELATED [ChEBI] synonym: "polycyclic heteroarenes" RELATED [ChEBI:] is_a: CHEBI:33833 ! heteroarene [Term] id: CHEBI:38323 name: cholinergic drug namespace: chebi_ontology def: "Any drug used for its actions on cholinergic systems. Included here are agonists and antagonists, drugs that affect the life cycle of acetylcholine, and drugs that affect the survival of cholinergic neurons." [] subset: 3_STAR synonym: "cholinergic agent" RELATED [ChEBI] synonym: "cholinergic drugs" RELATED [ChEBI] synonym: "cholinomimetic" RELATED [ChEBI] is_a: CHEBI:35942 ! neurotransmitter agent [Term] id: CHEBI:38324 name: cholinergic agonist namespace: chebi_ontology def: "Any drug that binds to and activates cholinergic receptors." [] subset: 3_STAR synonym: "acetylcholine agonist" RELATED [ChEBI] synonym: "acetylcholine agonists" RELATED [ChEBI] synonym: "acetylcholine receptor agonist" RELATED [IUPHAR] synonym: "cholinergic agonists" RELATED [ChEBI] synonym: "cholinomimetic" RELATED [ChEBI] synonym: "cholinomimetics" RELATED [ChEBI] is_a: CHEBI:38323 ! cholinergic drug [Term] id: CHEBI:38325 name: muscarinic agonist namespace: chebi_ontology def: "Any drug that binds to and activates a muscarinic cholinergic receptor." [] subset: 3_STAR synonym: "muscarinic acetylcholine receptor agonist" RELATED [ChEBI] synonym: "muscarinic agonists" RELATED [ChEBI] synonym: "muscarinic cholinergic agonist" RELATED [ChEBI] synonym: "muscarinic cholinergic agonists" RELATED [ChEBI] is_a: CHEBI:38324 ! cholinergic agonist [Term] id: CHEBI:38560 name: simple protein namespace: chebi_ontology subset: 3_STAR synonym: "simple proteins" RELATED [ChEBI] is_a: CHEBI:36080 ! protein is_a: PR:000000001 ! protein [Term] id: CHEBI:38631 name: aminoalkylindole namespace: chebi_ontology alt_id: CHEBI:22503 alt_id: CHEBI:24792 subset: 3_STAR synonym: "aminoalkylindoles" RELATED [ChEBI] is_a: CHEBI:24828 ! indoles [Term] id: CHEBI:38700 name: organic sodium salt namespace: chebi_ontology subset: 3_STAR synonym: "organic sodium salt" EXACT [ChEBI] synonym: "organic sodium salts" RELATED [ChEBI] is_a: CHEBI:24868 ! organic salt is_a: CHEBI:26714 ! sodium salt [Term] id: CHEBI:38716 name: carboxylic acid dianion namespace: chebi_ontology def: "Any dianion containing at least one carboxy group." [] subset: 3_STAR synonym: "carboxylic acid dianion" EXACT [ChEBI] synonym: "carboxylic acid dianions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion [Term] id: CHEBI:3892 name: corticotropin namespace: chebi_ontology def: "A polypeptide hormone produced and secreted by the pituitary gland comprising 39 amino acid residues coupled in a linear sequence. The N-terminal 24-amino acid segment is identical in all species and contains the adrenocorticotrophic activity. Corticotropin stimulates the cortex of the adrenal gland and boosts the synthesis of corticosteroids, mainly glucocorticoids but also sex steroids (androgens). It is used in the treatment of certain neurological disorders such as infantile spasms and multiple sclerosis, and diagnostically to investigate adrenocortical insufficiency." [] subset: 3_STAR synonym: "ACTH" RELATED [KEGG_COMPOUND] synonym: "Adrenocorticotropic hormone" RELATED [KEGG_COMPOUND] synonym: "adrenocorticotropin" RELATED [ChemIDplus] synonym: "corticotrofina" RELATED INN [ChemIDplus] synonym: "corticotrophine" RELATED INN [ChemIDplus] synonym: "corticotrophinum" RELATED INN [ChemIDplus] synonym: "Corticotropin" EXACT [KEGG_COMPOUND] synonym: "corticotropin" RELATED INN [ChemIDplus] synonym: "cortrophin" RELATED [ChemIDplus] synonym: "L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-alpha-aspartylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine" EXACT IUPAC_NAME [IUPAC] synonym: "SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF" RELATED [DrugBank] xref: CAS:9002-60-2 {source="ChemIDplus"} xref: CAS:9002-60-2 {source="KEGG COMPOUND"} xref: Drug_Central:4931 {source="DrugCentral"} xref: DrugBank:DB01285 xref: KEGG:C02017 xref: KEGG:D00146 is_a: CHEBI:15841 ! polypeptide is_a: CHEBI:25905 ! peptide hormone is_a: CHEBI:33694 ! biomacromolecule relationship: RO:0000087 CHEBI:33295 ! has role diagnostic agent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C207H308N56O58S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C207H308N56O58S/c1-108(2)89-140(186(302)240-135(69-74-163(279)280)182(298)254-149(204(320)321)94-117-43-20-15-21-44-117)250-193(309)152-54-35-86-262(152)202(318)147(92-116-41-18-14-19-42-116)252-171(287)114(11)230-175(291)132(66-71-160(273)274)234-170(286)113(10)231-191(307)150(105-265)255-183(299)136(70-75-164(281)282)241-190(306)146(98-165(283)284)249-180(296)133(67-72-161(275)276)235-169(285)112(9)229-157(270)101-225-174(290)145(97-156(213)269)251-194(310)153-55-36-87-263(153)203(319)148(93-119-60-64-123(268)65-61-119)253-199(315)167(110(5)6)257-185(301)129(49-26-30-79-210)243-198(314)168(111(7)8)259-196(312)155-57-38-85-261(155)201(317)139(53-34-83-223-207(218)219)244-178(294)130(51-32-81-221-205(214)215)237-177(293)128(48-25-29-78-209)236-176(292)127(47-24-28-77-208)232-158(271)103-227-197(313)166(109(3)4)258-195(311)154-56-37-84-260(154)200(316)138(50-27-31-80-211)233-159(272)102-226-173(289)143(95-120-99-224-126-46-23-22-45-124(120)126)247-179(295)131(52-33-82-222-206(216)217)238-187(303)142(90-115-39-16-13-17-40-115)246-189(305)144(96-121-100-220-107-228-121)248-181(297)134(68-73-162(277)278)239-184(300)137(76-88-322-12)242-192(308)151(106-266)256-188(304)141(245-172(288)125(212)104-264)91-118-58-62-122(267)63-59-118/h13-23,39-46,58-65,99-100,107-114,125,127-155,166-168,224,264-268H,24-38,47-57,66-98,101-106,208-212H2,1-12H3,(H2,213,269)(H,220,228)(H,225,290)(H,226,289)(H,227,313)(H,229,270)(H,230,291)(H,231,307)(H,232,271)(H,233,272)(H,234,286)(H,235,285)(H,236,292)(H,237,293)(H,238,303)(H,239,300)(H,240,302)(H,241,306)(H,242,308)(H,243,314)(H,244,294)(H,245,288)(H,246,305)(H,247,295)(H,248,297)(H,249,296)(H,250,309)(H,251,310)(H,252,287)(H,253,315)(H,254,298)(H,255,299)(H,256,304)(H,257,301)(H,258,311)(H,259,312)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,320,321)(H4,214,215,221)(H4,216,217,222)(H4,218,219,223)/t112-,113-,114-,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,166-,167-,168-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "IDLFZVILOHSSID-OVLDLUHVSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "4541.06600" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "4538.25937" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(O)=O" xsd:string [Term] id: CHEBI:38958 name: indole alkaloid namespace: chebi_ontology alt_id: CHEBI:24795 alt_id: CHEBI:5901 def: "An alkaloid containing an indole skeleton." [] subset: 3_STAR synonym: "Indole alkaloid" EXACT [KEGG_COMPOUND] synonym: "indole alkaloids" RELATED [ChEBI] xref: KEGG:C06073 xref: Wikipedia:Indole_alkaloid is_a: CHEBI:22315 ! alkaloid relationship: has_part CHEBI:73398 ! indole skeleton [Term] id: CHEBI:39015 name: apolipoprotein namespace: chebi_ontology def: "Protein component on the surface of lipoprotein." [] subset: 3_STAR synonym: "apolipoproteins" RELATED [ChEBI] is_a: CHEBI:13850 ! apoprotein [Term] id: CHEBI:39022 name: inclusion compound namespace: chebi_ontology def: "A complex in which one component (the host) forms a cavity or, in the case of a crystal, a crystal lattice containing spaces in the shape of long tunnels or channels in which molecular entities of a second chemical species (the guest) are located. There is no covalent bonding between guest and host, the attraction being generally due to van der Waals forces." [] subset: 3_STAR synonym: "compose d'inclusion" RELATED [IUPAC] synonym: "compuesto de inclusion" RELATED [IUPAC] synonym: "compuestos de inclusion" RELATED [IUPAC] synonym: "inclusion complex" RELATED [IUPAC] synonym: "inclusion compound" EXACT IUPAC_NAME [IUPAC] synonym: "inclusion compounds" RELATED [ChEBI] is_a: CHEBI:50967 ! non-covalently-bound molecular entity [Term] id: CHEBI:39024 name: clathrate compound namespace: chebi_ontology def: "Inclusion compound in which the guest molecule is in a cage formed by the host molecule or by a lattice of host molecules." [] subset: 3_STAR synonym: "cage compound" RELATED [IUPAC] synonym: "Clathrat" RELATED [ChEBI] synonym: "clathrate" RELATED [IUPAC] synonym: "clathrate compounds" RELATED [ChEBI] synonym: "clathrates" EXACT IUPAC_NAME [IUPAC] synonym: "Clathratverbindung" RELATED [ChEBI] synonym: "clatrato" RELATED [IUPAC] synonym: "clatratos" RELATED [IUPAC] synonym: "compuesto de clatrato" RELATED [ChEBI] synonym: "Klathrat" RELATED [ChEBI] synonym: "Klathratverbindung" RELATED [ChEBI] is_a: CHEBI:39022 ! inclusion compound [Term] id: CHEBI:39123 name: calcium cation namespace: chebi_ontology subset: 3_STAR synonym: "calcium cation" EXACT [ChEBI] synonym: "calcium cations" RELATED [ChEBI] is_a: CHEBI:33513 ! alkaline earth cation is_a: CHEBI:39124 ! calcium ion property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "40.078" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string [Term] id: CHEBI:39124 name: calcium ion namespace: chebi_ontology subset: 3_STAR synonym: "calcium ion" EXACT [ChEBI] synonym: "calcium ions" RELATED [ChEBI] is_a: CHEBI:25213 ! metal cation is_a: CHEBI:35155 ! elemental calcium property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "40.078" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "39.96259" xsd:string [Term] id: CHEBI:39141 name: Bronsted acid namespace: chebi_ontology def: "A molecular entity capable of donating a hydron to an acceptor (Bronsted base)." [] subset: 3_STAR synonym: "acide de Bronsted" RELATED [IUPAC] synonym: "Bronsted acid" EXACT IUPAC_NAME [IUPAC] synonym: "Bronsted-Saeure" RELATED [ChEBI] synonym: "donneur d'hydron" RELATED [IUPAC] synonym: "hydron donor" RELATED [IUPAC] is_a: CHEBI:17891 ! donor is_a: CHEBI:37527 ! acid [Term] id: CHEBI:39142 name: Bronsted base namespace: chebi_ontology def: "A molecular entity capable of accepting a hydron from a donor (Bronsted acid)." [] subset: 3_STAR synonym: "accepteur d'hydron" RELATED [IUPAC] synonym: "base de Bronsted" RELATED [IUPAC] synonym: "Bronsted base" EXACT IUPAC_NAME [IUPAC] synonym: "Bronsted-Base" RELATED [ChEBI] synonym: "hydron acceptor" RELATED [IUPAC] is_a: CHEBI:15339 ! acceptor is_a: CHEBI:22695 ! base [Term] id: CHEBI:39144 name: Lewis base namespace: chebi_ontology def: "A molecular entity able to provide a pair of electrons and thus capable of forming a covalent bond with an electron-pair acceptor (Lewis acid), thereby producing a Lewis adduct." [] subset: 3_STAR synonym: "base de Lewis" RELATED [IUPAC] synonym: "donneur d'une paire d'electrons" RELATED [ChEBI] synonym: "electron donor" RELATED [ChEBI] synonym: "Lewis base" EXACT IUPAC_NAME [IUPAC] synonym: "Lewis-Base" RELATED [ChEBI] is_a: CHEBI:17891 ! donor is_a: CHEBI:22695 ! base [Term] id: CHEBI:39418 name: straight-chain saturated fatty acid namespace: chebi_ontology def: "Any saturated fatty acid lacking a carbon side-chain." [ANON:ANON] def: "Any saturated fatty acid lacking a side-chain." [] subset: 3_STAR synonym: "straight-chain saturated fatty acid" EXACT [ChEBI:] synonym: "straight-chain saturated fatty acid" EXACT [ChEBI] synonym: "straight-chain saturated fatty acids" RELATED [ChEBI:] synonym: "straight-chain saturated fatty acids" RELATED [ChEBI] xref: PMID:15644336 {source="Europe PMC"} is_a: CHEBI:26607 ! saturated fatty acid is_a: CHEBI:59202 ! straight-chain fatty acid relationship: is_conjugate_acid_of CHEBI:58954 ! straight-chain saturated fatty acid anion [Term] id: CHEBI:39745 name: dihydrogenphosphate namespace: chebi_ontology alt_id: CHEBI:29137 alt_id: CHEBI:39739 def: "A monovalent inorganic anion that consists of phosphoric acid in which one of the three OH groups has been deprotonated." [] subset: 3_STAR synonym: "[PO2(OH)2](-)" RELATED [IUPAC] synonym: "dihydrogen(tetraoxidophosphate)(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "dihydrogenphosphate" EXACT IUPAC_NAME [IUPAC] synonym: "DIHYDROGENPHOSPHATE ION" RELATED [PDBeChem] synonym: "dihydrogentetraoxophosphate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "dihydrogentetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC] synonym: "dihydroxidodioxidophosphate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "H2PO4(-)" RELATED [IUPAC] xref: DrugBank:DB02831 xref: Gmelin:1999 {source="Gmelin"} xref: PDBeChem:2HP is_a: CHEBI:35780 ! phosphate ion is_a: CHEBI:79389 ! monovalent inorganic anion relationship: is_conjugate_acid_of CHEBI:43474 ! hydrogenphosphate property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O4P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "96.98724" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "96.96962" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OP([O-])(=O)O[H]" xsd:string [Term] id: CHEBI:3992 name: cyclic ketone namespace: chebi_ontology subset: 3_STAR synonym: "Cyclic ketone" EXACT [KEGG_COMPOUND] synonym: "cyclic ketones" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C02019 is_a: CHEBI:17087 ! ketone [Term] id: CHEBI:41609 name: carbonate namespace: chebi_ontology alt_id: CHEBI:29201 alt_id: CHEBI:41605 subset: 3_STAR synonym: "[CO3](2-)" RELATED [IUPAC] synonym: "carbonate" EXACT [IUPAC] synonym: "CARBONATE ION" RELATED [PDBeChem] synonym: "CO3(2-)" RELATED [ChEBI] synonym: "Karbonat" RELATED [ChEBI] synonym: "trioxidocarbonate(2-)" EXACT IUPAC_NAME [IUPAC] xref: Beilstein:3600898 {source="Beilstein"} xref: CAS:3812-32-6 {source="ChemIDplus"} xref: Gmelin:1559 {source="Gmelin"} xref: PDBeChem:CO3 is_a: CHEBI:35604 ! carbon oxoanion relationship: is_conjugate_base_of CHEBI:17544 ! hydrogencarbonate property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/CH2O3/c2-1(3)4/h(H2,2,3,4)/p-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BVKZGUZCCUSVTD-UHFFFAOYSA-L" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "60.00890" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.98584" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([O-])=O" xsd:string [Term] id: CHEBI:42485 name: formyl group namespace: chebi_ontology alt_id: CHEBI:24089 alt_id: CHEBI:42480 subset: 3_STAR synonym: "-CH(O)" RELATED [IUPAC] synonym: "-CHO" RELATED [IUPAC] synonym: "aldehyde group" EXACT IUPAC_NAME [IUPAC] synonym: "carbaldehyde" EXACT IUPAC_NAME [IUPAC] synonym: "Fo" RELATED [CBN] synonym: "formyl" EXACT IUPAC_NAME [IUPAC] synonym: "FORMYL GROUP" EXACT [PDBeChem] synonym: "H-CO-" RELATED [IUPAC] synonym: "methanoyl" RELATED [IUPAC] xref: PDBeChem:FOR is_a: CHEBI:27207 ! univalent carboacyl group relationship: is_substituent_group_from CHEBI:30751 ! formic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "29.01804" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "29.00274" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]C(*)=O" xsd:string [Term] id: CHEBI:43176 name: hydroxy group namespace: chebi_ontology alt_id: CHEBI:24706 alt_id: CHEBI:43171 subset: 3_STAR synonym: "-OH" RELATED [IUPAC] synonym: "hydroxy" EXACT IUPAC_NAME [IUPAC] synonym: "HYDROXY GROUP" EXACT [PDBeChem] synonym: "hydroxy group" EXACT [UniProt] synonym: "hydroxyl" RELATED [ChEBI] synonym: "hydroxyl group" RELATED [ChEBI] xref: PDBeChem:OH is_a: CHEBI:33246 ! inorganic group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HO" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "17.00734" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.00274" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*O[H]" xsd:string [Term] id: CHEBI:43474 name: hydrogenphosphate namespace: chebi_ontology alt_id: CHEBI:29139 alt_id: CHEBI:43470 def: "A phosphate ion that is the conjugate base of dihydrogenphosphate." [] subset: 3_STAR synonym: "[P(OH)O3](2-)" RELATED [MolBase] synonym: "[PO3(OH)](2-)" RELATED [IUPAC] synonym: "HPO4(2-)" RELATED [IUPAC] synonym: "hydrogen phosphate" RELATED [ChEBI] synonym: "hydrogen(tetraoxidophosphate)(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogenphosphate" EXACT IUPAC_NAME [IUPAC] synonym: "HYDROGENPHOSPHATE ION" RELATED [PDBeChem] synonym: "hydrogentetraoxophosphate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogentetraoxophosphate(V)" EXACT IUPAC_NAME [IUPAC] synonym: "hydroxidotrioxidophosphate(2-)" EXACT IUPAC_NAME [IUPAC] synonym: "INORGANIC PHOSPHATE GROUP" RELATED [PDBeChem] synonym: "phosphate" RELATED [UniProt] xref: Gmelin:1998 {source="Gmelin"} xref: MolBase:1628 xref: PDBeChem:PI xref: PDBeChem:PO4 is_a: CHEBI:35780 ! phosphate ion is_a: CHEBI:79388 ! divalent inorganic anion relationship: is_conjugate_acid_of CHEBI:18367 ! phosphate(3-) relationship: is_conjugate_base_of CHEBI:39745 ! dihydrogenphosphate relationship: RO:0000087 CHEBI:23357 ! has role cofactor relationship: RO:0000087 CHEBI:75772 ! has role Saccharomyces cerevisiae metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HO4P" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H3O4P/c1-5(2,3)4/h(H3,1,2,3,4)/p-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NBIIXXVUZAFLBC-UHFFFAOYSA-L" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "95.97930" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.96234" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "OP([O-])([O-])=O" xsd:string [Term] id: CHEBI:45696 name: hydrogensulfate namespace: chebi_ontology alt_id: CHEBI:29199 alt_id: CHEBI:45693 subset: 3_STAR synonym: "[SO3(OH)](-)" RELATED [IUPAC] synonym: "HSO4(-)" RELATED [IUPAC] synonym: "HYDROGEN SULFATE" RELATED [PDBeChem] synonym: "hydrogen(tetraoxidosulfate)(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogensulfate" EXACT [IUPAC] synonym: "hydrogensulfate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogentetraoxosulfate(1-)" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogentetraoxosulfate(VI)" EXACT IUPAC_NAME [IUPAC] synonym: "hydroxidotrioxidosulfate(1-)" EXACT IUPAC_NAME [IUPAC] xref: Gmelin:2121 {source="Gmelin"} is_a: CHEBI:33482 ! sulfur oxoanion relationship: is_conjugate_acid_of CHEBI:16189 ! sulfate relationship: is_conjugate_base_of CHEBI:26836 ! sulfuric acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "HO4S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "QAOWNCQODCNURD-UHFFFAOYSA-M" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "97.07154" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "96.96010" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]OS([O-])(=O)=O" xsd:string [Term] id: CHEBI:46629 name: oxo group namespace: chebi_ontology alt_id: CHEBI:29353 alt_id: CHEBI:44607 subset: 3_STAR synonym: "=O" RELATED [IUPAC] synonym: "oxo" EXACT IUPAC_NAME [IUPAC] synonym: "OXO GROUP" EXACT [PDBeChem] xref: PDBeChem:O is_a: CHEBI:33246 ! inorganic group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "15.99940" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "15.99491" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "O=*" xsd:string [Term] id: CHEBI:46662 name: mineral namespace: chebi_ontology def: "In general, a mineral is a chemical substance that is normally crystalline formed and has been formed as a result of geological processes. The term also includes metamict substances (naturally occurring, formerly crystalline substances whose crystallinity has been destroyed by ionising radiation) and can include naturally occurring amorphous substances that have never been crystalline ('mineraloids') such as georgite and calciouranoite as well as substances formed by the action of geological processes on bigenic compounds ('biogenic minerals')." [] subset: 3_STAR synonym: "mineral" EXACT [ChEBI] synonym: "Minerale" RELATED [ChEBI] synonym: "minerales" RELATED [ChEBI] synonym: "minerals" RELATED [ChEBI] synonym: "mineraux" RELATED [ChEBI] xref: Wikipedia:Mineral is_a: CHEBI:59999 ! chemical substance [Term] id: CHEBI:46723 name: phosphate mineral namespace: chebi_ontology subset: 3_STAR synonym: "phosphate minerals" RELATED [ChEBI] is_a: CHEBI:46662 ! mineral [Term] id: CHEBI:46787 name: solvent namespace: chebi_ontology def: "A liquid that can dissolve other substances (solutes) without any change in their chemical composition." [] subset: 3_STAR synonym: "Loesungsmittel" RELATED [ChEBI] synonym: "solvant" RELATED [ChEBI] synonym: "solvents" RELATED [ChEBI] xref: Wikipedia:Solvent is_a: CHEBI:33232 ! application is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:46883 name: carboxy group namespace: chebi_ontology alt_id: CHEBI:23025 alt_id: CHEBI:41420 subset: 3_STAR synonym: "-C(O)OH" RELATED [IUPAC] synonym: "-CO2H" RELATED [ChEBI] synonym: "-COOH" RELATED [IUPAC] synonym: "carboxy" EXACT IUPAC_NAME [IUPAC] synonym: "CARBOXY GROUP" EXACT [PDBeChem] synonym: "carboxyl group" RELATED [ChEBI] xref: PDBeChem:FMT is_a: CHEBI:33249 ! organyl group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CHO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "45.01744" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "44.99765" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "*C(=O)O" xsd:string [Term] id: CHEBI:47622 name: acetate ester namespace: chebi_ontology alt_id: CHEBI:13244 alt_id: CHEBI:13799 alt_id: CHEBI:22189 alt_id: CHEBI:2406 def: "Any carboxylic ester where the carboxylic acid component is acetic acid." [ANON:ANON] subset: 3_STAR synonym: "acetate" RELATED [ChEBI] synonym: "acetate" RELATED [ChEBI:] synonym: "acetate esters" RELATED [ChEBI:] synonym: "acetate esters" RELATED [ChEBI] synonym: "acetates" RELATED [ChEBI:] synonym: "acetates" RELATED [ChEBI] synonym: "Acetic ester" RELATED [KEGG COMPOUND:] synonym: "Acetic ester" RELATED [KEGG_COMPOUND] synonym: "Acetyl ester" RELATED [KEGG_COMPOUND] synonym: "Acetyl ester" RELATED [KEGG COMPOUND:] synonym: "acetyl ester" RELATED [UniProt:] synonym: "acetyl esters" RELATED [ChEBI] synonym: "acetyl esters" RELATED [ChEBI:] synonym: "an acetyl ester" RELATED [UniProt] synonym: "C2H3O2R" RELATED FORMULA [KEGG COMPOUND:] xref: KEGG:C01883 xref: Wikipedia:Acetate#Esters is_a: CHEBI:33308 ! carboxylic ester relationship: has_functional_parent CHEBI:15366 ! acetic acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3O2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "59.04400" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "59.01330" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC(=O)O[*]" xsd:string [Term] id: CHEBI:47788 name: 3-oxo steroid namespace: chebi_ontology alt_id: CHEBI:13607 alt_id: CHEBI:1653 alt_id: CHEBI:20182 alt_id: CHEBI:71186 def: "Any oxo steroid where an oxo substituent is located at position 3." [] subset: 3_STAR synonym: "3-oxo steroids" RELATED [ChEBI] synonym: "3-Oxosteroid" RELATED [KEGG_COMPOUND] synonym: "3-oxosteroids" RELATED [ChEBI] synonym: "a 3-oxosteroid" RELATED [UniProt] xref: KEGG:C01876 xref: MetaCyc:3-Oxosteroids xref: PMID:9811880 {source="SUBMITTER"} is_a: CHEBI:35789 ! oxo steroid is_a: CHEBI:3992 ! cyclic ketone property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H29OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "273.434" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "273.22184" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC4C2(CCC(C4)=O)C" xsd:string [Term] id: CHEBI:47891 name: steroid acid namespace: chebi_ontology def: "Any steroid substituted by at least one carboxy group." [] subset: 3_STAR synonym: "steroid acids" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid is_a: CHEBI:64709 ! organic acid relationship: is_conjugate_acid_of CHEBI:50160 ! steroid acid anion [Term] id: CHEBI:47909 name: 3-oxo-Delta(4) steroid namespace: chebi_ontology alt_id: CHEBI:13604 alt_id: CHEBI:1626 alt_id: CHEBI:20157 def: "A 3-oxo steroid conjugated to a C=C double bond at the alpha,beta position." [] subset: 3_STAR synonym: "3-oxo Delta(4)-steroid" RELATED [ChEBI] synonym: "3-oxo Delta(4)-steroids" RELATED [ChEBI] synonym: "3-oxo-Delta(4) steroids" RELATED [ChEBI] synonym: "3-Oxo-delta4-steroid" RELATED [KEGG_COMPOUND] synonym: "a 3-oxo-Delta(4)-steroid" RELATED [UniProt] xref: KEGG:C00619 xref: MetaCyc:3-Oxo-Delta-4-Steroids is_a: CHEBI:47788 ! 3-oxo steroid is_a: CHEBI:51689 ! enone relationship: has_part CHEBI:136849 ! 3-oxo-Delta(4)-steroid group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C19H27OR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "271.418" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "271.20619" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C12C(C3C(C(CC3)*)(C)CC1)CCC=4C2(CCC(C4)=O)C" xsd:string [Term] id: CHEBI:48154 name: sulfur oxide namespace: chebi_ontology subset: 3_STAR synonym: "oxides of sulfur" RELATED [ChEBI] synonym: "Schwefeloxide" RELATED [ChEBI] synonym: "sulfur oxides" RELATED [ChEBI] is_a: CHEBI:24836 ! inorganic oxide is_a: CHEBI:26835 ! sulfur molecular entity [Term] id: CHEBI:48354 name: polar solvent namespace: chebi_ontology def: "A solvent that is composed of polar molecules. Polar solvents can dissolve ionic compounds or ionisable covalent compounds." [] subset: 3_STAR synonym: "polar solvent" EXACT IUPAC_NAME [IUPAC] synonym: "polar solvents" RELATED [ChEBI] is_a: CHEBI:46787 ! solvent [Term] id: CHEBI:48356 name: protic solvent namespace: chebi_ontology def: "A polar solvent that is capable of acting as a hydron (proton) donor." [] subset: 3_STAR synonym: "protogenic solvent" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:39141 ! Bronsted acid is_a: CHEBI:48354 ! polar solvent [Term] id: CHEBI:48359 name: protophilic solvent namespace: chebi_ontology def: "Solvent that is capable of acting as a hydron (proton) acceptor." [] subset: 3_STAR synonym: "HBA solvent" RELATED [ChEBI] synonym: "hydrogen bond acceptor solvent" RELATED [ChEBI] synonym: "protophilic solvent" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:39142 ! Bronsted base is_a: CHEBI:48354 ! polar solvent [Term] id: CHEBI:48360 name: amphiprotic solvent namespace: chebi_ontology def: "Self-ionizing solvent possessing both characteristics of Bronsted acids and bases." [] subset: 3_STAR synonym: "amphiprotic solvent" EXACT IUPAC_NAME [IUPAC] is_a: CHEBI:48356 ! protic solvent is_a: CHEBI:48359 ! protophilic solvent [Term] id: CHEBI:48539 name: alpha-adrenergic drug namespace: chebi_ontology def: "Any drug that acts on an alpha-adrenergic receptor." [] subset: 3_STAR synonym: "alpha-adrenergic drugs" RELATED [ChEBI] is_a: CHEBI:37962 ! adrenergic agent [Term] id: CHEBI:48540 name: beta-adrenergic drug namespace: chebi_ontology def: "Any of the drugs that act on beta-adrenergic receptors." [] subset: 3_STAR synonym: "beta-adrenergic drugs" RELATED [ChEBI] is_a: CHEBI:37962 ! adrenergic agent [Term] id: CHEBI:48560 name: dopaminergic agent namespace: chebi_ontology def: "A drug used for its effects on dopamine receptors, on the life cycle of dopamine, or on the survival of dopaminergic neurons." [] subset: 3_STAR synonym: "dopamine agent" RELATED [ChEBI] synonym: "dopamine agents" RELATED [ChEBI] synonym: "dopamine drug" RELATED [ChEBI] synonym: "dopamine drugs" RELATED [ChEBI] synonym: "dopaminergic agents" RELATED [ChEBI] is_a: CHEBI:35942 ! neurotransmitter agent [Term] id: CHEBI:48578 name: radical scavenger namespace: chebi_ontology def: "A role played by a substance that can react readily with, and thereby eliminate, radicals." [] subset: 3_STAR synonym: "free radical scavengers" RELATED [ChEBI] synonym: "free-radical scavenger" RELATED [ChEBI] is_a: CHEBI:22586 ! antioxidant [Term] id: CHEBI:48705 name: agonist namespace: chebi_ontology def: "Substance which binds to cell receptors normally responding to naturally occurring substances and which produces a response of its own." [] subset: 3_STAR synonym: "agonist" EXACT IUPAC_NAME [IUPAC] synonym: "agonista" RELATED [ChEBI] synonym: "agoniste" RELATED [ChEBI] synonym: "agonists" RELATED [ChEBI] is_a: CHEBI:52210 ! pharmacological role [Term] id: CHEBI:49323 name: contraceptive drug namespace: chebi_ontology def: "A chemical substance that prevents or reduces the probability of conception." [] subset: 3_STAR synonym: "contraceptive agent" RELATED [ChEBI] synonym: "contraceptive drugs" RELATED [ChEBI] is_a: CHEBI:50689 ! reproductive control drug [Term] id: CHEBI:49637 name: hydrogen atom namespace: chebi_ontology alt_id: CHEBI:24634 alt_id: CHEBI:49636 subset: 3_STAR synonym: "1H" RELATED [IUPAC] synonym: "H" RELATED [IUPAC] synonym: "hidrogeno" RELATED [ChEBI] synonym: "hydrogen" EXACT IUPAC_NAME [IUPAC] synonym: "hydrogen" RELATED [ChEBI] synonym: "hydrogene" RELATED [ChEBI] synonym: "Wasserstoff" RELATED [ChEBI] xref: WebElements:H is_a: CHEBI:24835 ! inorganic molecular entity is_a: CHEBI:25585 ! nonmetal atom is_a: CHEBI:33559 ! s-block element atom relationship: RO:0000087 CHEBI:33937 ! has role macronutrient property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/H" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "YZCKVEUIGOORGS-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "1.00794" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1.00783" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H]" xsd:string [Term] id: CHEBI:50047 name: organic amino compound namespace: chebi_ontology def: "A compound formally derived from ammonia by replacing one, two or three hydrogen atoms by organyl groups." [ANON:ANON] subset: 3_STAR synonym: "organic amino compounds" RELATED [ChEBI] synonym: "organic amino compounds" RELATED [ChEBI:] is_a: CHEBI:35352 ! organonitrogen compound relationship: has_parent_hydride CHEBI:16134 ! ammonia relationship: RO:0000087 CHEBI:39142 ! has role Bronsted base [Term] id: CHEBI:50103 name: excitatory amino acid agonist namespace: chebi_ontology def: "An agent that binds to and activates excitatory amino acid receptors." [] subset: 3_STAR synonym: "excitatory amino acid agonists" RELATED [ChEBI] synonym: "excitatory amino acid receptor agonist" RELATED [ChEBI] synonym: "excitatory amino acid receptor agonists" RELATED [ChEBI] is_a: CHEBI:35942 ! neurotransmitter agent [Term] id: CHEBI:50112 name: sex hormone namespace: chebi_ontology def: "Any hormone that is responsible for controlling sexual characteristics and reproductive function." [] subset: 3_STAR synonym: "Geschlechtshormon" RELATED [ChEBI] synonym: "Geschlechtshormone" RELATED [ChEBI] synonym: "hormone sexuelle" RELATED [ChEBI] synonym: "hormones sexuelles" RELATED [ChEBI] synonym: "sex hormones" RELATED [ChEBI] synonym: "Sexualhormon" RELATED [ChEBI] synonym: "Sexualhormone" RELATED [ChEBI] is_a: CHEBI:24621 ! hormone [Term] id: CHEBI:50113 name: androgen namespace: chebi_ontology def: "A sex hormone that stimulates or controls the development and maintenance of masculine characteristics in vertebrates by binding to androgen receptors." [] subset: 3_STAR synonym: "Androgen" EXACT [ChEBI] synonym: "Androgene" RELATED [ChEBI] synonym: "androgene" RELATED [ChEBI] synonym: "androgenes" RELATED [ChEBI] synonym: "androgeno" RELATED [ChEBI] synonym: "androgenos" RELATED [ChEBI] synonym: "androgens" RELATED [ChEBI] is_a: CHEBI:50112 ! sex hormone [Term] id: CHEBI:50114 name: estrogen namespace: chebi_ontology def: "A hormone that stimulates or controls the development and maintenance of female sex characteristics in mammals by binding to oestrogen receptors. The oestrogens are named for their importance in the oestrous cycle. The oestrogens that occur naturally in the body, notably estrone, estradiol, estriol, and estetrol are steroids. Other compounds with oestrogenic activity are produced by plants (phytoestrogens) and fungi (mycoestrogens); synthetic compounds with oestrogenic activity are known as xenoestrogens." [] subset: 3_STAR synonym: "Estrogene" RELATED [ChEBI] synonym: "estrogene" RELATED [ChEBI] synonym: "estrogenes" RELATED [ChEBI] synonym: "estrogenes Hormon" RELATED [ChEBI] synonym: "estrogeno" RELATED [ChEBI] synonym: "estrogenos" RELATED [ChEBI] synonym: "estrogens" RELATED [ChEBI] synonym: "Oestrogen" RELATED [ChEBI] synonym: "oestrogen" RELATED [ChEBI] synonym: "Oestrogene" RELATED [ChEBI] synonym: "oestrogene" RELATED [ChEBI] synonym: "oestrogenes" RELATED [ChEBI] synonym: "oestrogens" RELATED [ChEBI] xref: Wikipedia:Estrogen is_a: CHEBI:50112 ! sex hormone [Term] id: CHEBI:50160 name: steroid acid anion namespace: chebi_ontology def: "Any anion formed by loss of a proton from a steroid acid." [] subset: 3_STAR synonym: "steroid acid anions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion relationship: is_conjugate_base_of CHEBI:47891 ! steroid acid [Term] id: CHEBI:50267 name: protective agent namespace: chebi_ontology def: "Synthetic or natural substance which is given to prevent a disease or disorder or are used in the process of treating a disease or injury due to a poisonous agent." [] subset: 3_STAR synonym: "chemoprotectant" RELATED [ChEBI] synonym: "chemoprotectants" RELATED [ChEBI] synonym: "chemoprotective agent" RELATED [ChEBI] synonym: "chemoprotective agents" RELATED [ChEBI] synonym: "protective agents" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:50297 name: canonical nucleotide residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical nucleotide residues" RELATED [ChEBI] is_a: CHEBI:50319 ! nucleotide residue [Term] id: CHEBI:50298 name: canonical deoxyribonucleotide residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical deoxyribonucleotide residues" RELATED [ChEBI] is_a: CHEBI:50297 ! canonical nucleotide residue [Term] id: CHEBI:50299 name: canonical ribonucleotide residue namespace: chebi_ontology subset: 3_STAR synonym: "canonical ribonucleotide residues" RELATED [ChEBI] is_a: CHEBI:50297 ! canonical nucleotide residue [Term] id: CHEBI:50312 name: onium compound namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:37577 ! heteroatomic molecular entity [Term] id: CHEBI:50313 name: onium cation namespace: chebi_ontology def: "Mononuclear cations derived by addition of a hydron to a mononuclear parent hydride of the pnictogen, chalcogen and halogen families." [] subset: 3_STAR synonym: "onium cations" EXACT IUPAC_NAME [IUPAC] synonym: "onium cations" RELATED [ChEBI] synonym: "onium ion" RELATED [ChEBI] synonym: "onium ions" RELATED [ChEBI] is_a: CHEBI:50312 ! onium compound [Term] id: CHEBI:50319 name: nucleotide residue namespace: chebi_ontology subset: 3_STAR synonym: "nucleotide residues" RELATED [ChEBI] is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:50320 name: nucleoside residue namespace: chebi_ontology subset: 3_STAR synonym: "nucleoside residues" RELATED [ChEBI] is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:50325 name: proteinogenic amino-acid side-chain group namespace: chebi_ontology def: "A univalent organyl group obtained by cleaving the bond from C-2 to the side chain of a proteinogenic amino-acid." [] subset: 3_STAR synonym: "canonical amino-acid side-chain" RELATED [ChEBI] synonym: "canonical amino-acid side-chains" RELATED [ChEBI] synonym: "proteinogenic amino-acid side-chain" RELATED [ChEBI] synonym: "proteinogenic amino-acid side-chain groups" RELATED [ChEBI] synonym: "proteinogenic amino-acid side-chains" RELATED [ChEBI] is_a: CHEBI:33249 ! organyl group [Term] id: CHEBI:50329 name: 2-carboxyethyl group namespace: chebi_ontology subset: 3_STAR synonym: "2-carboxyethyl" EXACT IUPAC_NAME [IUPAC] synonym: "glutamic acid side-chain" RELATED [ChEBI] is_a: CHEBI:50325 ! proteinogenic amino-acid side-chain group property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C3H5O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "73.07060" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "73.02895" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(CC(=O)O)*" xsd:string [Term] id: CHEBI:50402 name: androstanoid namespace: chebi_ontology def: "Any steroid based on an androstane skeleton and its derivatives." [] subset: 3_STAR synonym: "androstanoids" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid relationship: has_parent_hydride CHEBI:35509 ! androstane [Term] id: CHEBI:50514 name: vasoconstrictor agent namespace: chebi_ontology def: "Drug used to cause constriction of the blood vessels." [] subset: 3_STAR is_a: CHEBI:35554 ! cardiovascular drug [Term] id: CHEBI:50646 name: bone density conservation agent namespace: chebi_ontology alt_id: CHEBI:72497 def: "An agent that inhibits bone resorption and/or favor bone mineralization and bone regeneration. Used to heal bone fractures and to treat bone diseases such as osteopenia and osteoporosis." [] subset: 3_STAR synonym: "anti-osteopenia agent" RELATED [ChEBI] synonym: "anti-osteopenia agents" RELATED [ChEBI] synonym: "anti-osteopenia drug" RELATED [ChEBI] synonym: "anti-osteopenia drugs" RELATED [ChEBI] synonym: "anti-osteoporosis agent" RELATED [ChEBI] synonym: "anti-osteoporosis agents" RELATED [ChEBI] synonym: "anti-osteoporosis drug" RELATED [ChEBI] synonym: "anti-osteoporosis drugs" RELATED [ChEBI] synonym: "anti-osteoporotic" RELATED [ChEBI] synonym: "anti-osteoporotic agent" RELATED [ChEBI] synonym: "anti-osteoporotic agents" RELATED [ChEBI] synonym: "anti-osteoporotic drug" RELATED [ChEBI] synonym: "anti-osteoporotic drugs" RELATED [ChEBI] synonym: "anti-osteoporotics" RELATED [ChEBI] synonym: "antiosteoporotic" RELATED [ChEBI] synonym: "antiosteoporotics" RELATED [ChEBI] synonym: "bone density conservation agents" RELATED [ChEBI] synonym: "bone density conservation drug" RELATED [ChEBI] synonym: "bone density conservation drugs" RELATED [ChEBI] xref: Wikipedia:Osteoporosis is_a: CHEBI:23888 ! drug [Term] id: CHEBI:50689 name: reproductive control drug namespace: chebi_ontology def: "A substance used either in the prevention or facilitation of pregnancy." [] subset: 3_STAR synonym: "reproductive control agent" RELATED [ChEBI] synonym: "reproductive control drugs" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:50733 name: nutraceutical namespace: chebi_ontology def: "A product in capsule, tablet or liquid form that provide essential nutrients, such as a vitamin, an essential mineral, a protein, an herb, or similar nutritional substance." [] subset: 3_STAR synonym: "Dietary Supplement" RELATED [ChEBI] synonym: "Food Supplementation" RELATED [ChEBI] synonym: "Nutritional supplement" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:50745 name: progestogen namespace: chebi_ontology def: "A compound that interacts with progesterone receptors in target tissues to bring about effects similar to those of progesterone." [] subset: 3_STAR synonym: "gestagen" RELATED [ChEBI] synonym: "gestagens" RELATED [ChEBI] synonym: "progestagen" RELATED [ChEBI] synonym: "progestagens" RELATED [ChEBI] synonym: "progestogens" RELATED [ChEBI] is_a: CHEBI:50112 ! sex hormone [Term] id: CHEBI:50779 name: appetite enhancer namespace: chebi_ontology def: "A drug which increases appetite." [] subset: 3_STAR synonym: "appetite enhancing drug" RELATED [ChEBI] synonym: "appetite stimulant" RELATED [ChEBI] synonym: "orexigenic" RELATED [ChEBI] xref: Wikipedia:Appetite_stimulants is_a: CHEBI:50780 ! appetite regulator [Term] id: CHEBI:50780 name: appetite regulator namespace: chebi_ontology def: "An agent which regulates the physiologic mechanisms that control the appetite and food intake." [] subset: 3_STAR synonym: "appetite regulators" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:50846 name: immunomodulator namespace: chebi_ontology def: "Biologically active substance whose activity affects or plays a role in the functioning of the immune system." [] subset: 3_STAR synonym: "Biomodulator" RELATED [ChEBI] synonym: "Immune factor" RELATED [ChEBI] synonym: "Immunologic factor" RELATED [ChEBI] synonym: "Immunological factor" RELATED [ChEBI] synonym: "immunomodulators" RELATED [ChEBI] xref: Wikipedia:Immunotherapy is_a: CHEBI:23888 ! drug is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:50847 name: immunological adjuvant namespace: chebi_ontology def: "A substance that augments, stimulates, activates, potentiates, or modulates the immune response at either the cellular or humoral level. A classical agent (Freund's adjuvant, BCG, Corynebacterium parvum, et al.) contains bacterial antigens. It could also be endogenous (e.g., histamine, interferon, transfer factor, tuftsin, interleukin-1). Its mode of action is either non-specific, resulting in increased immune responsiveness to a wide variety of antigens, or antigen-specific, i.e., affecting a restricted type of immune response to a narrow group of antigens. The therapeutic efficacy is related to its antigen-specific immunoadjuvanticity." [] subset: 3_STAR synonym: "Immunoactivator" RELATED [ChEBI] synonym: "Immunoadjuvant" RELATED [ChEBI] synonym: "Immunologic adjuvant" RELATED [ChEBI] synonym: "Immunopotentiator" RELATED [ChEBI] synonym: "Immunostimulant" RELATED [ChEBI] xref: Wikipedia:Immunologic_adjuvant is_a: CHEBI:50846 ! immunomodulator is_a: CHEBI:60809 ! adjuvant [Term] id: CHEBI:50855 name: antiatherogenic agent namespace: chebi_ontology def: "A cardiovascular drug that prevents atherogenesis, the accumulation of lipid-containing plaques on the innermost layers of the arteries. Compare with antiatherosclerotic agent." [] subset: 3_STAR synonym: "anti-atherogenic agent" RELATED [ChEBI] synonym: "anti-atherogenic agents" RELATED [ChEBI] synonym: "anti-atherogenic drug" RELATED [ChEBI] synonym: "anti-atherogenic drugs" RELATED [ChEBI] synonym: "antiatherogenic agent" EXACT [ChEBI] synonym: "antiatherogenic agents" RELATED [ChEBI] synonym: "antiatherogenic drug" RELATED [ChEBI] synonym: "antiatherogenic drugs" RELATED [ChEBI] xref: PMID:14592471 {source="Europe PMC"} xref: PMID:16366593 {source="Europe PMC"} xref: PMID:17990280 {source="Europe PMC"} xref: PMID:20222342 {source="Europe PMC"} xref: PMID:21074432 {source="Europe PMC"} xref: PMID:21172387 {source="Europe PMC"} xref: PMID:21649483 {source="Europe PMC"} xref: PMID:3288054 {source="Europe PMC"} xref: PMID:9796331 {source="Europe PMC"} is_a: CHEBI:35554 ! cardiovascular drug [Term] id: CHEBI:50858 name: corticosteroid namespace: chebi_ontology def: "A natural or synthetic analogue of the hormones secreted by the adrenal gland." [] subset: 3_STAR synonym: "corticoides" RELATED [ChEBI] synonym: "corticosteroides" RELATED [ChEBI] synonym: "corticosteroids" RELATED [ChEBI] is_a: CHEBI:35341 ! steroid [Term] id: CHEBI:50860 name: organic molecular entity namespace: chebi_ontology alt_id: CHEBI:25700 alt_id: CHEBI:33244 def: "Any molecular entity that contains carbon." [ANON:ANON] subset: 3_STAR synonym: "organic compounds" RELATED [ChEBI] synonym: "organic compounds" RELATED [ChEBI:] synonym: "organic entity" RELATED [ChEBI] synonym: "organic entity" RELATED [ChEBI:] synonym: "organic molecular entities" RELATED [ChEBI:] synonym: "organic molecular entities" RELATED [ChEBI] is_a: CHEBI:33582 ! carbon group molecular entity relationship: has_part CHEBI:27594 ! carbon atom [Term] id: CHEBI:50906 name: role namespace: chebi_ontology def: "A role is particular behaviour which a material entity may exhibit." [] subset: 3_STAR is_a: BFO:0000023 ! role [Term] id: CHEBI:50910 name: neurotoxin namespace: chebi_ontology alt_id: CHEBI:50911 def: "A poison that interferes with the functions of the nervous system." [] subset: 3_STAR synonym: "agente neurotoxico" RELATED [ChEBI] synonym: "nerve poison" RELATED [ChEBI] synonym: "nerve poisons" RELATED [ChEBI] synonym: "neurotoxic agent" RELATED [ChEBI] synonym: "neurotoxic agents" RELATED [ChEBI] synonym: "neurotoxicant" RELATED [ChEBI] synonym: "neurotoxins" RELATED [ChEBI] xref: Wikipedia:Neurotoxin is_a: CHEBI:52209 ! aetiopathogenetic role is_a: CHEBI:64909 ! poison [Term] id: CHEBI:50967 name: non-covalently-bound molecular entity namespace: chebi_ontology def: "Systems consisting of two or more molecular entities held together by non-covalent interactions." [] subset: 3_STAR synonym: "non-covalently-bound molecular entities" RELATED [ChEBI] is_a: CHEBI:36357 ! polyatomic entity [Term] id: CHEBI:50994 name: primary amino compound namespace: chebi_ontology def: "A compound formally derived from ammonia by replacing one hydrogen atom by an organyl group." [ANON:ANON] subset: 3_STAR synonym: "primary amino compounds" RELATED [ChEBI] synonym: "primary amino compounds" RELATED [ChEBI:] is_a: CHEBI:50047 ! organic amino compound relationship: is_conjugate_base_of CHEBI:65296 ! primary ammonium ion [Term] id: CHEBI:51060 name: hormone agonist namespace: chebi_ontology def: "A chemical substance which binds to specific hormone receptors activating the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites." [] subset: 3_STAR is_a: CHEBI:48705 ! agonist is_a: CHEBI:51061 ! hormone receptor modulator [Term] id: CHEBI:51061 name: hormone receptor modulator namespace: chebi_ontology def: "A drug that modulates the function of the endocrine glands, the biosynthesis of their secreted hormones, or the action of hormones upon their specific sites." [] subset: 3_STAR synonym: "hormone receptor modulators" RELATED [ChEBI] is_a: CHEBI:90710 ! receptor modulator [Term] id: CHEBI:51086 name: chemical role namespace: chebi_ontology def: "A role played by the molecular entity or part thereof within a chemical context." [] subset: 3_STAR is_a: BFO:0000023 ! role is_a: CHEBI:50906 ! role [Term] id: CHEBI:51143 name: nitrogen molecular entity namespace: chebi_ontology alt_id: CHEBI:25556 alt_id: CHEBI:7594 subset: 3_STAR synonym: "nitrogen compounds" RELATED [ChEBI:] synonym: "nitrogen compounds" RELATED [ChEBI] synonym: "nitrogen molecular entities" RELATED [ChEBI] synonym: "nitrogen molecular entities" RELATED [ChEBI:] synonym: "Nitrogenous compounds" RELATED [KEGG COMPOUND:] synonym: "Nitrogenous compounds" RELATED [KEGG_COMPOUND] xref: KEGG:C06061 is_a: CHEBI:33302 ! pnictogen molecular entity relationship: has_part CHEBI:25555 ! nitrogen atom [Term] id: CHEBI:51151 name: dipolar compound namespace: chebi_ontology def: "An organic molecule that is electrically neutral carrying a positive and a negative charge in one of its major canonical descriptions. In most dipolar compounds the charges are delocalized; however the term is also applied to species where this is not the case." [] subset: 3_STAR synonym: "dipolar compounds" RELATED [ChEBI] is_a: CHEBI:72695 ! organic molecule [Term] id: CHEBI:51422 name: organodiyl group namespace: chebi_ontology def: "Any organic substituent group, regardless of functional type, having two free valences at carbon atom(s)." [] subset: 3_STAR synonym: "organodiyl groups" RELATED [ChEBI] is_a: CHEBI:51446 ! organic divalent group [Term] id: CHEBI:51446 name: organic divalent group namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:51447 name: organic univalent group namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:51689 name: enone namespace: chebi_ontology def: "An alpha,beta-unsaturated ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) in which the C=O function is conjugated to a C=C double bond at the alpha,beta position." [] subset: 3_STAR synonym: "enones" RELATED [ChEBI] xref: Wikipedia:Enone is_a: CHEBI:51721 ! alpha,beta-unsaturated ketone is_a: CHEBI:78840 ! olefinic compound property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C3OR4" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "52.03150" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "51.99491" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[*]\\C([*])=C(\\[*])C([*])=O" xsd:string [Term] id: CHEBI:51721 name: alpha,beta-unsaturated ketone namespace: chebi_ontology def: "A ketone of general formula R(1)R(2)C=CR(3)-C(=O)R(4) (R(4) =/= H) or R(1)C#C-C(=O)R(2) (R(2) =/= H) in which the ketonic C=O function is conjugated to an unsaturated C-C bond at the alpha,beta position." [] subset: 3_STAR synonym: "alpha,beta-unsaturated ketones" RELATED [ChEBI] is_a: CHEBI:17087 ! ketone [Term] id: CHEBI:51958 name: organic polycyclic compound namespace: chebi_ontology subset: 3_STAR synonym: "organic polycyclic compounds" RELATED [ChEBI] is_a: CHEBI:33635 ! polycyclic compound is_a: CHEBI:33832 ! organic cyclic compound [Term] id: CHEBI:52206 name: biochemical role namespace: chebi_ontology def: "A biological role played by the molecular entity or part thereof within a biochemical context." [] subset: 3_STAR is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:52208 name: biophysical role namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:52209 name: aetiopathogenetic role namespace: chebi_ontology def: "A role played by the molecular entity or part thereof which causes the development of a pathological process." [] subset: 3_STAR synonym: "etiopathogenetic agent" RELATED [ChEBI] synonym: "etiopathogenetic role" RELATED [ChEBI] is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:52210 name: pharmacological role namespace: chebi_ontology def: "A biological role which describes how a drug interacts within a biological system and how the interactions affect its medicinal properties." [] subset: 3_STAR is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:52211 name: physiological role namespace: chebi_ontology subset: 1_STAR is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:52217 name: pharmaceutical namespace: chebi_ontology alt_id: CHEBI:33293 alt_id: CHEBI:33294 def: "Any substance introduced into a living organism with therapeutic or diagnostic purpose." [] subset: 3_STAR synonym: "farmaco" RELATED [ChEBI] synonym: "medicament" RELATED [ChEBI] synonym: "pharmaceuticals" RELATED [ChEBI] is_a: CHEBI:33232 ! application [Term] id: CHEBI:52254 name: apatite namespace: chebi_ontology def: "A phosphate mineral with the general formula Ca5(PO4)3X where X = OH, F or Cl." [] subset: 3_STAR synonym: "hydroxyapatite" RELATED [ChEBI] xref: HMDB:HMDB0033610 is_a: CHEBI:46723 ! phosphate mineral [Term] id: CHEBI:52255 name: hydroxylapatite namespace: chebi_ontology def: "A phosphate mineral with the formula Ca5(PO4)3(OH)." [] subset: 3_STAR is_a: CHEBI:52254 ! apatite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "Ca5HO13P3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "502.312" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "501.67595" xsd:string [Term] id: CHEBI:52395 name: oxyketone namespace: chebi_ontology def: "A compound with the general formula R2C=O (R=/=H) where one or more of the R groups contains an oxy (-O-) group." [] subset: 3_STAR synonym: "oxyketones" RELATED [ChEBI] is_a: CHEBI:17087 ! ketone [Term] id: CHEBI:52396 name: alpha-oxyketone namespace: chebi_ontology def: "An oxyketone with the general formula R2C(=O) (R=/=H) where one or more of the R groups contains an oxy (-O-) group and the oxy and carbonyl groups are bonded to the same carbon atom." [] subset: 3_STAR synonym: "alpha-oxyketones" RELATED [ChEBI] is_a: CHEBI:52395 ! oxyketone [Term] id: CHEBI:52625 name: inorganic hydroxy compound namespace: chebi_ontology subset: 3_STAR synonym: "inorganic hydroxides" RELATED [ChEBI] is_a: CHEBI:24651 ! hydroxides is_a: CHEBI:24835 ! inorganic molecular entity [Term] id: CHEBI:52845 name: cyclic organic group namespace: chebi_ontology def: "An organic group that consists of a closed ring. It may be a substituent or a skeleton." [] subset: 3_STAR synonym: "cyclic organic groups" RELATED [ChEBI] is_a: CHEBI:33247 ! organic group [Term] id: CHEBI:53000 name: epitope namespace: chebi_ontology def: "The biological role played by a material entity when bound by a receptor of the adaptive immune system. Specific site on an antigen to which an antibody binds." [] subset: 3_STAR synonym: "antigenic determinant" RELATED [ChEBI] synonym: "epitope function" RELATED [ChEBI] synonym: "epitope role" RELATED [ChEBI] is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:53309 name: polyanionic macromolecule namespace: chebi_ontology def: "A polymer carrying multiple negative charges." [] subset: 3_STAR synonym: "polyanion" RELATED [ChEBI] synonym: "polyanions" RELATED [SUBMITTER] is_a: CHEBI:53368 ! ionic macromolecule [Term] id: CHEBI:53368 name: ionic macromolecule namespace: chebi_ontology def: "A macromolecule containing ionic groups." [] subset: 3_STAR synonym: "ionic polymer" RELATED [ChEBI] synonym: "polyionic macromolecule" RELATED [ChEBI] is_a: CHEBI:33839 ! macromolecule [Term] id: CHEBI:5391 name: glucagon namespace: chebi_ontology def: "A 29-amino acid peptide hormone consisting of His, Ser, Gln, Gly, Thr, Phe, Thr, Ser, Asp, Tyr, Ser, Lys, Tyr, Leu, Asp, Ser, Arg, Arg, Ala, Gln, Asp, Phe, Val, Gln, Trp, Leu, Met, Asn and Thr residues joined in sequence." [] subset: 3_STAR synonym: "Glucagon" EXACT [KEGG_COMPOUND] synonym: "glucagon" RELATED INN [ChemIDplus] synonym: "Glucagone" RELATED [ChemIDplus] synonym: "glucagonum" RELATED INN [ChemIDplus] synonym: "His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr" RELATED [ChEBI] synonym: "His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr" RELATED [ChemIDplus] synonym: "HSQGTFTSDYSKYLDSRRAQDFVQWLMNT" RELATED [ChEBI] synonym: "L-histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-alpha-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-asparaginyl-L-threonine" EXACT IUPAC_NAME [IUPAC] xref: CAS:16941-32-5 {source="ChemIDplus"} xref: CAS:9007-92-5 {source="KEGG COMPOUND"} xref: CAS:9007-92-5 {source="ChemIDplus"} xref: Drug_Central:2994 {source="DrugCentral"} xref: DrugBank:DB00040 xref: KEGG:C01501 xref: KEGG:D00116 xref: PMID:21940356 {source="Europe PMC"} xref: PMID:22014161 {source="Europe PMC"} xref: PMID:22154917 {source="Europe PMC"} xref: PMID:22166985 {source="Europe PMC"} xref: PMID:22167521 {source="Europe PMC"} xref: PMID:22214853 {source="Europe PMC"} xref: PMID:22227186 {source="Europe PMC"} xref: PMID:22286080 {source="Europe PMC"} xref: PMID:22294753 {source="Europe PMC"} xref: PMID:22318544 {source="Europe PMC"} xref: PMID:22334714 {source="Europe PMC"} xref: PMID:22399501 {source="Europe PMC"} xref: PMID:22438981 {source="Europe PMC"} xref: PMID:22454291 {source="Europe PMC"} xref: Reaxys:13191924 {source="Reaxys"} xref: Wikipedia:Glucagon is_a: CHEBI:25905 ! peptide hormone property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C153H225N43O49S" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "MASNOZXLGMXCHN-ZLPAWPGGSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "3482.74700" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3480.61570" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O" xsd:string [Term] id: CHEBI:5686 name: heterocyclic compound namespace: chebi_ontology def: "A cyclic compound having as ring members atoms of at least two different elements." [ANON:ANON] subset: 3_STAR synonym: "compuesto heterociclico" RELATED [IUPAC] synonym: "compuesto heterociclico" RELATED [IUPAC:] synonym: "compuestos heterociclicos" RELATED [IUPAC:] synonym: "compuestos heterociclicos" RELATED [IUPAC] synonym: "heterocycle" RELATED [ChEBI:] synonym: "heterocycle" RELATED [ChEBI] synonym: "Heterocyclic compound" EXACT [KEGG COMPOUND:] synonym: "Heterocyclic compound" EXACT [KEGG_COMPOUND] synonym: "heterocyclic compounds" RELATED [ChEBI:] synonym: "heterocyclic compounds" RELATED [ChEBI] is_a: CHEBI:33595 ! cyclic compound [Term] id: CHEBI:57305 name: glycine zwitterion namespace: chebi_ontology def: "An amino acid zwitterion arising from transfer of a proton from the carboxy to the amino group of glycine." [] subset: 3_STAR synonym: "2-azaniumylacetate" EXACT IUPAC_NAME [IUPAC] synonym: "glycine" RELATED [UniProt] xref: Gmelin:1807 {source="Gmelin"} xref: MetaCyc:GLY is_a: CHEBI:35238 ! amino acid zwitterion relationship: is_tautomer_of CHEBI:15428 ! glycine property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H5NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C2H5NO2/c3-1-2(4)5/h1,3H2,(H,4,5)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "DHMQDGOQFOQNFH-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "75.06660" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "75.03203" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CC([O-])=O" xsd:string [Term] id: CHEBI:57652 name: chondroitin D-glucuronate anion namespace: chebi_ontology def: "Anionic form of chondroitin D-glucuronate arising from deprotonation of the carboxylic acid groups of the repeating units; major species at pH 7.3." [] subset: 3_STAR synonym: "chondroitin D-glucuronate" RELATED [UniProt] synonym: "chondroitin D-glucuronate polyanion" RELATED [ChEBI] is_a: CHEBI:61469 ! polyanionic polymer relationship: is_conjugate_base_of CHEBI:16137 ! chondroitin D-glucuronate property_value: http://purl.obolibrary.org/obo/chebi/formula "H2O(C14H20NO11)n" xsd:string [Term] id: CHEBI:57887 name: tryptaminium namespace: chebi_ontology def: "An ammonium ion that is the conjugate acid of tryptamine arising from protonation of the primary amino group; major species at pH 7.3." [] subset: 3_STAR synonym: "2-(1H-indol-3-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "tryptamine" RELATED [UniProt] synonym: "tryptaminium cation" RELATED [ChEBI] synonym: "tryptaminium(1+)" RELATED [ChEBI] xref: Gmelin:533978 {source="Gmelin"} is_a: CHEBI:65296 ! primary ammonium ion relationship: is_conjugate_acid_of CHEBI:16765 ! tryptamine relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:76924 ! has role plant metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C10H13N2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "APJYDQYYACXCRM-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "161.22310" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "161.10732" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]c2ccccc12" xsd:string [Term] id: CHEBI:57977 name: bilirubin(2-) namespace: chebi_ontology def: "A dicarboxylic acid dianion obtained by deprotonation of the two carboxy groups of bilirubin; major species at pH 7.3." [] subset: 3_STAR synonym: "2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-1,10,19,22,23,24-hexahydro-21H-biline-8,12-dipropanoate" RELATED [ChEBI] synonym: "bilirubin dianion" RELATED [ChEBI] synonym: "bilirubin IXalpha" RELATED [UniProt] xref: Beilstein:4083310 {source="Beilstein"} is_a: CHEBI:28965 ! dicarboxylic acid dianion is_a: CHEBI:59252 ! linear tetrapyrrole anion relationship: is_conjugate_base_of CHEBI:16990 ! bilirubin IXalpha relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "-2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C33H34N4O6" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/p-2/b26-13-,27-14-" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BPYKTIZUTYGOLE-IFADSCNNSA-L" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "582.64630" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "582.24893" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "CC1=C(C=C)\\C(NC1=O)=C\\c1[nH]c(Cc2[nH]c(\\C=C3NC(=O)C(C=C)=C/3C)c(C)c2CCC([O-])=O)c(CCC([O-])=O)c1C" xsd:string [Term] id: CHEBI:58432 name: histaminium namespace: chebi_ontology def: "An ammonium ion that is the conjugate acid of histamine protonated on the side-chain nitrogen." [] subset: 3_STAR synonym: "2-(1H-imidazol-4-yl)ethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "histamine" RELATED [UniProt] synonym: "histaminium cation" RELATED [ChEBI] is_a: CHEBI:35274 ! ammonium ion derivative relationship: is_conjugate_acid_of CHEBI:18295 ! histamine relationship: RO:0000087 CHEBI:75771 ! has role mouse metabolite relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C5H10N3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C5H9N3/c6-2-1-5-3-7-4-8-5/h3-4H,1-2,6H2,(H,7,8)/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NTYJJOPFIAHURM-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "112.15300" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "112.08692" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1c[nH]cn1" xsd:string [Term] id: CHEBI:58951 name: short-chain fatty acid anion namespace: chebi_ontology def: "Any fatty acid anion obtained by removal of a proton from the carboxy group of a short-chain fatty acid (chain length of less than C6)." [] subset: 3_STAR synonym: "a short-chain fatty acid" RELATED [UniProt] synonym: "short-chain fatty acid anions" RELATED [ChEBI] is_a: CHEBI:28868 ! fatty acid anion relationship: is_conjugate_base_of CHEBI:26666 ! short-chain fatty acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "CO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "44.010" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "43.98983" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string [Term] id: CHEBI:58953 name: saturated fatty acid anion namespace: chebi_ontology def: "Any fatty acid anion in which there is no C-C unsaturation." [] subset: 3_STAR synonym: "saturated fatty acid anions" RELATED [ChEBI] is_a: CHEBI:28868 ! fatty acid anion [Term] id: CHEBI:58954 name: straight-chain saturated fatty acid anion namespace: chebi_ontology def: "Any saturated fatty acid anion lacking a carbon side-chain." [] subset: 3_STAR synonym: "straight-chain saturated fatty acid anions" RELATED [ChEBI] is_a: CHEBI:58953 ! saturated fatty acid anion relationship: is_conjugate_base_of CHEBI:39418 ! straight-chain saturated fatty acid [Term] id: CHEBI:58958 name: organosulfate oxoanion namespace: chebi_ontology def: "An organic anion of general formula RS(=O)2O(-) where R is an organyl group." [] subset: 3_STAR synonym: "organosulfate oxoanions" RELATED [ChEBI] is_a: CHEBI:25696 ! organic anion is_a: CHEBI:33482 ! sulfur oxoanion relationship: has_functional_parent CHEBI:16189 ! sulfate relationship: is_conjugate_base_of CHEBI:25704 ! organic sulfate property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "O4SR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "96.06300" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "95.95173" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]S(=O)(=O)O[*]" xsd:string [Term] id: CHEBI:59202 name: straight-chain fatty acid namespace: chebi_ontology def: "Any fatty acid whose skeletal carbon atoms form an unbranched open chain." [] subset: 3_STAR synonym: "straight-chain fatty acids" RELATED [ChEBI] is_a: CHEBI:35366 ! fatty acid relationship: is_conjugate_acid_of CHEBI:59203 ! straight-chain fatty acid anion [Term] id: CHEBI:59203 name: straight-chain fatty acid anion namespace: chebi_ontology def: "A fatty acid anion formed by deprotonation of the carboxylic acid functional group of a straight-chain fatty acid." [] subset: 3_STAR synonym: "straight-chain FA anion" RELATED [ChEBI] synonym: "straight-chain FA anions" RELATED [ChEBI] synonym: "straight-chain fatty acid anions" RELATED [ChEBI] is_a: CHEBI:28868 ! fatty acid anion relationship: is_conjugate_base_of CHEBI:59202 ! straight-chain fatty acid [Term] id: CHEBI:59252 name: linear tetrapyrrole anion namespace: chebi_ontology def: "An organic anion arising from deprotonation of a acyclic tetrapyrrole compound." [] subset: 3_STAR synonym: "acyclic tetrapyrrole anion" RELATED [ChEBI] synonym: "acyclic tetrapyrrole anions" RELATED [ChEBI] synonym: "linear tetrapyrrole anions" RELATED [ChEBI] is_a: CHEBI:25696 ! organic anion [Term] id: CHEBI:59698 name: phosphoric acids namespace: chebi_ontology def: "Compounds containing one or more phosphoric acid units." [] subset: 3_STAR is_a: CHEBI:33457 ! phosphorus oxoacid [Term] id: CHEBI:59740 name: nucleophilic reagent namespace: chebi_ontology def: "A reagent that forms a bond to its reaction partner (the electrophile) by donating both bonding electrons." [] subset: 3_STAR synonym: "nucleophile" RELATED [ChEBI] synonym: "nucleophiles" RELATED [ChEBI] synonym: "nucleophilic reagents" RELATED [ChEBI] is_a: CHEBI:33893 ! reagent is_a: CHEBI:39144 ! Lewis base [Term] id: CHEBI:59814 name: L-alpha-amino acid anion namespace: chebi_ontology def: "Conjugate base of an L-alpha-amino acid arising from deprotonation of the C-1 carboxy group." [] subset: 3_STAR synonym: "L-alpha-amino carboxylate" RELATED [ChEBI] is_a: CHEBI:33558 ! alpha-amino-acid anion relationship: is_conjugate_base_of CHEBI:15705 ! L-alpha-amino acid property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H3NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "73.051" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "73.01638" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[C@H](C(=O)[O-])(N)*" xsd:string [Term] id: CHEBI:59826 name: progestin namespace: chebi_ontology def: "A synthetic progestogen." [] subset: 3_STAR synonym: "progestins" RELATED [ChEBI] xref: Wikipedia:Progestin is_a: CHEBI:50745 ! progestogen [Term] id: CHEBI:59869 name: L-alpha-amino acid zwitterion namespace: chebi_ontology def: "Zwitterionic form of an L-alpha-amino acid having an anionic carboxy group and a protonated amino group." [] subset: 3_STAR synonym: "an L-alpha-amino acid" RELATED [UniProt] synonym: "L-alpha-amino acid zwitterions" RELATED [ChEBI] is_a: CHEBI:78608 ! alpha-amino acid zwitterion relationship: is_tautomer_of CHEBI:15705 ! L-alpha-amino acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+][C@@H]([*])C([O-])=O" xsd:string [Term] id: CHEBI:59888 name: gamma-aminobutyric acid zwitterion namespace: chebi_ontology def: "Zwitterionic form of gamma-aminobutyric acid having an anionic carboxy group and a protonated amino group." [] subset: 3_STAR synonym: "4-aminobutanoate" RELATED [UniProt] synonym: "4-ammoniobutanoate" RELATED [ChEBI] synonym: "4-azaniumylbutanoate" EXACT IUPAC_NAME [IUPAC] xref: Gmelin:1041559 {source="Gmelin"} is_a: CHEBI:35238 ! amino acid zwitterion relationship: is_tautomer_of CHEBI:16865 ! gamma-aminobutyric acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H9NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "BTCSSZJGUNDROE-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "103.11980" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "103.06333" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCCC([O-])=O" xsd:string [Term] id: CHEBI:59905 name: dopaminium(1+) namespace: chebi_ontology def: "An ammonium ion that is the conjugate acid of dopamine; major species at pH 7.3." [] subset: 3_STAR synonym: "2-(3,4-dihydroxyphenyl)ethan-1-aminium" RELATED [ChEBI] synonym: "2-(3,4-dihydroxyphenyl)ethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "dopamine" RELATED [UniProt] synonym: "dopaminium cation" RELATED [ChEBI] xref: Gmelin:328863 {source="Gmelin"} is_a: CHEBI:35274 ! ammonium ion derivative relationship: is_conjugate_acid_of CHEBI:18243 ! dopamine relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H12NO2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO2/c9-4-3-6-1-2-7(10)8(11)5-6/h1-2,5,10-11H,3-4,9H2/p+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "VYFYYTLLBUKUHU-UHFFFAOYSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "154.18640" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "154.08626" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]CCc1ccc(O)c(O)c1" xsd:string [Term] id: CHEBI:59999 name: chemical substance namespace: chebi_ontology def: "A chemical substance is a portion of matter of constant composition, composed of molecular entities of the same type or of different types." [] subset: 3_STAR synonym: "Chemische Substanz" RELATED [ChEBI] is_a: CHEBI:24431 ! chemical entity [Term] id: CHEBI:60004 name: mixture namespace: chebi_ontology def: "A mixture is a chemical substance composed of multiple molecules, at least two of which are of a different kind." [] subset: 3_STAR synonym: "Mischung" RELATED [ChEBI] is_a: CHEBI:59999 ! chemical substance [Term] id: CHEBI:60027 name: polymer namespace: chebi_ontology def: "A polymer is a mixture, which is composed of macromolecules of different kinds and which may be differentiated by composition, length, degree of branching etc.." [] subset: 3_STAR synonym: "Kunststoff" RELATED [ChEBI] synonym: "Polymer" EXACT [ChEBI] xref: Wikipedia:Polymer is_a: CHEBI:60004 ! mixture relationship: has_part CHEBI:33839 ! macromolecule [Term] id: CHEBI:60164 name: ionic polymer namespace: chebi_ontology def: "An ionic polymer is a polymer, composed of ionic macromolecules." [] subset: 3_STAR synonym: "polyionic polymer" RELATED [ChEBI] is_a: CHEBI:60027 ! polymer relationship: has_part CHEBI:53368 ! ionic macromolecule [Term] id: CHEBI:60240 name: divalent metal cation namespace: chebi_ontology def: "A metal cation with a valence of two." [] subset: 3_STAR synonym: "a divalent metal cation" RELATED [UniProt] is_a: CHEBI:25213 ! metal cation is_a: CHEBI:64641 ! divalent inorganic cation [Term] id: CHEBI:60242 name: monovalent inorganic cation namespace: chebi_ontology def: "An atom or small molecule with a positive charge that does not contain carbon in covalent linkage, with a valency of one." [] subset: 3_STAR synonym: "a monovalent cation" RELATED [UniProt] is_a: CHEBI:36915 ! inorganic cation [Term] id: CHEBI:60466 name: peptide zwitterion namespace: chebi_ontology def: "Zwitterionic form of any peptide where, in general, the amino terminus is positively charged and the carboxy terminus is negatively charged." [] subset: 3_STAR synonym: "a peptide" RELATED [UniProt] synonym: "peptide zwitterions" RELATED [ChEBI] is_a: CHEBI:27369 ! zwitterion relationship: is_tautomer_of CHEBI:16670 ! peptide property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R(C2H2NOR)n" xsd:string [Term] id: CHEBI:60809 name: adjuvant namespace: chebi_ontology def: "Any pharmacological or immunological agent that modifies the effect of other agents such as drugs or vaccines while having few if any direct effects when given by itself." [] subset: 3_STAR synonym: "adjuvants" RELATED [ChEBI] is_a: CHEBI:52217 ! pharmaceutical [Term] id: CHEBI:60924 name: keratan sulfate namespace: chebi_ontology def: "A sulfated glycosaminoglycan, a linear polymer that consists of the repeating disaccharide [3)-beta-Gal-(1->4)-beta-GlcNAc-(1->] and containing sulfo groups located at random positions." [] subset: 3_STAR synonym: "keratan sulfates" RELATED [ChEBI] synonym: "keratosulfate" RELATED [SUBMITTER] is_a: CHEBI:35722 ! sulfated glycosaminoglycan is_a: CHEBI:37395 ! mucopolysaccharide relationship: has_functional_parent CHEBI:29057 ! keratan [Term] id: CHEBI:61073 name: oxygen radical namespace: chebi_ontology def: "An inorganic radical in which a free electron resides on one or more oxygen atoms of an oxygen species." [] subset: 3_STAR synonym: "oxygen radicals" RELATED [ChEBI] is_a: CHEBI:26523 ! reactive oxygen species is_a: CHEBI:36871 ! inorganic radical [Term] id: CHEBI:61115 name: EC 3.5.1.98 (histone deacetylase) inhibitor namespace: chebi_ontology def: "An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the function of histone deacetylase (EC 3.5.1.98)." [] subset: 3_STAR synonym: "EC 3.5.1.98 (histone deacetylase) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.1.98 inhibitor" RELATED [ChEBI] synonym: "EC 3.5.1.98 inhibitors" RELATED [ChEBI] synonym: "HDAC inhibitor" RELATED [ChEBI] synonym: "HDAC inhibitors" RELATED [ChEBI] synonym: "HDACi" RELATED [ChEBI] synonym: "HDACis" RELATED [ChEBI] synonym: "HDI" RELATED [ChEBI] synonym: "HDIs" RELATED [ChEBI] synonym: "histone amidohydrolase inhibitor" RELATED [ChEBI] synonym: "histone amidohydrolase inhibitors" RELATED [ChEBI] synonym: "histone deacetylase (EC 3.5.1.98) inhibitor" RELATED [ChEBI] synonym: "histone deacetylase (EC 3.5.1.98) inhibitors" RELATED [ChEBI] synonym: "histone deacetylase inhibitor" RELATED [ChEBI] synonym: "histone deacetylase inhibitors" RELATED [ChEBI] xref: Wikipedia:Histone_deacetylase_inhibitor is_a: CHEBI:76807 ! EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor [Term] id: CHEBI:61120 name: nucleobase-containing molecular entity namespace: chebi_ontology def: "Any compound that has a nucleobase as a part." [] subset: 3_STAR synonym: "nucleobase-containing compound" RELATED [SUBMITTER] synonym: "nucleobase-containing compounds" RELATED [ChEBI] synonym: "nucleobase-containing molecular entities" RELATED [ChEBI] is_a: CHEBI:33833 ! heteroarene is_a: CHEBI:51143 ! nitrogen molecular entity relationship: has_functional_parent CHEBI:18282 ! nucleobase [Term] id: CHEBI:61313 name: C21-steroid namespace: chebi_ontology def: "A steroid that has a structure based on a 21-carbon (pregnane) skeleton. Note that individual examples may have ring substituents at other positions and/or contain double bonds, aromatic A-rings, expanded/contracted rings etc., so the formula and mass may vary from that given for the generic structure." [] subset: 3_STAR synonym: "a C21-steroid" RELATED [UniProt] is_a: CHEBI:35341 ! steroid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H36" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H36/c1-4-15-9-11-18-17-10-8-16-7-5-6-13-20(16,2)19(17)12-14-21(15,18)3/h15-19H,4-14H2,1-3H3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "JWMFYGXQPXQEEM-UHFFFAOYSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "288.511" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.28170" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1CCCC2C1(C3C(CC2)C4C(CC3)(C(CC4)CC)C)C" xsd:string [Term] id: CHEBI:61469 name: polyanionic polymer namespace: chebi_ontology def: "A polymer, composed of polyanion macromolecules." [] subset: 3_STAR synonym: "polyanion" RELATED [ChEBI] synonym: "polyanions" RELATED [ChEBI] is_a: CHEBI:60164 ! ionic polymer relationship: has_part CHEBI:53309 ! polyanionic macromolecule [Term] id: CHEBI:62031 name: polar amino acid zwitterion namespace: chebi_ontology def: "Zwitterionic form of a polar amino acid having an anionic carboxy group and a protonated amino group." [] subset: 2_STAR synonym: "a polar amino acid" RELATED [UniProt] xref: MetaCyc:Polar-amino-acids {source="SUBMITTER"} is_a: CHEBI:35238 ! amino acid zwitterion relationship: is_tautomer_of CHEBI:26167 ! polar amino acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(C([O-])=O)(*)[NH3+]" xsd:string [Term] id: CHEBI:62488 name: signalling molecule namespace: chebi_ontology def: "A molecular messenger in which the molecule is specifically involved in transmitting information between cells. Such molecules are released from the cell sending the signal, cross over the gap between cells by diffusion, and interact with specific receptors in another cell, triggering a response in that cell by activating a series of enzyme controlled reactions which lead to changes inside the cell." [] subset: 3_STAR synonym: "signal molecule" RELATED [ChEBI] synonym: "signal molecules" RELATED [ChEBI] synonym: "signaling molecule" RELATED [ChEBI] synonym: "signaling molecules" RELATED [ChEBI] synonym: "signalling molecules" RELATED [ChEBI] is_a: CHEBI:33280 ! molecular messenger [Term] id: CHEBI:62764 name: reactive nitrogen species namespace: chebi_ontology def: "A family of nitrogen molecular entities which are highly reactive and derived from nitric oxide (.NO) and superoxide (O2.(-)) produced via the enzymatic activity of inducible nitric oxide synthase 2 (NOS2) and NADPH oxidase respectively." [] subset: 3_STAR synonym: "RNI" RELATED [SUBMITTER] synonym: "RNS" RELATED [SUBMITTER] xref: PMID:12076975 {source="SUBMITTER"} xref: PMID:17667957 {source="SUBMITTER"} xref: PMID:9741578 {source="SUBMITTER"} xref: Wikipedia:Reactive_nitrogen_species is_a: CHEBI:51143 ! nitrogen molecular entity [Term] id: CHEBI:62868 name: hepatoprotective agent namespace: chebi_ontology def: "Any compound that is able to prevent damage to the liver." [] subset: 3_STAR synonym: "antihepatotoxic agent" RELATED [ChEBI] synonym: "hepatoprotective agents" RELATED [ChEBI] synonym: "hepatoprotector" RELATED [ChEBI] is_a: CHEBI:50267 ! protective agent [Term] id: CHEBI:63248 name: oxidising agent namespace: chebi_ontology def: "A substance that removes electrons from another reactant in a redox reaction." [] subset: 3_STAR synonym: "oxidant" RELATED [ChEBI] synonym: "oxidants" RELATED [ChEBI] synonym: "oxidiser" RELATED [ChEBI] synonym: "oxidisers" RELATED [ChEBI] synonym: "oxidising agents" RELATED [ChEBI] synonym: "oxidizer" RELATED [ChEBI] synonym: "oxidizers" RELATED [ChEBI] synonym: "oxidizing agent" RELATED [ChEBI] synonym: "oxidizing agents" RELATED [ChEBI] is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:63299 name: carbohydrate derivative namespace: chebi_ontology def: "Any organooxygen compound derived from a carbohydrate by replacement of one or more hydroxy group(s) by an amino group, a thiol group or similar heteroatomic groups. The term also includes derivatives of these compounds." [] subset: 3_STAR synonym: "carbohydrate derivatives" RELATED [ChEBI] synonym: "derivatised carbohydrate" RELATED [ChEBI] synonym: "derivatised carbohydrates" RELATED [ChEBI] synonym: "derivatized carbohydrate" RELATED [ChEBI] synonym: "derivatized carbohydrates" RELATED [ChEBI] is_a: CHEBI:78616 ! carbohydrates and carbohydrate derivatives relationship: has_functional_parent CHEBI:16646 ! carbohydrate [Term] id: CHEBI:63436 name: carbohydrate acid derivative namespace: chebi_ontology def: "A carbohydrate derivative that is formally obtained from a carbohydrate acid." [] subset: 3_STAR synonym: "carbohydrate acid derivatives" RELATED [ChEBI] is_a: CHEBI:63299 ! carbohydrate derivative relationship: has_functional_parent CHEBI:33720 ! carbohydrate acid relationship: is_conjugate_acid_of CHEBI:63551 ! carbohydrate acid derivative anion [Term] id: CHEBI:63534 name: monoamine namespace: chebi_ontology def: "An aralylamino compound which contains one amino group connected to an aromatic ring by a two-carbon chain. Monoamines are derived from aromatic amino acids like phenylalanine, tyrosine, tryptophan, and the thyroid hormones by the action of aromatic amino acid decarboxylase enzymes." [] subset: 3_STAR synonym: "monoamines" RELATED [ChEBI] synonym: "naturally occurring monoamine" RELATED [ChEBI] synonym: "naturally occurring monoamines" RELATED [ChEBI] xref: PMID:21822758 {source="Europe PMC"} xref: PMID:21993877 {source="Europe PMC"} xref: PMID:22005599 {source="Europe PMC"} xref: PMID:22082101 {source="Europe PMC"} xref: PMID:22153577 {source="Europe PMC"} xref: PMID:22213370 {source="Europe PMC"} xref: PMID:22218931 {source="Europe PMC"} xref: PMID:22342987 {source="Europe PMC"} xref: PMID:22371656 {source="Europe PMC"} is_a: CHEBI:64365 ! aralkylamino compound [Term] id: CHEBI:63551 name: carbohydrate acid derivative anion namespace: chebi_ontology def: "A carboxylic acid anion resulting from the deprotonation of the carboxy group of a carbohydrate acid derivative." [] subset: 3_STAR synonym: "carbohydrate acid anion derivative" RELATED [ChEBI] synonym: "carbohydrate acid anion derivatives" RELATED [ChEBI] synonym: "carbohydrate acid derivative anions" RELATED [ChEBI] is_a: CHEBI:29067 ! carboxylic acid anion relationship: has_functional_parent CHEBI:33721 ! carbohydrate acid anion relationship: is_conjugate_base_of CHEBI:63436 ! carbohydrate acid derivative [Term] id: CHEBI:64047 name: food additive namespace: chebi_ontology def: "Any substance which is added to food to preserve or enhance its flavour and/or appearance." [] subset: 3_STAR synonym: "food additives" RELATED [ChEBI] xref: Wikipedia:Food_additive is_a: CHEBI:33232 ! application is_a: CHEBI:78295 ! food component [Term] id: CHEBI:64049 name: food acidity regulator namespace: chebi_ontology def: "A food additive that is used to change or otherwise control the acidity or alkalinity of foods. They may be acids, bases, neutralising agents or buffering agents." [] subset: 3_STAR synonym: "acidity regulator" RELATED [ChEBI] synonym: "acidity regulators" RELATED [ChEBI] synonym: "food acidity regulators" RELATED [ChEBI] synonym: "pH control agent" RELATED [ChEBI] synonym: "pH control agents" RELATED [ChEBI] xref: Wikipedia:Acidity_regulator is_a: CHEBI:64047 ! food additive [Term] id: CHEBI:64365 name: aralkylamino compound namespace: chebi_ontology def: "An organic amino compound in which an aminoalkyl group is linked to an arene." [] subset: 3_STAR synonym: "aralkylamino compounds" RELATED [ChEBI] is_a: CHEBI:50047 ! organic amino compound [Term] id: CHEBI:64570 name: EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitor namespace: chebi_ontology def: "An EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor that interferes with the action of glycine hydroxymethyltransferase (EC 2.1.2.1)." [] subset: 3_STAR synonym: "5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitor" RELATED [ChEBI] synonym: "5,10-methylenetetrahydrofolate:glycine hydroxymethyltransferase inhibitors" RELATED [ChEBI] synonym: "allothreonine aldolase inhibitor" RELATED [ChEBI] synonym: "allothreonine aldolase inhibitors" RELATED [ChEBI] synonym: "EC 2.1.2.1 (glycine hydroxymethyltransferase) inhibitors" RELATED [ChEBI] synonym: "EC 2.1.2.1 inhibitor" RELATED [ChEBI] synonym: "EC 2.1.2.1 inhibitors" RELATED [ChEBI] synonym: "glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitor" RELATED [ChEBI] synonym: "glycine hydroxymethyltransferase (EC 2.1.2.1) inhibitors" RELATED [ChEBI] synonym: "glycine hydroxymethyltransferase inhibitor" RELATED [ChEBI] synonym: "glycine hydroxymethyltransferase inhibitors" RELATED [ChEBI] synonym: "L-serine hydroxymethyltransferase inhibitor" RELATED [ChEBI] synonym: "L-serine hydroxymethyltransferase inhibitors" RELATED [ChEBI] synonym: "L-threonine aldolase inhibitor" RELATED [ChEBI] synonym: "L-threonine aldolase inhibitors" RELATED [ChEBI] synonym: "serine aldolase inhibitor" RELATED [ChEBI] synonym: "serine aldolase inhibitors" RELATED [ChEBI] synonym: "serine hydroxymethylase inhibitor" RELATED [ChEBI] synonym: "serine hydroxymethylase inhibitors" RELATED [ChEBI] synonym: "serine hydroxymethyltransferase inhibitor" RELATED [ChEBI] synonym: "serine hydroxymethyltransferase inhibitors" RELATED [ChEBI] synonym: "serine transhydroxymethylase inhibitor" RELATED [ChEBI] synonym: "serine transhydroxymethylase inhibitors" RELATED [ChEBI] synonym: "threonine aldolase inhibitor" RELATED [ChEBI] synonym: "threonine aldolase inhibitors" RELATED [ChEBI] xref: Wikipedia:Glycine_hydroxymethyltransferase is_a: CHEBI:76874 ! EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor [Term] id: CHEBI:64571 name: NMDA receptor agonist namespace: chebi_ontology def: "An excitatory amino acid agonist which binds to NMDA receptors and triggers a response." [] subset: 3_STAR synonym: "N-methyl-D-aspartate receptor agonist" RELATED [ChEBI] synonym: "N-methyl-D-aspartate receptor agonists" RELATED [ChEBI] synonym: "NMDA receptor agonists" RELATED [ChEBI] synonym: "NMDAR agonist" RELATED [ChEBI] synonym: "NMDAR agonists" RELATED [ChEBI] is_a: CHEBI:50103 ! excitatory amino acid agonist [Term] id: CHEBI:64600 name: C21-steroid hormone namespace: chebi_ontology def: "A steroid compound with a structure based on a 21-carbon (pregnane) skeleton that acts as a hormone." [] subset: 3_STAR synonym: "C21-steroid hormones" RELATED [ChEBI] is_a: CHEBI:26764 ! steroid hormone is_a: CHEBI:61313 ! C21-steroid [Term] id: CHEBI:64628 name: somatostatin namespace: chebi_ontology def: "A fourteen-membered heterodetic cyclic peptide comprising the sequence Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys cyclised by a disulfide bridge between the two Cys residues at positions 3 and 14." [] subset: 3_STAR synonym: "Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys]" RELATED [ChEBI] synonym: "L-alanyl-N-[(4R,7S,10S,13S,16S,19S,22S,25S,28S,31S,34S,37R)-19,34-bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-13,25,28-tribenzyl-4-carboxy-10,16-bis[(1R)-1-hydroxyethyl]-7-(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6,9,12,15,18,21,24,27,30,33,36-undecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35-undecaazacyclooctatriacontan-37-yl]glycinamide" EXACT IUPAC_NAME [IUPAC] synonym: "L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide" RELATED [ChemIDplus] synonym: "somatostatin" RELATED INN [KEGG_DRUG] synonym: "Somatostatin-1" RELATED [KEGG_COMPOUND] synonym: "Somatostatin-14" RELATED [KEGG_COMPOUND] synonym: "somatostatina" RELATED INN [ChemIDplus] synonym: "somatostatine" RELATED INN [ChemIDplus] synonym: "somatostatinum" RELATED INN [ChemIDplus] synonym: "Synthetic growth hormone release-inhibiting hormone" RELATED [ChemIDplus] xref: CAS:38916-34-6 {source="KEGG DRUG"} xref: CAS:38916-34-6 {source="ChemIDplus"} xref: Drug_Central:2997 {source="DrugCentral"} xref: HMDB:HMDB0013072 xref: KEGG:C16022 xref: KEGG:D07431 xref: LINCS:LSM-5326 xref: PMID:21922516 {source="Europe PMC"} xref: PMID:22129035 {source="Europe PMC"} xref: PMID:22147011 {source="Europe PMC"} xref: PMID:22251942 {source="Europe PMC"} xref: PMID:22483686 {source="Europe PMC"} xref: PMID:22509294 {source="Europe PMC"} xref: Reaxys:10148626 {source="Reaxys"} xref: Wikipedia:Somatostatin is_a: CHEBI:24533 ! heterodetic cyclic peptide is_a: CHEBI:25905 ! peptide hormone property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C76H104N18O19S2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C76H104N18O19S2/c1-41(79)64(100)82-37-61(99)83-58-39-114-115-40-59(76(112)113)92-72(108)57(38-95)91-75(111)63(43(3)97)94-71(107)54(33-46-23-11-6-12-24-46)90-74(110)62(42(2)96)93-66(102)51(28-16-18-30-78)84-69(105)55(34-47-36-81-49-26-14-13-25-48(47)49)88-68(104)53(32-45-21-9-5-10-22-45)86-67(103)52(31-44-19-7-4-8-20-44)87-70(106)56(35-60(80)98)89-65(101)50(85-73(58)109)27-15-17-29-77/h4-14,19-26,36,41-43,50-59,62-63,81,95-97H,15-18,27-35,37-40,77-79H2,1-3H3,(H2,80,98)(H,82,100)(H,83,99)(H,84,105)(H,85,109)(H,86,103)(H,87,106)(H,88,104)(H,89,101)(H,90,110)(H,91,111)(H,92,108)(H,93,102)(H,94,107)(H,112,113)/t41-,42+,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,59-,62-,63-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "NHXLMOGPVYXJNR-ATOGVRKGSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "1637.87800" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1636.71666" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC1=O)[C@@H](C)O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N" xsd:string [Term] id: CHEBI:64641 name: divalent inorganic cation namespace: chebi_ontology def: "An inorganic cation with a valency of two." [] subset: 3_STAR is_a: CHEBI:36915 ! inorganic cation [Term] id: CHEBI:64708 name: one-carbon compound namespace: chebi_ontology def: "An organic molecular entity containing a single carbon atom (C1)." [] subset: 3_STAR synonym: "one-carbon compounds" RELATED [ChEBI] is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:64709 name: organic acid namespace: chebi_ontology def: "Any organic molecular entity that is acidic and contains carbon in covalent linkage." [] subset: 3_STAR synonym: "organic acids" RELATED [ChEBI] is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:64909 name: poison namespace: chebi_ontology def: "Any substance that causes disturbance to organisms by chemical reaction or other activity on the molecular scale, when a sufficient quantity is absorbed by the organism." [] subset: 3_STAR synonym: "poisonous agent" RELATED [ChEBI] synonym: "poisonous agents" RELATED [ChEBI] synonym: "poisonous substance" RELATED [ChEBI] synonym: "poisonous substances" RELATED [ChEBI] synonym: "poisons" RELATED [ChEBI] synonym: "toxic agent" RELATED [ChEBI] synonym: "toxic agents" RELATED [ChEBI] synonym: "toxic substance" RELATED [ChEBI] synonym: "toxic substances" RELATED [ChEBI] xref: Wikipedia:Poison is_a: CHEBI:24432 ! biological role [Term] id: CHEBI:6495 name: lipoprotein namespace: chebi_ontology def: "A clathrate complex consisting of a lipid enwrapped in a protein host without covalent binding in such a way that the complex has a hydrophilic outer surface consisting of all the protein and the polar ends of any phospholipids." [] subset: 3_STAR synonym: "Lipoprotein" EXACT [KEGG_COMPOUND] synonym: "lipoprotein particle" RELATED [ChEBI] synonym: "lipoproteins" EXACT IUPAC_NAME [IUPAC] xref: KEGG:C01834 is_a: CHEBI:33837 ! conjugated protein is_a: CHEBI:39024 ! clathrate compound relationship: has_part CHEBI:39015 ! apolipoprotein relationship: RO:0000087 CHEBI:76971 ! has role Escherichia coli metabolite [Term] id: CHEBI:65212 name: polysaccharide derivative namespace: chebi_ontology def: "A carbohydrate derivative that is any derivative of a polysaccharide." [] subset: 3_STAR synonym: "polysaccharide derivatives" RELATED [ChEBI] is_a: CHEBI:167559 ! glycan is_a: CHEBI:33694 ! biomacromolecule is_a: CHEBI:63299 ! carbohydrate derivative relationship: has_functional_parent CHEBI:18154 ! polysaccharide [Term] id: CHEBI:65255 name: food preservative namespace: chebi_ontology def: "Substances which are added to food in order to prevent decomposition caused by microbial growth or by undesirable chemical changes." [] subset: 3_STAR synonym: "food preservatives" RELATED [ChEBI] is_a: CHEBI:64047 ! food additive [Term] id: CHEBI:65256 name: antimicrobial food preservative namespace: chebi_ontology def: "A food preservative which prevents decomposition of food by preventing the growth of fungi or bacteria. In European countries, E-numbers for permitted food preservatives are from E200 to E299, divided into sorbates (E200-209), benzoates (E210-219), sulfites (E220-229), phenols and formates (E230-239), nitrates (E240-259), acetates (E260-269), lactates (E270-279), propionates (E280-289) and others (E290-299)." [] subset: 3_STAR synonym: "antimicrobial food preservatives" RELATED [ChEBI] synonym: "antimicrobial preservative" RELATED [ChEBI] synonym: "antimicrobial preservatives" RELATED [ChEBI] is_a: CHEBI:33281 ! antimicrobial agent is_a: CHEBI:65255 ! food preservative [Term] id: CHEBI:65296 name: primary ammonium ion namespace: chebi_ontology def: "An ammonium ion derivative resulting from the protonation of the nitrogen atom of a primary amino compound. Major species at pH 7.3." [] subset: 3_STAR synonym: "a primary amine" RELATED [UniProt] synonym: "substituted ammonium" RELATED [ChEBI] is_a: CHEBI:25697 ! organic cation is_a: CHEBI:35274 ! ammonium ion derivative relationship: is_conjugate_acid_of CHEBI:50994 ! primary amino compound property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "H3NR" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "17.031" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "17.02655" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+][*]" xsd:string [Term] id: CHEBI:67079 name: anti-inflammatory agent namespace: chebi_ontology def: "Any compound that has anti-inflammatory effects." [] subset: 3_STAR synonym: "anti-inflammatory agents" RELATED [ChEBI] synonym: "antiinflammatory agent" RELATED [ChEBI] synonym: "antiinflammatory agents" RELATED [ChEBI] is_a: CHEBI:33232 ! application [Term] id: CHEBI:68452 name: azole namespace: chebi_ontology def: "Any monocyclic heteroarene consisting of a five-membered ring containing nitrogen. Azoles can also contain one or more other non-carbon atoms, such as nitrogen, sulfur or oxygen." [] subset: 3_STAR synonym: "azoles" RELATED [ChEBI] xref: Wikipedia:Azole is_a: CHEBI:38101 ! organonitrogen heterocyclic compound is_a: CHEBI:38179 ! monocyclic heteroarene [Term] id: CHEBI:68495 name: apoptosis inducer namespace: chebi_ontology def: "Any substance that induces the process of apoptosis (programmed cell death) in multi-celled organisms." [] subset: 3_STAR synonym: "apoptosis inducers" RELATED [ChEBI] synonym: "Type I cell-death inducer" RELATED [ChEBI] synonym: "Type I cell-death inducers" RELATED [ChEBI] synonym: "Type I programmed cell-death inducer" RELATED [ChEBI] synonym: "Type I programmed cell-death inducers" RELATED [ChEBI] is_a: CHEBI:52206 ! biochemical role [Term] id: CHEBI:70709 name: progesterone receptor agonist namespace: chebi_ontology def: "A hormone agonist that binds to and activates progesterone receptors." [] subset: 3_STAR synonym: "PR agonist" RELATED [ChEBI] synonym: "PR agonists" RELATED [ChEBI] synonym: "progesterone receptor agonists" RELATED [ChEBI] is_a: CHEBI:51060 ! hormone agonist [Term] id: CHEBI:71300 name: EC 2.* (transferase) inhibitor namespace: chebi_ontology def: "An enzyme inhibitor that inhibits the action of a transferase (EC 2.*)" [] subset: 3_STAR synonym: "EC 2 inhibitor" RELATED [ChEBI] synonym: "EC 2 inhibitors" RELATED [ChEBI] synonym: "EC 2.* (transferase) inhibitors" RELATED [ChEBI] synonym: "EC 2.* inhibitor" RELATED [ChEBI] synonym: "EC 2.* inhibitors" RELATED [ChEBI] synonym: "transferase inhibitor" RELATED [ChEBI] synonym: "transferase inhibitors" RELATED [ChEBI] xref: Wikipedia:Transferase is_a: CHEBI:23924 ! enzyme inhibitor [Term] id: CHEBI:71666 name: gamma-amino acid anion namespace: chebi_ontology def: "An amino-acid anion in which the amino group is situated gamma- to the carboxylate group." [] subset: 3_STAR synonym: "gamma-amino acid anions" RELATED [ChEBI] is_a: CHEBI:37022 ! amino-acid anion relationship: is_conjugate_base_of CHEBI:33707 ! gamma-amino acid [Term] id: CHEBI:72587 name: (R)-noradrenaline(1+) namespace: chebi_ontology def: "An organic cation that is the conjugate acid of (R)-noradrenaline, obtained by protonation of the priamry amino group; major species at pH 7.3." [] subset: 3_STAR synonym: "(2R)-2-(3,4-dihydroxyphenyl)-2-hydroxyethanaminium" EXACT IUPAC_NAME [IUPAC] synonym: "(R)-noradrenaline" RELATED [UniProt] synonym: "(R)-noradrenaline cation" RELATED [ChEBI] synonym: "(R)-noradrenalinium cation" RELATED [ChEBI] synonym: "(R)-noradrenalinium(1+)" RELATED [ChEBI] xref: PDBeChem:E5E is_a: CHEBI:166902 ! noradrenaline(1+) relationship: is_conjugate_acid_of CHEBI:18357 ! (R)-noradrenaline relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "+1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8H12NO3" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C8H11NO3/c9-4-8(12)5-1-2-6(10)7(11)3-5/h1-3,8,10-12H,4,9H2/p+1/t8-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "SFLSHLFXELFNJZ-QMMMGPOBSA-O" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "170.187" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "170.08117" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C=1(C=CC(=CC1O)[C@H](C[NH3+])O)O" xsd:string [Term] id: CHEBI:72695 name: organic molecule namespace: chebi_ontology def: "Any molecule that consists of at least one carbon atom as part of the electrically neutral entity." [] subset: 3_STAR synonym: "organic compound" RELATED [ChEBI] synonym: "organic compounds" RELATED [ChEBI] synonym: "organic molecules" RELATED [ChEBI] is_a: CHEBI:25367 ! molecule is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:72813 name: exopolysaccharide namespace: chebi_ontology def: "A biomacromolecule composed of carbohydrate residues which is secreted by a microorganism into the surrounding environment." [] subset: 3_STAR synonym: "exopolysaccharides" RELATED [ChEBI] synonym: "extracellular polymeric substance" RELATED [ChEBI] synonym: "extracellular polymeric substances" RELATED [ChEBI] xref: MetaCyc:Exopolysaccharides xref: PMID:11160795 {source="Europe PMC"} xref: PMID:11785425 {source="Europe PMC"} xref: PMID:1444258 {source="Europe PMC"} xref: PMID:15738217 {source="Europe PMC"} xref: PMID:16075348 {source="Europe PMC"} xref: PMID:17440912 {source="Europe PMC"} xref: PMID:18097339 {source="Europe PMC"} xref: PMID:19453747 {source="Europe PMC"} xref: PMID:20172021 {source="Europe PMC"} xref: PMID:20631870 {source="Europe PMC"} xref: PMID:20718297 {source="Europe PMC"} xref: PMID:2688547 {source="Europe PMC"} xref: PMID:6354590 {source="Europe PMC"} xref: Wikipedia:Exopolysaccharide xref: Wikipedia:Extracellular_polymeric_substance is_a: CHEBI:33694 ! biomacromolecule [Term] id: CHEBI:73398 name: indole skeleton namespace: chebi_ontology def: "A mancude heterobicyclic organic group consisting of a benzene ring fused to a pyrrole ring." [] subset: 3_STAR is_a: CHEBI:73541 ! organic heterobicyclic ring property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C8N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "110.09230" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "110.00307" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C1(=C(C(=C2C(=C1*)N(C(=C2*)*)*)*)*)*" xsd:string [Term] id: CHEBI:73541 name: organic heterobicyclic ring namespace: chebi_ontology def: "A bicyclic organic group that contains both carbon and hetero atoms." [] subset: 3_STAR synonym: "organic heterobicyclic rings" RELATED [ChEBI] is_a: CHEBI:52845 ! cyclic organic group [Term] id: CHEBI:74783 name: astringent namespace: chebi_ontology def: "A compound that causes the contraction of body tissues, typically used to reduce bleeding from minor abrasions." [] subset: 3_STAR synonym: "adstringent" RELATED [ChEBI] synonym: "adstringents" RELATED [ChEBI] synonym: "astringents" RELATED [ChEBI] xref: Wikipedia:Astringent is_a: CHEBI:23888 ! drug [Term] id: CHEBI:75431 name: ghrelin namespace: chebi_ontology def: "A 28-membered appetite-stimulating polypeptide consisting of Gly, Ser, Ser(octanoyl), Phe, Leu, Ser, Pro, Glu, His, Gln, Arg, Val, Gln, Gln, Arg, Lys, Glu, Ser, Lys, Lys, Pro, Pro, Ala, Lys, Leu, Gln, Pro and Arg residues joined in sequence. The O-n-octanoylation of the side-chain hydroxy group of serine-3 (Ser3) is essential for ghrelin's activity." [] subset: 3_STAR synonym: "Gastric MLTRP" RELATED [ChemIDplus] synonym: "Ghrelin (human)" RELATED [ChemIDplus] synonym: "Gly-Ser-Ser(octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg" RELATED [ChEBI] synonym: "glycyl-L-seryl-O-octanoyl-L-seryl-L-phenylalanyl-L-leucyl-L-seryl-L-prolyl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-arginyl-L-valyl-L-glutaminyl-L-glutaminyl-L-arginyl-L-lysyl-L-alpha-glutamyl-L-seryl-L-lysyl-L-lysyl-L-prolyl-L-prolyl-L-alanyl-L-lysyl-L-leucyl-L-glutaminyl-L-prolyl-L-arginine" EXACT IUPAC_NAME [IUPAC] synonym: "GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR" RELATED [ChEBI] synonym: "GSS(octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR" RELATED [ChEBI] synonym: "H-Gly-Ser-Ser(n-octanoyl)-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg-OH" RELATED [ChEBI] synonym: "Human ghrelin" RELATED [ChemIDplus] synonym: "lenomorelin" RELATED INN [WHO_MedNet] synonym: "lenomorelina" RELATED INN [WHO_MedNet] synonym: "lenomoreline" RELATED INN [WHO_MedNet] synonym: "lenomorelinum" RELATED INN [WHO_MedNet] synonym: "Motilin-related peptide" RELATED [ChemIDplus] xref: CAS:258279-04-8 {source="ChemIDplus"} xref: CAS:304853-26-7 {source="ChemIDplus"} xref: KEGG:C16025 xref: PMID:15788704 {source="Europe PMC"} xref: PMID:23159561 {source="Europe PMC"} xref: PMID:23178701 {source="Europe PMC"} xref: PMID:23278489 {source="Europe PMC"} xref: PMID:23307791 {source="Europe PMC"} xref: PMID:23316086 {source="Europe PMC"} xref: PMID:23317782 {source="Europe PMC"} xref: PMID:23359315 {source="Europe PMC"} xref: PMID:23428971 {source="Europe PMC"} xref: PMID:23481295 {source="Europe PMC"} xref: PMID:23524619 {source="Europe PMC"} xref: PMID:23624808 {source="Europe PMC"} xref: PMID:23631903 {source="Europe PMC"} xref: PMID:23652386 {source="Europe PMC"} xref: PMID:23652399 {source="Europe PMC"} xref: PMID:23652420 {source="Europe PMC"} xref: PMID:23698230 {source="Europe PMC"} xref: PMID:23704134 {source="Europe PMC"} xref: PMID:23778458 {source="Europe PMC"} xref: PMID:23804489 {source="Europe PMC"} xref: PMID:23808302 {source="Europe PMC"} xref: PMID:23843943 {source="Europe PMC"} xref: PMID:23847595 {source="Europe PMC"} xref: PMID:23965296 {source="Europe PMC"} xref: PMID:23982275 {source="Europe PMC"} xref: PMID:23989358 {source="Europe PMC"} xref: PMID:28538835 {source="Europe PMC"} xref: PMID:28542403 {source="Europe PMC"} xref: PMID:28547758 {source="Europe PMC"} xref: PMID:28590260 {source="Europe PMC"} xref: PMID:28621678 {source="Europe PMC"} xref: PMID:28704966 {source="Europe PMC"} xref: Reaxys:24715767 {source="Reaxys"} xref: Wikipedia:Ghrelin is_a: CHEBI:15841 ! polypeptide is_a: CHEBI:25905 ! peptide hormone relationship: RO:0000087 CHEBI:35610 ! has role antineoplastic agent relationship: RO:0000087 CHEBI:50779 ! has role appetite enhancer relationship: RO:0000087 CHEBI:50855 ! has role antiatherogenic agent relationship: RO:0000087 CHEBI:68495 ! has role apoptosis inducer relationship: RO:0000087 CHEBI:77746 ! has role human metabolite property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C149H249N47O42" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C149H249N47O42/c1-9-10-11-12-16-45-118(209)238-78-106(191-135(225)103(75-197)171-115(204)73-154)137(227)187-101(71-84-32-14-13-15-33-84)133(223)186-100(70-81(4)5)132(222)190-105(77-199)144(234)194-66-29-42-108(194)139(229)180-95(51-57-117(207)208)128(218)188-102(72-85-74-165-79-169-85)134(224)179-92(47-53-112(156)201)126(216)175-90(39-26-63-167-148(161)162)130(220)192-119(82(6)7)141(231)181-93(48-54-113(157)202)127(217)177-91(46-52-111(155)200)125(215)174-89(38-25-62-166-147(159)160)122(212)173-87(35-18-22-59-151)121(211)178-94(50-56-116(205)206)129(219)189-104(76-198)136(226)176-88(36-19-23-60-152)123(213)182-96(37-20-24-61-153)142(232)196-68-31-44-110(196)145(235)195-67-30-41-107(195)138(228)170-83(8)120(210)172-86(34-17-21-58-150)124(214)185-99(69-80(2)3)131(221)183-97(49-55-114(158)203)143(233)193-65-28-43-109(193)140(230)184-98(146(236)237)40-27-64-168-149(163)164/h13-15,32-33,74,79-83,86-110,119,197-199H,9-12,16-31,34-73,75-78,150-154H2,1-8H3,(H2,155,200)(H2,156,201)(H2,157,202)(H2,158,203)(H,165,169)(H,170,228)(H,171,204)(H,172,210)(H,173,212)(H,174,215)(H,175,216)(H,176,226)(H,177,217)(H,178,211)(H,179,224)(H,180,229)(H,181,231)(H,182,213)(H,183,221)(H,184,230)(H,185,214)(H,186,223)(H,187,227)(H,188,218)(H,189,219)(H,190,222)(H,191,225)(H,192,220)(H,205,206)(H,207,208)(H,236,237)(H4,159,160,166)(H4,161,162,167)(H4,163,164,168)/t83-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,119-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "GNKDKYIHGQKHHM-RJKLHVOGSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "3370.867" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "3368.87933" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "C(C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N1[C@@H](CCC1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N2[C@@H](CCC2)C(N3[C@@H](CCC3)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(N4[C@@H](CCC4)C(=O)N[C@H](C(=O)O)CCCNC(=N)N)=O)CCC(=O)N)CC(C)C)CCCCN)C)=O)=O)CCCCN)CCCCN)CO)CCC(=O)O)CCCCN)CCCNC(N)=N)CCC(=O)N)CCC(=O)N)C(C)C)CCCNC(N)=N)CCC(=O)N)CC=5N=CNC5)CCC(=O)O)=O)CO)CC(C)C)CC=6C=CC=CC6)COC(=O)CCCCCCC)CO)N" xsd:string [Term] id: CHEBI:75763 name: eukaryotic metabolite namespace: chebi_ontology def: "Any metabolite produced during a metabolic reaction in eukaryotes, the taxon that include members of the fungi, plantae and animalia kingdoms." [] subset: 3_STAR synonym: "eukaryotic metabolites" RELATED [ChEBI] is_a: CHEBI:25212 ! metabolite [Term] id: CHEBI:75767 name: animal metabolite namespace: chebi_ontology alt_id: CHEBI:77721 alt_id: CHEBI:77743 def: "Any eukaryotic metabolite produced during a metabolic reaction in animals that include diverse creatures from sponges, insects to mammals." [] subset: 3_STAR synonym: "animal metabolites" RELATED [ChEBI] is_a: CHEBI:75763 ! eukaryotic metabolite [Term] id: CHEBI:75768 name: mammalian metabolite namespace: chebi_ontology alt_id: CHEBI:77464 alt_id: CHEBI:77744 def: "Any animal metabolite produced during a metabolic reaction in mammals." [] subset: 3_STAR synonym: "mammalian metabolites" RELATED [ChEBI] is_a: CHEBI:75767 ! animal metabolite [Term] id: CHEBI:75771 name: mouse metabolite namespace: chebi_ontology def: "Any mammalian metabolite produced during a metabolic reaction in a mouse (Mus musculus)." [] subset: 3_STAR synonym: "mouse metabolites" RELATED [ChEBI] synonym: "Mus musculus metabolite" RELATED [ChEBI] synonym: "Mus musculus metabolites" RELATED [ChEBI] is_a: CHEBI:75768 ! mammalian metabolite [Term] id: CHEBI:75772 name: Saccharomyces cerevisiae metabolite namespace: chebi_ontology alt_id: CHEBI:76949 alt_id: CHEBI:76951 def: "Any fungal metabolite produced during a metabolic reaction in Baker's yeast (Saccharomyces cerevisiae)." [] subset: 3_STAR synonym: "baker's yeast metabolite" RELATED [ChEBI] synonym: "baker's yeast metabolites" RELATED [ChEBI] synonym: "baker's yeast secondary metabolite" RELATED [ChEBI] synonym: "baker's yeast secondary metabolites" RELATED [ChEBI] synonym: "S. cerevisiae metabolite" RELATED [ChEBI] synonym: "S. cerevisiae metabolites" RELATED [ChEBI] synonym: "S. cerevisiae secondary metabolite" RELATED [ChEBI] synonym: "S. cerevisiae secondary metabolites" RELATED [ChEBI] synonym: "Saccharomyces cerevisiae metabolites" RELATED [ChEBI] synonym: "Saccharomyces cerevisiae secondary metabolites" RELATED [ChEBI] is_a: CHEBI:76946 ! fungal metabolite [Term] id: CHEBI:75787 name: prokaryotic metabolite namespace: chebi_ontology def: "Any metabolite produced during a metabolic reaction in prokaryotes, the taxon that include members of domains such as the bacteria and archaea." [] subset: 3_STAR synonym: "prokaryotic metabolites" RELATED [ChEBI] is_a: CHEBI:25212 ! metabolite [Term] id: CHEBI:76206 name: xenobiotic metabolite namespace: chebi_ontology def: "Any metabolite produced by metabolism of a xenobiotic compound." [] subset: 3_STAR synonym: "xenobiotic metabolites" RELATED [ChEBI] is_a: CHEBI:25212 ! metabolite [Term] id: CHEBI:76413 name: greenhouse gas namespace: chebi_ontology def: "A gas in an atmosphere that absorbs and emits radiation within the thermal infrared range, so contributing to the 'greenhouse effect'." [] subset: 3_STAR synonym: "greenhouse gases" RELATED [ChEBI] xref: Wikipedia:Greenhouse_gas is_a: CHEBI:51086 ! chemical role [Term] id: CHEBI:76655 name: EC 2.1.* (C1-transferase) inhibitor namespace: chebi_ontology def: "A transferase inhibitor inhibiting the action of transferase of a one-carbon-containing group (EC 2.1.*.*)." [] subset: 3_STAR synonym: "C1-transferase (EC 2.1.*) inhibitor" RELATED [ChEBI] synonym: "C1-transferase (EC 2.1.*) inhibitors" RELATED [ChEBI] synonym: "C1-transferase inhibitor" RELATED [ChEBI] synonym: "C1-transferase inhibitors" RELATED [ChEBI] synonym: "EC 2.1.* (C1-transferase) inhibitors" RELATED [ChEBI] synonym: "EC 2.1.* inhibitor" RELATED [ChEBI] synonym: "EC 2.1.* inhibitors" RELATED [ChEBI] synonym: "one-carbon-containing group transferase inhibitor" RELATED [ChEBI] synonym: "one-carbon-containing group transferase inhibitors" RELATED [ChEBI] is_a: CHEBI:71300 ! EC 2.* (transferase) inhibitor [Term] id: CHEBI:76759 name: EC 3.* (hydrolase) inhibitor namespace: chebi_ontology def: "Any enzyme inhibitor that interferes with the action of a hydrolase (EC 3.*.*.*)." [] subset: 3_STAR synonym: "EC 3.* (hydrolase) inhibitors" RELATED [ChEBI] synonym: "EC 3.* inhibitor" RELATED [ChEBI] synonym: "EC 3.* inhibitors" RELATED [ChEBI] synonym: "EC 3.*.*.* inhibitor" RELATED [ChEBI] synonym: "EC 3.*.*.* inhibitors" RELATED [ChEBI] synonym: "hydrolase (EC 3.*) inhibitor" RELATED [ChEBI] synonym: "hydrolase (EC 3.*) inhibitors" RELATED [ChEBI] synonym: "hydrolase inhibitor" RELATED [ChEBI] synonym: "hydrolase inhibitors" RELATED [ChEBI] xref: Wikipedia:Hydrolase is_a: CHEBI:23924 ! enzyme inhibitor [Term] id: CHEBI:76764 name: EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor namespace: chebi_ontology def: "Any hydrolase inhibitor that interferes with the action of a hydrolase acting on C-N bonds, other than peptide bonds (EC 3.5.*.*)." [] subset: 3_STAR synonym: "EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitor" RELATED [ChEBI] synonym: "EC 3.5.* (hydrolase acting on non-peptide C-N bond) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitor" RELATED [ChEBI] synonym: "EC 3.5.* (hydrolases acting on C-N bonds, other than peptide bonds) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.* inhibitor" RELATED [ChEBI] synonym: "EC 3.5.* inhibitors" RELATED [ChEBI] is_a: CHEBI:76759 ! EC 3.* (hydrolase) inhibitor [Term] id: CHEBI:76807 name: EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor namespace: chebi_ontology def: "An EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor that interferes with the action of any non-peptide linear amide C-N hydrolase (EC 3.5.1.*)." [] subset: 3_STAR synonym: "EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.1.* inhibitor" RELATED [ChEBI] synonym: "EC 3.5.1.* inhibitors" RELATED [ChEBI] synonym: "non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitor" RELATED [ChEBI] synonym: "non-peptide linear amide C-N hydrolase (EC 3.5.1.*) inhibitors" RELATED [ChEBI] is_a: CHEBI:76764 ! EC 3.5.* (hydrolases acting on non-peptide C-N bonds) inhibitor [Term] id: CHEBI:76874 name: EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitor namespace: chebi_ontology def: "An EC 2.1.* (C1-transferase) inhibitor that interferes with the action of any hydroxymethyl-, formyl- and related transferase (EC 2.1.2.*)." [] subset: 3_STAR synonym: "EC 2.1.2.* (hydroxymethyl-, formyl- and related transferases) inhibitors" RELATED [ChEBI] synonym: "EC 2.1.2.* inhibitor" RELATED [ChEBI] synonym: "EC 2.1.2.* inhibitors" RELATED [ChEBI] synonym: "hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitor" RELATED [ChEBI] synonym: "hydroxymethyl-, formyl- and related transferases (EC 2.1.2.*) inhibitors" RELATED [ChEBI] is_a: CHEBI:76655 ! EC 2.1.* (C1-transferase) inhibitor [Term] id: CHEBI:76924 name: plant metabolite namespace: chebi_ontology alt_id: CHEBI:75766 alt_id: CHEBI:76925 def: "Any eukaryotic metabolite produced during a metabolic reaction in plants, the kingdom that include flowering plants, conifers and other gymnosperms." [] subset: 3_STAR synonym: "plant metabolites" RELATED [ChEBI] synonym: "plant secondary metabolites" RELATED [ChEBI] is_a: CHEBI:75763 ! eukaryotic metabolite [Term] id: CHEBI:76946 name: fungal metabolite namespace: chebi_ontology alt_id: CHEBI:75765 alt_id: CHEBI:76947 def: "Any eukaryotic metabolite produced during a metabolic reaction in fungi, the kingdom that includes microorganisms such as the yeasts and moulds." [] subset: 3_STAR synonym: "fungal metabolites" RELATED [ChEBI] is_a: CHEBI:75763 ! eukaryotic metabolite [Term] id: CHEBI:76967 name: human xenobiotic metabolite namespace: chebi_ontology def: "Any human metabolite produced by metabolism of a xenobiotic compound in humans." [] subset: 3_STAR synonym: "human xenobiotic metabolites" RELATED [ChEBI] is_a: CHEBI:76206 ! xenobiotic metabolite is_a: CHEBI:77746 ! human metabolite [Term] id: CHEBI:76969 name: bacterial metabolite namespace: chebi_ontology alt_id: CHEBI:75760 alt_id: CHEBI:76970 def: "Any prokaryotic metabolite produced during a metabolic reaction in bacteria." [] subset: 3_STAR is_a: CHEBI:75787 ! prokaryotic metabolite [Term] id: CHEBI:76971 name: Escherichia coli metabolite namespace: chebi_ontology def: "Any bacterial metabolite produced during a metabolic reaction in Escherichia coli." [] subset: 3_STAR synonym: "E.coli metabolite" RELATED [ChEBI] synonym: "E.coli metabolites" RELATED [ChEBI] synonym: "Escherichia coli metabolites" RELATED [ChEBI] is_a: CHEBI:76969 ! bacterial metabolite [Term] id: CHEBI:77746 name: human metabolite namespace: chebi_ontology alt_id: CHEBI:75770 alt_id: CHEBI:77123 def: "Any mammalian metabolite produced during a metabolic reaction in humans (Homo sapiens)." [] subset: 3_STAR synonym: "H. sapiens metabolite" RELATED [ChEBI] synonym: "H. sapiens metabolites" RELATED [ChEBI] synonym: "Homo sapiens metabolite" RELATED [ChEBI] synonym: "Homo sapiens metabolites" RELATED [ChEBI] is_a: CHEBI:75768 ! mammalian metabolite [Term] id: CHEBI:77941 name: EC 3.5.1.4 (amidase) inhibitor namespace: chebi_ontology def: "An EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor that interferes with the action of amidase (EC 3.5.1.4)." [] subset: 3_STAR synonym: "acylamidase inhibitor" RELATED [ChEBI] synonym: "acylamidase inhibitors" RELATED [ChEBI] synonym: "acylamide amidohydrolase inhibitor" RELATED [ChEBI] synonym: "acylamide amidohydrolase inhibitors" RELATED [ChEBI] synonym: "amidase (EC 3.5.1.4) inhibitor" RELATED [ChEBI] synonym: "amidase (EC 3.5.1.4) inhibitors" RELATED [ChEBI] synonym: "amidase inhibitor" RELATED [ChEBI] synonym: "amidase inhibitors" RELATED [ChEBI] synonym: "amidohydrolase inhibitor" RELATED [ChEBI] synonym: "amidohydrolase inhibitors" RELATED [ChEBI] synonym: "deaminase inhibitor" RELATED [ChEBI] synonym: "deaminase inhibitors" RELATED [ChEBI] synonym: "EC 3.5.1.4 (amidase) inhibitors" RELATED [ChEBI] synonym: "EC 3.5.1.4 inhibitor" RELATED [ChEBI] synonym: "EC 3.5.1.4 inhibitors" RELATED [ChEBI] synonym: "fatty acylamidase inhibitor" RELATED [ChEBI] synonym: "fatty acylamidase inhibitors" RELATED [ChEBI] synonym: "N-acetylaminohydrolase inhibitor" RELATED [ChEBI] synonym: "N-acetylaminohydrolase inhibitors" RELATED [ChEBI] xref: Wikipedia:Amidase is_a: CHEBI:76807 ! EC 3.5.1.* (non-peptide linear amide C-N hydrolase) inhibitor [Term] id: CHEBI:77974 name: food packaging gas namespace: chebi_ontology def: "A food additive that is a (generally inert) gas which is used to envelop foodstuffs during packing and so protect them from unwanted chemical reactions such as food spoilage or oxidation during subsequent transport and storage. The term includes propellant gases, used to expel foods from a container." [] subset: 3_STAR synonym: "food packaging gases" RELATED [ChEBI] xref: Wikipedia:Packaging_gas is_a: CHEBI:64047 ! food additive [Term] id: CHEBI:78115 name: fatty acid anion 4:0 namespace: chebi_ontology def: "Any saturated fatty acid anion containing 4 carbons. Formed by deprotonation of the carboxylic acid moiety. Major species at pH 7.3." [] subset: 3_STAR synonym: "fatty acid 4:0" RELATED [UniProt] is_a: CHEBI:58951 ! short-chain fatty acid anion is_a: CHEBI:58953 ! saturated fatty acid anion relationship: is_conjugate_base_of CHEBI:140601 ! fatty acid 4:0 property_value: http://purl.obolibrary.org/obo/chebi/charge "-1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C4H7O2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "87.09718" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "87.04460" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[O-]C([*])=O" xsd:string [Term] id: CHEBI:78295 name: food component namespace: chebi_ontology def: "A physiological role played by any substance that is distributed in foodstuffs. It includes materials derived from plants or animals, such as vitamins or minerals, as well as environmental contaminants." [] subset: 3_STAR synonym: "dietary component" RELATED [ChEBI] synonym: "dietary components" RELATED [ChEBI] synonym: "food components" RELATED [ChEBI] is_a: CHEBI:52211 ! physiological role [Term] id: CHEBI:78433 name: refrigerant namespace: chebi_ontology def: "A substance used in a thermodynamic heat pump cycle or refrigeration cycle that undergoes a phase change from a gas to a liquid and back. Refrigerants are used in air-conditioning systems and freezers or refrigerators and are assigned a \"R\" number (by ASHRAE - formerly the American Society of Heating, Refrigerating and Air Conditioning Engineers), which is determined systematically according to their molecular structure." [] subset: 3_STAR synonym: "refrigerants" RELATED [ChEBI] xref: Wikipedia:Refrigerant is_a: CHEBI:33232 ! application [Term] id: CHEBI:78608 name: alpha-amino acid zwitterion namespace: chebi_ontology alt_id: CHEBI:83409 def: "An amino acid zwitterion obtained by transfer of a proton from the carboxy to the amino group of any alpha-amino acid; major species at pH 7.3." [] subset: 3_STAR synonym: "an alpha-amino acid" RELATED [UniProt] xref: MetaCyc:Alpha-Amino-Acids {source="SUBMITTER"} is_a: CHEBI:35238 ! amino acid zwitterion relationship: is_tautomer_of CHEBI:33704 ! alpha-amino acid property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C2H4NO2R" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "74.059" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "74.02420" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[NH3+]C([*])C([O-])=O" xsd:string [Term] id: CHEBI:78616 name: carbohydrates and carbohydrate derivatives namespace: chebi_ontology def: "Any organooxygen compound that is a polyhydroxy-aldehyde or -ketone, or a compound derived from one. Carbohydrates contain only carbon, hydrogen and oxygen and usually have an empirical formula Cm(H2O)n; carbohydrate derivatives may contain other elements by substitution or condensation." [] subset: 3_STAR synonym: "carbohydrates and derivatives" RELATED [ChEBI] synonym: "carbohydrates and their derivatives" RELATED [ChEBI] is_a: CHEBI:36963 ! organooxygen compound [Term] id: CHEBI:78675 name: fundamental metabolite namespace: chebi_ontology def: "Any metabolite produced by all living cells." [] subset: 3_STAR synonym: "essential metabolite" RELATED [ChEBI] synonym: "essential metabolites" RELATED [ChEBI] synonym: "fundamental metabolites" RELATED [ChEBI] is_a: CHEBI:25212 ! metabolite [Term] id: CHEBI:7872 name: oxytocin namespace: chebi_ontology def: "A cyclic nonapeptide hormone with amino acid sequence CYIQNCPLG that also acts as a neurotransmitter in the brain; the principal uterine-contracting and milk-ejecting hormone of the posterior pituitary. Together with the neuropeptide vasopressin, it is believed to influence social cognition and behaviour." [] subset: 3_STAR synonym: "(1-Hemicystine)oxytocin" RELATED [ChemIDplus] synonym: "1-({(4R,7S,10S,13S,16S,19R)-19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-16-(4-hydroxybenzyl)-13-[(1S)-1-methylpropyl]-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-4-yl}carbonyl)-L-prolyl-L-leucylglycinamide" EXACT IUPAC_NAME [IUPAC] synonym: "3-Isoleucine-8-leucine vasopressin" RELATED [ChemIDplus] synonym: "Endopituitrina" RELATED [ChemIDplus] synonym: "L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-asparaginyl-L-cysteinyl-L-prolyl-L-leucylglycinamide cyclic(1-6)-disulfide" RELATED [ChemIDplus] synonym: "Ocytocin" RELATED [KEGG_COMPOUND] synonym: "Orasthin" RELATED BRAND_NAME [ChemIDplus] synonym: "OT" RELATED [KEGG_COMPOUND] synonym: "oxitocina" RELATED INN [ChemIDplus] synonym: "OXT" RELATED [KEGG_COMPOUND] synonym: "Oxytocin" EXACT [KEGG_COMPOUND] synonym: "oxytocin" RELATED INN [ChemIDplus] synonym: "oxytocine" RELATED INN [ChemIDplus] synonym: "oxytocinum" RELATED INN [ChemIDplus] synonym: "Pitocin" RELATED BRAND_NAME [DrugBank] synonym: "Piton S" RELATED BRAND_NAME [ChemIDplus] synonym: "Syntocinon" RELATED BRAND_NAME [DrugBank] synonym: "Syntocinon" RELATED BRAND_NAME [ChemIDplus] xref: Beilstein:3586108 {source="Beilstein"} xref: CAS:50-56-6 {source="ChemIDplus"} xref: Drug_Central:2042 {source="DrugCentral"} xref: DrugBank:DB00107 xref: HMDB:HMDB0002865 xref: KEGG:C00746 xref: KEGG:D00089 xref: Patent:US2938891 xref: Patent:US3076797 xref: PMID:10027619 {source="Europe PMC"} xref: PMID:10834934 {source="Europe PMC"} xref: PMID:10949083 {source="Europe PMC"} xref: PMID:10949750 {source="Europe PMC"} xref: PMID:10983343 {source="Europe PMC"} xref: PMID:11134819 {source="Europe PMC"} xref: PMID:13305558 {source="Europe PMC"} xref: PMID:15815422 {source="Europe PMC"} xref: PMID:18593851 {source="Europe PMC"} xref: PMID:18988842 {source="Europe PMC"} xref: PMID:19104313 {source="Europe PMC"} xref: PMID:19369205 {source="Europe PMC"} xref: PMID:19482229 {source="Europe PMC"} xref: PMID:24706799 {source="Europe PMC"} xref: PMID:25209411 {source="Europe PMC"} xref: PMID:32509991 {source="Europe PMC"} xref: PMID:32683141 {source="Europe PMC"} xref: PMID:32979349 {source="Europe PMC"} xref: PMID:33192340 {source="Europe PMC"} xref: Wikipedia:Oxytocin is_a: CHEBI:24533 ! heterodetic cyclic peptide is_a: CHEBI:25905 ! peptide hormone relationship: RO:0000087 CHEBI:35620 ! has role vasodilator agent relationship: RO:0000087 CHEBI:36063 ! has role oxytocic property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C43H66N12O12S2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C43H66N12O12S2/c1-5-22(4)35-42(66)49-26(12-13-32(45)57)38(62)51-29(17-33(46)58)39(63)53-30(20-69-68-19-25(44)36(60)50-28(40(64)54-35)16-23-8-10-24(56)11-9-23)43(67)55-14-6-7-31(55)41(65)52-27(15-21(2)3)37(61)48-18-34(47)59/h8-11,21-22,25-31,35,56H,5-7,12-20,44H2,1-4H3,(H2,45,57)(H2,46,58)(H2,47,59)(H,48,61)(H,49,66)(H,50,60)(H,51,62)(H,52,65)(H,53,63)(H,54,64)/t22-,25-,26-,27-,28-,29-,30-,31-,35-/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "XNOPRXBHLZRZKH-DSZYJQQASA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "1007.18982" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "1006.43646" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]1(NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@@H](N)CSSC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)NCC(N)=O)[C@@H](C)CC" xsd:string [Term] id: CHEBI:78840 name: olefinic compound namespace: chebi_ontology def: "Any organic molecular entity that contains at least one C=C bond." [] subset: 3_STAR synonym: "olefinic compounds" RELATED [ChEBI] is_a: CHEBI:50860 ! organic molecular entity [Term] id: CHEBI:79387 name: trivalent inorganic anion namespace: chebi_ontology def: "Any inorganic anion with a valency of three." [] subset: 3_STAR synonym: "trivalent inorganic anions" RELATED [ChEBI] is_a: CHEBI:24834 ! inorganic anion [Term] id: CHEBI:79388 name: divalent inorganic anion namespace: chebi_ontology def: "Any inorganic anion with a valency of two." [] subset: 3_STAR synonym: "divalent inorganic anions" RELATED [ChEBI] is_a: CHEBI:24834 ! inorganic anion [Term] id: CHEBI:79389 name: monovalent inorganic anion namespace: chebi_ontology def: "Any inorganic anion with a valency of one." [] subset: 3_STAR synonym: "monovalent inorganic anions" RELATED [ChEBI] is_a: CHEBI:24834 ! inorganic anion [Term] id: CHEBI:82663 name: elemental iron namespace: chebi_ontology def: "An elemental molecular entity in which all of the atoms have atomic number 26." [] subset: 3_STAR is_a: CHEBI:24873 ! iron molecular entity is_a: CHEBI:33259 ! elemental molecular entity [Term] id: CHEBI:83039 name: crustacean metabolite namespace: chebi_ontology def: "An animal metabolite produced by arthropods such as crabs, lobsters, crayfish, shrimps and krill." [] subset: 3_STAR synonym: "crustacean metabolites" RELATED [ChEBI] is_a: CHEBI:75767 ! animal metabolite [Term] id: CHEBI:83056 name: Daphnia magna metabolite namespace: chebi_ontology def: "A Daphnia metabolite produced by the species Daphnia magna." [] subset: 3_STAR synonym: "Daphnia magna metabolites" RELATED [ChEBI] is_a: CHEBI:83057 ! Daphnia metabolite [Term] id: CHEBI:83057 name: Daphnia metabolite namespace: chebi_ontology def: "A crustacean metabolite produced by the genus of small planktonic arthropods, Daphnia" [] subset: 3_STAR synonym: "Daphnia metabolites" RELATED [ChEBI] xref: Wikipedia:Daphnia is_a: CHEBI:83039 ! crustacean metabolite [Term] id: CHEBI:83813 name: proteinogenic amino acid namespace: chebi_ontology def: "Any of the 23 alpha-amino acids that are precursors to proteins, and are incorporated into proteins during translation. The group includes the 20 amino acids encoded by the nuclear genes of eukaryotes together with selenocysteine, pyrrolysine, and N-formylmethionine. Apart from glycine, which is non-chiral, all have L configuration." [] subset: 3_STAR synonym: "canonical amino acid" RELATED [ChEBI] synonym: "canonical amino acids" RELATED [ChEBI] synonym: "proteinogenic amino acids" RELATED [ChEBI] xref: Wikipedia:Proteinogenic_amino_acid is_a: CHEBI:33575 ! carboxylic acid is_a: CHEBI:35352 ! organonitrogen compound [Term] id: CHEBI:83820 name: non-proteinogenic amino acid namespace: chebi_ontology def: "Any amino-acid that is not naturally encoded in the genetic code of any organism." [] subset: 3_STAR synonym: "non-canonical amino acid" RELATED [ChEBI] synonym: "non-canonical amino acids" RELATED [ChEBI] synonym: "non-canonical amino-acid" RELATED [ChEBI] synonym: "non-canonical amino-acids" RELATED [ChEBI] synonym: "non-coded amino acid" RELATED [ChEBI] synonym: "non-coded amino acids" RELATED [ChEBI] synonym: "non-coded amino-acid" RELATED [ChEBI] synonym: "non-coded amino-acids" RELATED [ChEBI] synonym: "non-proteinogenic amino acids" RELATED [ChEBI] synonym: "non-proteinogenic amino-acid" RELATED [ChEBI] synonym: "non-proteinogenic amino-acids" RELATED [ChEBI] xref: Wikipedia:Non-proteinogenic_amino_acids is_a: CHEBI:33709 ! amino acid [Term] id: CHEBI:83821 name: amino acid derivative namespace: chebi_ontology alt_id: CHEBI:25359 def: "Any derivative of an amino acid resulting from reaction at an amino group, carboxy group, side-chain functional group, or from the replacement of any hydrogen by a heteroatom. The definition normally excludes peptides containing amino acid residues." [] subset: 3_STAR synonym: "amino acid derivatives" RELATED [ChEBI] synonym: "modified amino acids" RELATED [ChEBI] is_a: CHEBI:35352 ! organonitrogen compound [Term] id: CHEBI:8386 name: pregnane namespace: chebi_ontology subset: 3_STAR synonym: "pregnane" EXACT IUPAC_NAME [IUPAC] xref: LIPID_MAPS_instance:LMST02030000 {source="LIPID MAPS"} xref: Wikipedia:Pregnane is_a: CHEBI:35508 ! steroid fundamental parent property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C21H36" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchi "InChI=1S/C21H36/c1-4-15-9-11-18-17-10-8-16-7-5-6-13-20(16,2)19(17)12-14-21(15,18)3/h15-19H,4-14H2,1-3H3/t15-,16?,17-,18-,19-,20-,21+/m0/s1" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/inchikey "JWMFYGXQPXQEEM-WZBAXQLOSA-N" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "288.51054" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "288.28170" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/smiles "[H][C@]1(CC)CC[C@@]2([H])[C@]3([H])CCC4([H])CCCC[C@]4(C)[C@@]3([H])CC[C@]12C" xsd:string [Term] id: CHEBI:84087 name: human urinary metabolite namespace: chebi_ontology def: "Any metabolite (endogenous or exogenous) found in human urine samples." [] subset: 3_STAR synonym: "human urinary metabolites" RELATED [ChEBI] is_a: CHEBI:77746 ! human metabolite [Term] id: CHEBI:84729 name: hydroxyindoles namespace: chebi_ontology def: "Any member of the class of indoles carrying at least one hydroxy group." [] subset: 3_STAR is_a: CHEBI:24828 ! indoles is_a: CHEBI:33822 ! organic hydroxy compound [Term] id: CHEBI:84735 name: algal metabolite namespace: chebi_ontology def: "Any eukaryotic metabolite produced during a metabolic reaction in algae including unicellular organisms like chlorella and diatoms to multicellular organisms like giant kelps and brown algae." [] subset: 3_STAR synonym: "algal metabolites" RELATED [ChEBI] is_a: CHEBI:75763 ! eukaryotic metabolite [Term] id: CHEBI:90710 name: receptor modulator namespace: chebi_ontology def: "A drug that acts as an antagonist, agonist, reverse agonist, or in some other fashion when interacting with cellular receptors." [] subset: 3_STAR synonym: "receptor modulators" RELATED [ChEBI] is_a: CHEBI:23888 ! drug [Term] id: CHEBI:9937 name: vasopressin namespace: chebi_ontology def: "A family of cyclic nonapeptide hormones found in most mammals. Synthesised in the hypothalamus and stored in the post-pituitary, vasopressins play a key role in homeostasis, particularly in regulating the body's water content. Together with the similar neuropeptide oxytocin, they are believed to influence social cognition and behaviour." [] subset: 3_STAR synonym: "ADH" RELATED [KEGG_COMPOUND] synonym: "Antidiuretic hormone" RELATED [KEGG_COMPOUND] synonym: "arginine vasopressin" RELATED [ChEBI] synonym: "argipressin" RELATED [ChEBI] synonym: "AVP" RELATED [ChEBI] synonym: "beta-Hypophamine" RELATED [ChemIDplus] synonym: "Inyectable de vasopresina" RELATED INN [ChemIDplus] synonym: "Solute injectable de vasopressine" RELATED INN [ChemIDplus] synonym: "Vasopressin" EXACT [KEGG_COMPOUND] synonym: "Vasopressini injectio" RELATED INN [ChemIDplus] synonym: "VP" RELATED [KEGG_COMPOUND] xref: CAS:11000-17-2 {source="ChemIDplus"} xref: KEGG:C00840 xref: KEGG:D00101 xref: PMID:18988842 {source="Europe PMC"} xref: PMID:20445498 {source="Europe PMC"} is_a: CHEBI:24533 ! heterodetic cyclic peptide is_a: CHEBI:25905 ! peptide hormone property_value: http://purl.obolibrary.org/obo/chebi/charge "0" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/formula "C46H65N15O12S2.C46H65N13O12S2" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/mass "2140.458" xsd:string property_value: http://purl.obolibrary.org/obo/chebi/monoisotopicmass "2138.86956" xsd:string [Term] id: CL:0000000 name: cell def: "A material entity of anatomical origin (part of or deriving from an organism) that has as its parts a maximally connected cell compartment surrounded by a plasma membrane." [CARO:mah] comment: The definition of cell is intended to represent all cells, and thus a cell is defined as a material entity and not an anatomical structure, which implies that it is part of an organism (or the entirety of one). subset: ubprop:upper_level xref: CALOHA:TS-2035 xref: FBbt:00007002 xref: FMA:68646 xref: GO:0005623 xref: KUPO:0000002 xref: MESH:D002477 xref: VHOG:0001533 xref: WBbt:0004017 xref: XAO:0003012 disjoint_from: GO:0031012 ! extracellular matrix disjoint_from: GO:0032991 ! protein-containing complex disjoint_from: GO:0043226 ! organelle relationship: has_part GO:0005634 {gci_filler="PATO:0001407", gci_relation="bearer_of"} ! nucleus relationship: has_part GO:0005634 {gci_filler="PATO:0001908", gci_relation="bearer_of"} ! nucleus relationship: only_in_taxon NCBITaxon:131567 ! cellular organisms [Term] id: CL:0000001 name: primary cultured cell def: "A cultured cell that is freshly isolated from a organismal source, or derives in culture from such a cell prior to the culture being passaged." [ReO:mhb] comment: Covers cells actively being cultured or stored in a quiescent state for future use. synonym: "primary cell culture cell" EXACT [] synonym: "primary cell line cell" RELATED [] synonym: "unpassaged cultured cell" EXACT [] xref: BTO:0002290 is_a: CL:0000010 ! cultured cell [Term] id: CL:0000002 name: obsolete immortal cell line cell def: "OBSOLETE: A cell line cell that is expected to be capable of an unlimited number of divisions, and is thus able to support indefinite growth/propagation in vitro as part of a immortal cell line." [ReO:mhb] comment: Obsoleted in July 2013 and replaced by the CLO 'immortal cell line cell' class, as a result of CLO-OBI-CL alignment efforts.\n\nCovers cells actively being cultured or stored in a quiescent state for future use. synonym: "continuous cell line cell" EXACT [] synonym: "permanent cell line cell" EXACT [] is_obsolete: true replaced_by: CLO:0000019 [Term] id: CL:0000003 name: native cell def: "A cell that is found in a natural setting, which includes multicellular organism cells 'in vivo' (i.e. part of an organism), and unicellular organisms 'in environment' (i.e. part of a natural environment)." [CARO:mah] comment: To accommodate unicellular organisms better, 'cell in vivo' has been re-labeled 'native cell' to better represent its intended meaning - that is, that it is a cell in the context of a multicellular organism or in a natural environment. 'Native' is intended to contrast with 'in vitro', which refers to cells or other biological entities that have been intentionally placed in a controlled, non-natural setting for the purpose of study or manipulation. (MAH 1.12.12). subset: ubprop:upper_level synonym: "cell in vivo" NARROW [] xref: CARO:0000013 is_a: CL:0000000 ! cell [Term] id: CL:0000004 name: obsolete cell by organism def: "OBSOLETE: A classification of cells by the organisms within which they are contained." [FB:ma] comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its species. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000005 name: fibroblast neural crest derived def: "Any fibroblast that is deriived from the neural crest." [https://orcid.org/0000-0001-5208-3432] is_a: CL:0000057 ! fibroblast intersection_of: CL:0000057 ! fibroblast intersection_of: develops_from CL:0000333 ! migratory neural crest cell relationship: develops_from CL:0000008 ! migratory cranial neural crest cell [Term] id: CL:0000006 name: neuronal receptor cell synonym: "neuronal receptor cell (sensu Animalia)" EXACT [] is_a: CL:0000101 ! sensory neuron is_a: CL:0000197 ! sensory receptor cell intersection_of: CL:0000197 ! sensory receptor cell intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception [Term] id: CL:0000007 name: early embryonic cell (metazoa) def: "A cell found in the embryo before the formation of all the gem layers is complete." [GOC:tfm] is_a: CL:0002321 ! embryonic cell (metazoa) [Term] id: CL:0000008 name: migratory cranial neural crest cell def: "Cell that is part of the migratory cranial neural crest population. Migratory cranial neural crest cells develop from premigratory cranial neural crest cells and have undergone epithelial to mesenchymal transition and delamination." [https://orcid.org/0000-0001-5208-3432, ZFA:0007091] is_a: CL:0000333 ! migratory neural crest cell [Term] id: CL:0000009 name: obsolete fusiform initial alt_id: CL:0000274 def: "Obsolete. Use PO:0000079 from Plant Ontology instead. An elongated cell with approximately wedge-shaped ends, found in the vascular cambium, which gives rise to the elements of the axial system in the secondary vascular tissues." [ISBN:0471245208] synonym: "xylem initial" RELATED [] synonym: "xylem mother cell" RELATED [] is_obsolete: true replaced_by: PO:0000079 [Term] id: CL:0000010 name: cultured cell def: "A cell in vitro that is or has been maintained or propagated as part of a cell culture." [ReO:mhb] comment: Note that this class was re-labeled to 'cultured cell' instead of 'cell line cell', as it intent was clarified to cover any cultured cells of multicellular and unicellular organisms. This includes cells actively being cultured, or cells that have been cultured but are stored in a quiescent state for future use. In having been cultured, cells must establish homeostasis and often replicate in a foreign environment. Accomodation of this stress initiates a selection of cells fit for such challenges, wherein necessary adaptive biochemical and.or genetic changes can occur. These changes can set them apart from the in vivo cells from which they derive, and such changes will typically accumulate and change over increasing time in culture. xref: MESH:D002478 is_a: CL:0000578 ! experimentally modified cell in vitro [Term] id: CL:0000011 name: migratory trunk neural crest cell def: "Cell that is part of the migratory trunk neural crest population. Migratory trunk neural crest cells develop from premigratory trunk neural crest cells and have undergone epithelial to mesenchymal transition and delamination." [https://orcid.org/0000-0001-5208-3432, ZFA:0007095] is_a: CL:0000333 ! migratory neural crest cell [Term] id: CL:0000012 name: obsolete cell by class comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000013 name: obsolete dentine secreting cell is_obsolete: true consider: CL:0000140 [Term] id: CL:0000014 name: germ line stem cell synonym: "germline stem cell" EXACT [] is_a: CL:0000034 {is_inferred="true"} ! stem cell is_a: CL:0000039 {is_inferred="true"} ! germ line cell intersection_of: CL:0000039 ! germ line cell intersection_of: capable_of GO:0017145 ! stem cell division [Term] id: CL:0000015 name: male germ cell def: "A germ cell that supports male gamete production. In some species, non-germ cells known as Sertoli cells also play a role in spermatogenesis." [https://orcid.org/0000-0001-5208-3432, PMID:29462262] xref: FMA:72290 xref: MA:0002765 xref: ncithesaurus:Spermatogenic_Cell xref: VHOG:0001531 is_a: CL:0000586 {is_inferred="true"} ! germ cell relationship: capable_of_part_of GO:0007283 ! spermatogenesis property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/574 xsd:string [Term] id: CL:0000016 name: male germ line stem cell is_a: CL:0000014 ! germ line stem cell is_a: CL:0000015 ! male germ cell [Term] id: CL:0000017 name: spermatocyte def: "A male germ cell that develops from spermatogonia. The euploid primary spermatocytes undergo meiosis and give rise to the haploid secondary spermatocytes which in turn give rise to spermatids." [GOC:tfm, MESH:D013090] xref: BTO:0001275 xref: CALOHA:TS-0951 xref: EMAPA:31484 xref: FBbt:00004936 xref: FMA:84049 xref: WBbt:0006799 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000015 {is_inferred="true"} ! male germ cell intersection_of: CL:0000015 ! male germ cell intersection_of: capable_of GO:0048137 ! spermatocyte division relationship: capable_of GO:0048137 ! spermatocyte division relationship: develops_from CL:0000020 ! spermatogonium [Term] id: CL:0000018 name: spermatid def: "A male germ cell that develops from the haploid secondary spermatocytes. Without further division, spermatids undergo structural changes and give rise to spermatozoa." [MESH:D013087] synonym: "nematoblast" EXACT [] xref: BTO:0001274 xref: CALOHA:TS-0950 xref: EMAPA:31486 xref: FBbt:00004942 xref: FMA:72294 xref: WBbt:0006800 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000015 {is_inferred="true"} ! male germ cell is_a: CL:0000413 ! haploid cell intersection_of: CL:0000015 ! male germ cell intersection_of: bearer_of PATO:0001375 ! haploid intersection_of: capable_of GO:0001675 ! acrosome assembly intersection_of: capable_of GO:0007288 ! sperm axoneme assembly intersection_of: capable_of GO:0007289 ! spermatid nucleus differentiation relationship: capable_of GO:0001675 ! acrosome assembly relationship: capable_of GO:0007288 ! sperm axoneme assembly relationship: capable_of GO:0007289 ! spermatid nucleus differentiation relationship: develops_from CL:0000657 ! secondary spermatocyte [Term] id: CL:0000019 name: sperm def: "A mature male germ cell that develops from a spermatid." [GOC:tfm, MESH:D013094] synonym: "sperm cell" EXACT [] synonym: "spermatozoid" EXACT [] synonym: "spermatozoon" EXACT [] xref: BTO:0001277 xref: BTO:0002046 xref: CALOHA:TS-0949 xref: FBbt:00004954 xref: FMA:67338 xref: WBbt:0006798 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000408 {is_inferred="true"} ! male gamete relationship: develops_from CL:0000018 ! spermatid [Term] id: CL:0000020 name: spermatogonium def: "An euploid male germ cell of an early stage of spermatogenesis." [MESH:D013093] synonym: "spermatogonial cell" EXACT [] xref: BTO:0000958 xref: CALOHA:TS-2193 xref: EMAPA:31482 xref: FBbt:00004934 xref: FBbt:00004935 xref: FMA:72291 is_a: CL:0000015 ! male germ cell intersection_of: CL:0000015 ! male germ cell intersection_of: bearer_of PATO:0001394 ! diploid intersection_of: bearer_of PATO:0001501 ! immature relationship: bearer_of PATO:0001394 ! diploid relationship: bearer_of PATO:0001501 ! immature [Term] id: CL:0000021 name: female germ cell def: "Female germ cell is a germ cell that supports female gamete production." [GOC:tfm, PMID:11023867, PMID:20454446] xref: MA:0000388 xref: ncithesaurus:Egg xref: VHOG:0001530 is_a: CL:0000586 {is_inferred="true"} ! germ cell intersection_of: CL:0000586 ! germ cell intersection_of: capable_of GO:0048477 ! oogenesis relationship: capable_of GO:0048477 ! oogenesis [Term] id: CL:0000022 name: female germ line stem cell xref: FBbt:00004873 is_a: CL:0000014 {is_inferred="true"} ! germ line stem cell is_a: CL:0000021 {is_inferred="true"} ! female germ cell intersection_of: CL:0000021 ! female germ cell intersection_of: capable_of GO:0017145 ! stem cell division [Term] id: CL:0000023 name: oocyte def: "A female germ cell that has entered meiosis." [GOC:tfm, ISBN:0721662544] synonym: "oogonium" RELATED [] xref: BTO:0000964 xref: CALOHA:TS-0711 xref: FBbt:00004886 xref: FMA:18644 xref: MESH:D009865 xref: WBbt:0006797 is_a: CL:0000021 {is_inferred="true"} ! female germ cell is_a: CL:0000548 ! animal cell relationship: participates_in GO:0007143 ! female meiotic nuclear division [Term] id: CL:0000024 name: oogonial cell def: "An undifferentiated germ cell that proliferates rapidly and gives rise to oocytes." [GOC:tfm, ISBN:0721662544] xref: FMA:83673 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000021 {is_inferred="true"} ! female germ cell intersection_of: CL:0000021 ! female germ cell intersection_of: capable_of GO:0000278 ! mitotic cell cycle relationship: capable_of GO:0000278 ! mitotic cell cycle relationship: develops_from CL:0000670 ! primordial germ cell [Term] id: CL:0000025 name: egg cell def: "A female gamete where meiosis has progressed to metaphase II and is able to participate in fertilization." [GOC:tfm, ISBN:0721662544] synonym: "mature oocyte" EXACT [] synonym: "ovum" EXACT [] xref: BTO:0000369 xref: BTO:0003801 xref: CALOHA:TS-2191 xref: FBbt:00057012 xref: FMA:67343 xref: MA:0000388 xref: MESH:D010063 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000675 {is_inferred="true"} ! female gamete relationship: develops_from CL:0000023 ! oocyte relationship: participates_in GO:0007143 ! female meiotic nuclear division [Term] id: CL:0000026 name: invertebrate nurse cell def: "A germline cell that contributes to the development of the oocyte by transferring cytoplasm directly to oocyte." [GOC:tfm, PMID:15848391] synonym: "nurse cell" RELATED [] xref: BTO:0000953 xref: FBbt:00004878 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000412 ! polyploid cell is_a: CL:4029002 ! germline-derived nurse cell relationship: develops_from CL:0000722 ! cystoblast [Term] id: CL:0000027 name: smooth muscle cell neural crest derived def: "A smooth muscle cell derived from the neural crest." [https://orcid.org/0000-0001-5208-3432] is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell intersection_of: CL:0000192 ! smooth muscle cell intersection_of: develops_from CL:0000333 ! migratory neural crest cell relationship: develops_from CL:0000008 ! migratory cranial neural crest cell [Term] id: CL:0000028 name: CNS neuron (sensu Nematoda and Protostomia) is_a: CARO:0000000 ! anatomical entity is_a: CL:0000540 ! neuron relationship: develops_from CL:0000338 ! neuroblast (sensu Nematoda and Protostomia) relationship: part_of UBERON:0001017 ! central nervous system [Term] id: CL:0000029 name: neural crest derived neuron synonym: "neuron neural crest derived" EXACT [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000540 {is_inferred="true"} ! neuron intersection_of: CL:0000540 ! neuron intersection_of: develops_from CL:0000333 ! migratory neural crest cell relationship: develops_from CL:0002676 ! neural crest derived neuroblast [Term] id: CL:0000030 name: glioblast is_a: CARO:0000000 ! anatomical entity is_a: CL:0000055 ! non-terminally differentiated cell relationship: develops_from CL:0000133 ! neurectodermal cell [Term] id: CL:0000031 name: neuroblast (sensu Vertebrata) alt_id: CL:0000337 def: "A cell that will develop into a neuron often after a migration phase." [GOC:NV, http://en.wikipedia.org/wiki/Neuroblast] synonym: "neuroblast" EXACT [] xref: BTO:0000930 xref: FMA:70563 is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0000548 ! animal cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata [Term] id: CL:0000032 name: neuroplacodal cell def: "A cell of a platelike structure, especially a thickened plate of ectoderm in the early embryo, from which a sense organ develops." [GOC:tfm, ISBN:0618947256] synonym: "neural placode cell" EXACT [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0002321 ! embryonic cell (metazoa) relationship: develops_from CL:0000114 ! surface ectodermal cell [Term] id: CL:0000033 name: apocrine cell def: "An apocrine cell is a secretory cell characterized loss of part of the cytoplasm during the process of secretion - secretions are budded off through the plasma membrane producing membrane bound vesicles containing the secreted substance." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas is_a: CL:0000151 ! secretory cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000034 name: stem cell def: "A relatively undifferentiated cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells." [GOC:tfm, MESH:D013234] comment: This term applies to metazoan. For plant stem cells, consider using PO:0004011 ‘initial cell’ or its parent PO:0004010 ‘meristematic cell’. subset: human_reference_atlas synonym: "animal stem cell" EXACT [] xref: CALOHA:TS-2086 xref: FMA:63368 is_a: CL:0000548 ! animal cell is_a: CL:0011115 ! precursor cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0017145 ! stem cell division relationship: capable_of GO:0017145 ! stem cell division relationship: in_taxon NCBITaxon:33208 ! Metazoa relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000035 name: single fate stem cell def: "A stem cell that self-renews as well as give rise to a single mature cell type." [GOC:tfm] synonym: "unipotent stem cell" EXACT [] synonym: "unipotential stem cell" EXACT [] xref: FMA:70569 is_a: CL:0000723 ! somatic stem cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001400 ! unipotent intersection_of: capable_of GO:0017145 ! stem cell division relationship: bearer_of PATO:0001400 ! unipotent [Term] id: CL:0000036 name: epithelial fate stem cell subset: human_reference_atlas synonym: "epithelial stem cell" EXACT [] is_a: CL:0000035 ! single fate stem cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000037 name: hematopoietic stem cell def: "A stem cell from which all cells of the lymphoid and myeloid lineages develop, including blood cells and cells of the immune system. Hematopoietic stem cells lack cell markers of effector cells (lin-negative). Lin-negative is defined by lacking one or more of the following cell surface markers: CD2, CD3 epsilon, CD4, CD5 ,CD8 alpha chain, CD11b, CD14, CD19, CD20, CD56, ly6G, ter119." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Hematopoietic_stem_cell, PMID:19022770] comment: Markers differ between species, and two sets of markers have been described for mice. HSCs are reportedly CD34-positive, CD45-positive, CD48-negative, CD150-positive, CD133-positive, and CD244-negative. subset: human_reference_atlas synonym: "blood forming stem cell" EXACT [] synonym: "colony forming unit hematopoietic" RELATED [] synonym: "hemopoietic stem cell" EXACT [] synonym: "HSC" EXACT [] xref: BTO:0000725 xref: CALOHA:TS-0448 xref: FMA:70337 xref: FMA:86475 xref: MESH:D006412 xref: VHOG:0001485 is_a: CL:0000723 ! somatic stem cell is_a: CL:0008001 ! hematopoietic precursor cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000988 ! hematopoietic cell intersection_of: capable_of GO:0002244 ! hematopoietic progenitor cell differentiation intersection_of: capable_of GO:0048103 ! somatic stem cell division intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: capable_of GO:0002244 ! hematopoietic progenitor cell differentiation relationship: develops_from CL:0000566 ! angioblastic mesenchymal cell relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000038 name: erythroid progenitor cell def: "A progenitor cell committed to the erythroid lineage." [GOC:add, ISBN:0721601464] synonym: "BFU-E" RELATED [] synonym: "blast forming unit erythroid" RELATED [] synonym: "burst forming unit erythroid" RELATED [] synonym: "CFU-E" RELATED [] synonym: "colony forming unit erythroid" RELATED [] synonym: "erythroid stem cell" RELATED [] xref: BTO:0004911 is_a: CL:0000764 ! erythroid lineage cell is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell [Term] id: CL:0000039 name: germ line cell def: "A cell that is within the developmental lineage of gametes and is able to pass along its genetic material to offspring." [GOC:tfm, ISBN:0721662544] comment: Originally this term had some plant germ line cell children. subset: ubprop:upper_level is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell disjoint_from: CL:0002371 ! somatic cell relationship: capable_of GO:0022414 ! reproductive process [Term] id: CL:0000040 name: monoblast def: "A myeloid progenitor cell committed to the monocyte lineage. This cell is CD11b-positive, has basophilic cytoplasm, euchromatin, and the presence of a nucleolus." [GOC:add, http://en.wikipedia.org/wiki/Monoblast, http://www.copewithcytokines.de, PMID:1104740] comment: Morphology: mononuclear cell, diameter 12-20 _M, non-granular, N/C ratio 3/1 - 4/1; markers: CD11b (shared with many other myeloid cells); location: Adult: bone marrow; fetal: liver, Yolk Sac; role or process: hematopoiesis, monocyte development; lineage: hematopoietic, myeloid. synonym: "CFU-M" RELATED [] synonym: "colony forming unit macrophage" RELATED [] synonym: "colony forming unit monocyte" RELATED [] synonym: "monocyte stem cell" RELATED [] xref: CALOHA:TS-1195 xref: FMA:83553 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0002194 {is_inferred="true"} ! monopoietic cell intersection_of: CL:0002194 ! monopoietic cell intersection_of: capable_of GO:0030224 ! monocyte differentiation intersection_of: has_part CL:0017503 ! basophilic cytoplasm intersection_of: has_part GO:0000791 ! euchromatin intersection_of: has_part GO:0005730 ! nucleolus intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: develops_from CL:0002009 ! macrophage dendritic cell progenitor relationship: has_part CL:0017503 ! basophilic cytoplasm relationship: has_part GO:0000791 ! euchromatin relationship: has_part GO:0005730 ! nucleolus relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M [Term] id: CL:0000041 name: mature eosinophil def: "A fully differentiated eosinophil, a granular leukocyte with a nucleus that usually has two lobes connected by one or more slender threads, and cytoplasm containing coarse, round granules that are uniform in size and which can be stained by the dye eosin. Cells are also differentiated from other granulocytes by a small nuclear-to-cytoplasm ratio (1:3). This cell type is CD49d-positive." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464] comment: Eosinophils are CD125-positive (IL-5R), GM-CSFR-positive, IL-3R-positive, VLA4-positive. They can also express MHC Class I & II, CD4, CD9, CD11a, CD11b, CD11c, CD13, CD15, CD16, CD17, CD18, CD24, CD25,CD28, CD29, CD32, CD33, CD35, CD37, CD39, CD43, CD44, CD45, CD45RB, CD45RO, CD46, CD47, CD48, CD49d, CD49f, CD50, CD52, CD53, CD54, CD55, CD58, CD59, CD62L, CD63, CD65, CD66, CD69, CD71, CD76, CD80, CD81, CD82, CD86, CD87, CD88, CD89, CD92, CD95, CD97, CD98, CD99, CD100, CD101, CD116, CD117, CD119, CD120, CD123, CD124, CD125, CD131, CD137, CD139, CD148, CD149, CD151, CD153, CD156, CD162, CD161, CD162, CD165, CD174, CD182, CD183, CD191, CD192, CD193, CD196, CD213, IL9R, ad integrin, beta-7 integrin, FceRI, IL13Ra1, TGFbR, PAFR, LTB4R, C3aR, CystLT1R, CystLT2R, fMLPR, CRTH2 (PGD2 receptor), histamine 4R, IDO, KYN, PAR-2, Siglec-8, Siglec-10, LIR1, LIR2, LIR3, LIR7, TLR7, TLR8, and VLA-4. Eosinophils can also secrete CXCL1, eotaxin-1, GM-CSF, IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, IL-10, IL-12, IL-13, IL-16, IL-18, IFN-gamma, LTC4, MIP-1alpha, NGF, PAF, RANTES, substance P, TGF-alpha, TGF-beta, TNF-alpha, and VIP. subset: human_reference_atlas synonym: "mature eosinocyte" EXACT [] synonym: "mature eosinophil leucocyte" EXACT [] synonym: "mature eosinophil leukocyte" EXACT [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] is_a: CL:0000145 ! professional antigen presenting cell is_a: CL:0000771 {is_inferred="true"} ! eosinophil relationship: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II relationship: capable_of GO:0002540 ! leukotriene production involved in inflammatory response relationship: capable_of GO:0045730 ! respiratory burst relationship: develops_from CL:0000774 ! band form eosinophil relationship: has_part PR:000007152 ! eosinophil peroxidase relationship: has_part PR:000007857 ! erythroid transcription factor relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2 relationship: has_part PR:000014046 ! non-secretory ribonuclease relationship: has_part PR:000014047 ! eosinophil cationic protein relationship: has_part PR:000022006 ! eosinophil granule major basic protein relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000009129 ! has plasma membrane part integrin alpha-4 property_value: editor_note "The status of eosinophils as true professional antigen presenting cells is unclear, despite their ability to present exogenous peptides and peptides processed from exogenous proteins (in certain studies) via MHC Class II and activate T cells. Per the equivalence axioms, 'eosinophil' is reasoned to be a subclass of 'professional antigen presenting cell', though the role of eosinophils as such in the body may be limited." xsd:string [Term] id: CL:0000042 name: neutrophilic myeloblast def: "A myeloblast committed to the neutrophil lineage. This cell type is GATA-1 positive, C/EBPa-positive, AML-1-positive, c-myb-positive and has low expression of PU.1 transcription factor." [GOC:add, ISBN:0721601464, PMID:12560239, PMID:15514007] comment: These cells are CD11b-negative, CD15-negative, CD16-negative, CD35-negative, CD49d-positive, CD68-positive, lactotransferrin-negative, and fMLP receptor-negative. They are found in the Band 3 fraction. synonym: "neutrophilic granuloblast" RELATED [] is_a: CL:0000834 ! neutrophil progenitor cell is_a: CL:0000835 {is_inferred="true"} ! myeloblast intersection_of: CL:0000835 ! myeloblast intersection_of: capable_of GO:0030223 ! neutrophil differentiation intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000007857 ! erythroid transcription factor intersection_of: has_part PR:000010799 ! myb proto-oncogene protein intersection_of: has_part PR:000014362 ! runt-related transcription factor 1 relationship: develops_from CL:0000834 ! neutrophil progenitor cell relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000007857 ! erythroid transcription factor relationship: has_part PR:000010799 ! myb proto-oncogene protein relationship: has_part PR:000014362 ! runt-related transcription factor 1 [Term] id: CL:0000043 name: mature basophil alt_id: CL:0000739 def: "A fully differentiated basophil, a granular leukocyte with an irregularly shaped, pale-staining nucleus that is partially constricted into two lobes, and with cytoplasm that contains coarse granules of variable size. Basophils contain vasoactive amines such as histamine and serotonin, which are released on appropriate stimulation." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:18466030, PMID:19231594, PMID:20837449] comment: Mature basophils are also capable of producing IL-3, IL-5, IL-6, IL-8, IL-13, IL-25, CCL22, tslp, vegf, and LTC4. synonym: "mature basophil leucocyte" EXACT [] synonym: "mature basophil leukocyte" EXACT [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] xref: BTO:0001026 xref: CALOHA:TS-0688 is_a: CL:0000767 {is_inferred="true"} ! basophil is_a: CL:0002274 ! histamine secreting cell relationship: capable_of GO:0002349 ! histamine production involved in inflammatory response relationship: capable_of GO:0002351 ! serotonin production involved in inflammatory response relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response relationship: capable_of GO:0032616 ! interleukin-13 production relationship: capable_of GO:0032633 ! interleukin-4 production relationship: capable_of GO:0048295 ! positive regulation of isotype switching to IgE isotypes relationship: develops_from CL:0000770 ! band form basophil [Term] id: CL:0000045 name: obsolete thymus processed stem cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Consider using term 'pro-T cell ; CL:0000827' or the term 'thymocyte ; CL:0000893' or one of its children instead. is_obsolete: true [Term] id: CL:0000046 name: obsolete bursa processed stem cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Consider using term 'pro-B cell ; CL:0000826' or the term 'immature B cell ; CL:0000816 or one of its children instead. is_obsolete: true [Term] id: CL:0000047 name: neural stem cell def: "An undifferentiated neural cell that originates from the neuroectoderm and has the capacity both to perpetually self-renew without differentiating and to generate multiple central nervous system neuronal and glial cell types." [PMID:30639325] synonym: "neuronal stem cell" EXACT [PMID:16305818] synonym: "NSC" EXACT [] xref: BTO:0002881 xref: CALOHA:TS-2360 xref: FMA:86684 is_a: CARO:0000000 ! anatomical entity is_a: CL:0002319 ! neural cell relationship: develops_from CL:0000133 ! neurectodermal cell [Term] id: CL:0000048 name: multi fate stem cell def: "A stem cell that can give rise to multiple lineages of cells." [GOC:add] synonym: "multi-fate stem cell" EXACT [] synonym: "multifate stem cell" EXACT [] synonym: "multipotent cell" EXACT [] synonym: "multipotent stem cell" EXACT [] xref: FMA:84789 is_a: CL:0000034 ! stem cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0002371 ! somatic cell intersection_of: bearer_of PATO:0001402 ! multipotent intersection_of: capable_of GO:0017145 ! stem cell division relationship: bearer_of PATO:0001402 ! multipotent [Term] id: CL:0000049 name: common myeloid progenitor def: "A progenitor cell committed to myeloid lineage, including the megakaryocyte and erythroid lineages." [GOC:add, ISBN:0878932437, MESH:D023461] comment: This cell type is intended to be compatible with any vertebrate common myeloid progenitor. For mammalian CMP known to be CD34-positive, please use the term 'common myeloid progenitor, CD34-positive' (CL_0001059). subset: human_reference_atlas synonym: "CFU-GEMM" RELATED [ISBN:0878932437] synonym: "CFU-S" RELATED [ISBN:0878932437] synonym: "CMP" EXACT [ISBN:0878932437] synonym: "colony forming unit granulocyte, erythrocyte, macrophage, and megakaryocyte" RELATED [ISBN:0878932437] synonym: "common myeloid precursor" EXACT [] synonym: "multipotential myeloid stem cell" RELATED [ISBN:0878932437] synonym: "myeloid stem cell" RELATED [ISBN:0878932437] synonym: "pluripotent stem cell (bone marrow)" RELATED [ISBN:0878932437] xref: BTO:0004730 is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell disjoint_from: CL:0000050 ! megakaryocyte-erythroid progenitor cell disjoint_from: CL:0000051 ! common lymphoid progenitor disjoint_from: CL:0000557 ! granulocyte monocyte progenitor cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000050 name: megakaryocyte-erythroid progenitor cell def: "A progenitor cell committed to the megakaryocyte and erythroid lineages." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Megakaryocyte-erythroid_progenitor_cell, MESH:D055015, PMID:16647566] comment: MEPs are reportedly CD19-negative, CD34-negative, CD45RA-negative, CD110-positive, CD117-positive, and SCA1-negative and reportedly express the transcription factors GATA-1 and NF-E2. subset: human_reference_atlas synonym: "CFU-EM" EXACT [] synonym: "CFU-MegE" EXACT [] synonym: "colony forming unit erythroid megakaryocyte" EXACT [] synonym: "Meg/E progenitor" EXACT [] synonym: "megakaryocyte/erythrocyte progenitor" EXACT [] synonym: "megakaryocyte/erythroid progenitor cell" EXACT [] synonym: "MEP" EXACT [] is_a: CL:0000763 ! myeloid cell is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell intersection_of: capable_of GO:0030218 ! erythrocyte differentiation intersection_of: capable_of GO:0030219 ! megakaryocyte differentiation disjoint_from: CL:0000557 ! granulocyte monocyte progenitor cell disjoint_from: CL:0002009 ! macrophage dendritic cell progenitor relationship: capable_of GO:0030218 ! erythrocyte differentiation relationship: capable_of GO:0030219 ! megakaryocyte differentiation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000051 name: common lymphoid progenitor alt_id: CL:0000044 def: "A oligopotent progenitor cell committed to the lymphoid lineage." [GOC:add, GOC:dsd, GOC:tfm, PMID:10407577, PMID:16551251] comment: CLP are CD7-positive, CD10-positive, CD19-negative, CD34-positive, CD45RA-positive, CD79a-negative, CD127-positive, AA4.1-positive, RAG-negative, Sca-1-low, sIgM-negative, sIgD-negative, TdT-negative, Vpre-B-negative, and pre-BCR-negative. Expression of transcription factors include E2A-positive, EBF-positive, Ikaros-negative, PU.1-negative, and Pax5-negative. subset: human_reference_atlas synonym: "CLP" EXACT [] synonym: "committed lymphopoietic stem cell" RELATED [] synonym: "common lymphocyte precursor" EXACT [] synonym: "common lymphocyte progenitor" EXACT [] synonym: "common lymphoid precursor" EXACT [] synonym: "early lymphocyte progenitor" RELATED [] synonym: "ELP" RELATED [] synonym: "lymphoid stem cell" RELATED [] synonym: "lymphopoietic stem cell" RELATED [] is_a: CL:0002032 {is_inferred="true"} ! hematopoietic oligopotent progenitor cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell intersection_of: capable_of GO:0030098 ! lymphocyte differentiation relationship: capable_of GO:0030098 ! lymphocyte differentiation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000052 name: totipotent stem cell def: "A stem cell from which all cells of the body can form." [GOC:add, GOC:tfm] synonym: "totipotential stem cell" EXACT [] xref: FMA:84790 xref: MESH:D039901 is_a: CL:0000723 ! somatic stem cell [Term] id: CL:0000054 name: bone matrix secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000055 name: non-terminally differentiated cell def: "A precursor cell with a limited number of potential fates." [SANBI:mhl] comment: define using PATO mulit-potent or oligopotent? synonym: "blast cell" EXACT [] xref: BTO:0000125 xref: FMA:84782 is_a: CL:0011115 ! precursor cell [Term] id: CL:0000056 name: myoblast def: "A cell that is commited to differentiating into a muscle cell. Embryonic myoblasts develop from the mesoderm. They undergo proliferation, migrate to their various sites, and then differentiate into the appropriate form of myocytes. Myoblasts also occur as transient populations of cells in muscles undergoing repair." [GOC:tfm, MESH:D032446, PMID:21849021] xref: BTO:0000222 xref: CALOHA:TS-0650 xref: FBbt:00005083 xref: FMA:70335 xref: VHOG:0001529 is_a: CL:0000680 ! muscle precursor cell [Term] id: CL:0000057 name: fibroblast def: "A connective tissue cell which secretes an extracellular matrix rich in collagen and other macromolecules. Flattened and irregular in outline with branching processes; appear fusiform or spindle-shaped." [http://en.wikipedia.org/wiki/Fibroblast, ISBN:0517223651, MESH:D005347] comment: These cells may be vimentin-positive, fibronectin-positive, fsp1-positive, MMP-1-positive, collagen I-positive, collagen III-positive, and alpha-SMA-negative. subset: human_reference_atlas xref: BTO:0000452 xref: CALOHA:TS-0362 xref: FMA:63877 xref: VHOG:0001482 is_a: CARO:0000000 ! anatomical entity is_a: CL:0002320 ! connective tissue cell relationship: develops_from CL:0000134 ! mesenchymal stem cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000058 name: chondroblast def: "Skeletogenic cell that is typically non-terminally differentiated, secretes an avascular, GAG rich matrix; is not buried in cartilage tissue matrix, retains the ability to divide, located adjacent to cartilage tissue (including within the perichondrium), and develops from prechondroblast (and thus prechondrogenic) cell." [GO_REF:0000034, GOC:tfm, ISBN:0618947256] synonym: "chrondoplast" EXACT [] xref: BTO:0003607 xref: FMA:66783 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0002320 ! connective tissue cell relationship: develops_from CL:0007009 ! prechondroblast relationship: produces UBERON:0002418 ! cartilage tissue [Term] id: CL:0000059 name: ameloblast alt_id: CL:0000053 alt_id: CL:0000139 def: "Skeletogenic cell that produces enamel, overlies the odontogenic papilla, and arises from the differentiation of a preameloblast cell." [GO_REF:0000034, GOC:tfm, MESH:D000565] comment: non-encoded relationship from VSAO produces VSAO:0000066 synonym: "amelocyte" EXACT [] synonym: "enamel secreting cell" EXACT [] xref: BTO:0001663 xref: FMA:70576 is_a: CL:0000146 ! simple columnar epithelial cell is_a: CL:0000151 ! secretory cell is_a: CL:0002077 ! ecto-epithelial cell relationship: adjacent_to UBERON:0001763 ! odontogenic papilla relationship: capable_of GO:0097186 ! amelogenesis relationship: develops_from CL:0007000 ! preameloblast relationship: part_of UBERON:0005176 ! tooth enamel organ relationship: produces UBERON:0001752 ! enamel [Term] id: CL:0000060 name: odontoblast def: "Skeletogenic cell that secretes dentine matrix, is derived from the odontogenic papilla, and develops from a preodontoblast cell." [GO_REF:0000034, ISBN:0618947256] comment: legacy def: One of the cells forming the outer surface of dental pulp that produces tooth dentin. xref: BTO:0001769 xref: CALOHA:TS-0696 xref: FMA:62999 xref: MESH:D009804 is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0000710 ! neurecto-epithelial cell is_a: CL:0002159 ! general ecto-epithelial cell is_a: CL:0011026 ! progenitor cell relationship: develops_from CL:0007003 ! preodontoblast relationship: part_of UBERON:0005176 ! tooth enamel organ relationship: produces UBERON:0001751 ! dentine [Term] id: CL:0000061 name: cementoblast alt_id: CL:0000859 def: "Skeletogenic cell that produces cementum (a bony substance that covers the root of a tooth), is part of the odontogenic papilla, and develops from a precementoblast cell." [GO_REF:0000034, ISBN:0781733901] comment: Legacy def: A cell of ectomesenchymal origin that aids in the formation the cementum layer on the roots of teeth. synonym: "cementum secreting cell" EXACT [] xref: CALOHA:TS-1164 xref: FMA:63002 is_a: CL:0000062 ! osteoblast is_a: CL:0000151 ! secretory cell relationship: develops_from CL:0007002 ! precementoblast relationship: part_of UBERON:0005176 ! tooth enamel organ relationship: produces UBERON:0001753 ! cementum [Term] id: CL:0000062 name: osteoblast def: "Skeletogenic cell that secretes osteoid, is capable of producing mineralized (hydroxyapatite) matrix, is located adjacent to or within osteoid tissue, and arises from the transformation of a preosteoblast cell." [GO_REF:0000034, MESH:D010006] comment: non-encoded relationships from VSAO - capable_of_producing VSAO:0000020 subset: human_reference_atlas xref: BTO:0001593 xref: CALOHA:TS-0720 xref: FMA:66780 is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0002320 ! connective tissue cell is_a: CL:0011026 ! progenitor cell relationship: develops_from CL:0007010 ! preosteoblast relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: produces UBERON:0008883 ! osteoid [Term] id: CL:0000063 name: obsolete cell by histology def: "OBSOLETE: A classification of cells by their microscopic appearance." [FB:ma, GOC:tfm] comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its microscopic appearance. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000064 name: ciliated cell def: "A cell that has a filiform extrusion of the cell surface." [GOC:tfm] xref: VHOG:0001532 xref: XAO:0000031 is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: has_part GO:0005929 ! cilium relationship: has_part GO:0005929 ! cilium [Term] id: CL:0000065 name: ependymal cell def: "A neurectoderm derived cell that lines the neural lumen." [GOC:tfm, JB:jb, PMID:9550134] synonym: "ependymocyte" EXACT [] xref: BTO:0001724 xref: FMA:70550 is_a: CL:0000067 ! ciliated epithelial cell is_a: CL:0000710 ! neurecto-epithelial cell [Term] id: CL:0000066 name: epithelial cell def: "A cell that is usually found in a two-dimensional sheet with a free surface. The cell has a cytoskeleton that allows for tight cell to cell contact and for cell polarity where apical part is directed towards the lumen and the basal part to the basal lamina." [FB:ma, GOC:tfm, MESH:D004847] subset: human_reference_atlas synonym: "epitheliocyte" EXACT [] xref: BTO:0000414 xref: CALOHA:TS-2026 xref: CARO:0000077 xref: FBbt:00000124 xref: FMA:66768 xref: WBbt:0003672 is_a: BFO:0000004 ! independent continuant is_a: CL:0000548 ! animal cell disjoint_from: CL:0000738 ! leukocyte relationship: part_of UBERON:0000483 ! epithelium relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000067 name: ciliated epithelial cell def: "An epithelial cell that has a cilia." [GOC:tfm] xref: FMA:70605 is_a: CL:0000064 ! ciliated cell is_a: CL:0000066 ! epithelial cell intersection_of: CL:0000066 ! epithelial cell intersection_of: has_part GO:0005929 ! cilium [Term] id: CL:0000068 name: duct epithelial cell def: "An epithelial cell that is part of a duct." [https://orcid.org/0000-0001-5208-3432] is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0000058 ! duct relationship: part_of UBERON:0000058 ! duct [Term] id: CL:0000069 name: branched duct epithelial cell is_a: CL:0000068 ! duct epithelial cell [Term] id: CL:0000070 name: obsolete epithelial cell of gland is_obsolete: true [Term] id: CL:0000071 name: blood vessel endothelial cell def: "An endothelial cell that lines the vasculature." [GOC:tfm] subset: human_reference_atlas synonym: "cuboidal endothelial cell of vascular tree" EXACT [] is_a: CL:0000076 {is_inferred="true"} ! squamous epithelial cell is_a: CL:0002139 ! endothelial cell of vascular tree intersection_of: CL:0000076 ! squamous epithelial cell intersection_of: part_of UBERON:0004638 ! blood vessel endothelium relationship: develops_from CL:0002546 ! embryonic blood vessel endothelial progenitor cell relationship: part_of UBERON:0004638 ! blood vessel endothelium relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000072 name: non-branched duct epithelial cell is_a: CL:0000068 ! duct epithelial cell is_a: CL:0002078 ! meso-epithelial cell [Term] id: CL:0000073 name: barrier epithelial cell is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000074 name: obsolete epithem cell def: "Obsolete. Use PO:0000066 from Plant Ontology instead. A cell that constitutes the mesophyll of a hydathode and is located between the xylem endings and the epidermis. Proposed to be involved in the retrieval of solutes from the xylem sap." [ISBN:0471245208, PMID:12662305] is_obsolete: true replaced_by: PO:0000066 [Term] id: CL:0000075 name: columnar/cuboidal epithelial cell def: "A columnar/cuboidal epithelial cell is a cell usually found in a two dimensional sheet with a free surface. Columnar/cuboidal epithelial cells take on the shape of a column or cube." [GO:0002065, https://orcid.org/0000-0001-5208-3432] subset: human_reference_atlas is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000076 name: squamous epithelial cell xref: CALOHA:TS-1249 is_a: CL:0000066 ! epithelial cell [Term] id: CL:0000077 name: mesothelial cell def: "A flattened epithelial cell of mesenchymal origin that lines the serous cavity." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas synonym: "mesotheliocyte" EXACT [] xref: FMA:66773 is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0000213 ! lining cell is_a: CL:0002078 ! meso-epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000078 name: peridermal cell is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000079 name: stratified epithelial cell is_a: CARO:0000000 ! anatomical entity is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell relationship: develops_from CL:0000357 ! stratified epithelial stem cell [Term] id: CL:0000080 name: circulating cell def: "A cell which moves among different tissues of the body, via blood, lymph, or other medium." [GOC:add] is_a: BFO:0000004 ! independent continuant is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: part_of UBERON:0000179 ! haemolymphatic fluid relationship: part_of UBERON:0000179 ! haemolymphatic fluid [Term] id: CL:0000081 name: blood cell def: "A cell found predominately in the blood." [GOC:add, GOC:tfm] xref: FMA:62844 xref: MESH:D001773 is_a: BFO:0000040 ! material entity is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell intersection_of: CL:0000988 ! hematopoietic cell intersection_of: capable_of GO:0008015 ! blood circulation relationship: capable_of GO:0008015 ! blood circulation [Term] id: CL:0000082 name: epithelial cell of lung def: "An epithelial cell of the lung." [https://orcid.org/0000-0001-5208-3432] synonym: "lung epithelial cell" EXACT [] xref: BTO:0004299 is_a: CL:0000066 ! epithelial cell intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0002048 ! lung relationship: part_of UBERON:0000115 ! lung epithelium [Term] id: CL:0000083 name: epithelial cell of pancreas def: "An epithelial cell of the pancreas." [GOC:tfm] synonym: "pancreas epithelial cell" EXACT [] synonym: "pancreatic epithelial cell" EXACT [] xref: BTO:0000028 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000066 {is_inferred="true"} ! epithelial cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0001264 ! pancreas relationship: develops_from CL:0000223 ! endodermal cell relationship: part_of UBERON:0001264 ! pancreas [Term] id: CL:0000084 name: T cell alt_id: CL:0000804 alt_id: CL:0000812 def: "A type of lymphocyte whose defining characteristic is the expression of a T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149] subset: human_reference_atlas synonym: "immature T cell" RELATED [] synonym: "mature T cell" RELATED [] synonym: "T lymphocyte" EXACT [] synonym: "T-cell" EXACT [] synonym: "T-lymphocyte" EXACT [] xref: BTO:0000782 xref: CALOHA:TS-1001 xref: FMA:62870 xref: MESH:D013601 xref: VHOG:0001479 is_a: CL:0000542 {is_inferred="true"} ! lymphocyte intersection_of: CL:0000542 ! lymphocyte intersection_of: capable_of GO:0002456 ! T cell mediated immunity disjoint_from: CL:0000945 ! lymphocyte of B lineage relationship: capable_of GO:0002456 ! T cell mediated immunity relationship: develops_from CL:0000827 ! pro-T cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000085 name: germ line stem cell (sensu Vertebrata) is_a: CL:0000014 ! germ line stem cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata [Term] id: CL:0000086 name: germ line stem cell (sensu Nematoda and Protostomia) xref: FBbt:00004861 is_a: CL:0000014 ! germ line stem cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000087 name: male germ line stem cell (sensu Nematoda and Protostomia) xref: FBbt:00004929 is_a: CL:0000016 ! male germ line stem cell is_a: CL:0000086 ! germ line stem cell (sensu Nematoda and Protostomia) [Term] id: CL:0000088 name: female germ line stem cell (sensu Nematoda and Protostomia) is_a: CL:0000022 ! female germ line stem cell is_a: CL:0000086 ! germ line stem cell (sensu Nematoda and Protostomia) [Term] id: CL:0000089 name: male germ line stem cell (sensu Vertebrata) synonym: "spermatogonial stem cell" EXACT [PMID:19948499] is_a: CL:0000016 ! male germ line stem cell is_a: CL:0000085 ! germ line stem cell (sensu Vertebrata) [Term] id: CL:0000090 name: female germ line stem cell (sensu Vertebrata) is_a: CL:0000022 ! female germ line stem cell is_a: CL:0000085 ! germ line stem cell (sensu Vertebrata) [Term] id: CL:0000091 name: Kupffer cell def: "A tissue-resident macrophage of the reticuloendothelial system found on the luminal surface of the hepatic sinusoids involved in erythrocyte clearance. Markers include F4/80+, CD11b-low, CD68-positive, sialoadhesin-positive, CD163/SRCR-positive. Irregular, with long processes including lamellipodia extending into the sinusoid lumen, have flattened nucleus with cytoplasm containing characteristic invaginations of the plasma membrane (vermiform bodies); lie within the sinusoid lumen attached to the endothelial surface; derived from the bone marrow, form a major part of the body's mononuclear phagocyte system." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0517223651, MESH:D007728, PMID:15771589, PMID:17105582] comment: Markers: Mouse: F4/80+, CD11b-low, CD68+, sialoadhesin+, CD163/SRCR+; role or process: immune, antigen-presentation, clearance of senescent erythrocytes, iron metabolism. Kupffer cells are also reportedly C3aR-positive, CD14-low, CD54-positive, CD88-positive, and CD284-positive. They are also capable of producing IL-1, IL-6, TNF-alpha, nitric oxide, PGD2, PGE2, PGF2alpha, and TXA2. subset: human_reference_atlas synonym: "hepatic macrophage" EXACT [] synonym: "littoral cell of hepatic sinusoid" EXACT [] synonym: "liver macrophage" EXACT [] synonym: "macrophagocytus stellatus" EXACT [] synonym: "stellate cell of von Kupffer" EXACT [] synonym: "von Kupffer cell" EXACT [] xref: BTO:0000685 xref: FMA:14656 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: capable_of GO:0034102 ! erythrocyte clearance intersection_of: located_in UBERON:0001281 ! hepatic sinusoid intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 intersection_of: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130 intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin intersection_of: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M relationship: capable_of GO:0034102 ! erythrocyte clearance relationship: located_in UBERON:0001281 ! hepatic sinusoid relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 relationship: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130 relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M [Term] id: CL:0000092 name: osteoclast def: "A specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue, which typically differentiates from monocytes. This cell has the following markers: tartrate-resistant acid phosphatase type 5-positive, PU.1-positive, c-fos-positive, nuclear factor NF-kappa-B p100 subunit-positive, tumor necrosis factor receptor superfamily member 11A-positive and macrophage colony-stimulating factor 1 receptor-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149, PMID:10428500, PMID:15055519, PMID:17380158] comment: Morphology: Highly vesicular; markers: Surface: RANK, cFMS (MCSF receptor); Secreted: cathepsin K and TRAP (tartate resistant acid phosphatase); transcription factors: PU.1, cFOS, MITF, NFkB (p52); role or process: tissue remodelling: bone resorption; lineage: hematopoietic, myeloid. subset: human_reference_atlas synonym: "chondroclast" RELATED [] xref: BTO:0000968 xref: CALOHA:TS-0721 xref: FMA:66781 xref: MESH:D010010 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte is_a: CL:0001035 {is_inferred="true"} ! bone cell intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: capable_of GO:0045453 ! bone resorption intersection_of: has_part PR:000001850 ! cathepsin K intersection_of: has_part PR:000001937 ! tartrate-resistant acid phosphatase type 5 intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000007597 ! protein c-Fos intersection_of: has_part PR:000011178 ! nuclear factor NF-kappa-B p100 subunit intersection_of: part_of UBERON:0001474 ! bone element intersection_of: RO:0002104 PR:000001954 ! has plasma membrane part tumor necrosis factor receptor superfamily member 11A intersection_of: RO:0002104 PR:000002062 ! has plasma membrane part macrophage colony-stimulating factor 1 receptor relationship: capable_of GO:0045453 ! bone resorption relationship: develops_from CL:0000576 ! monocyte relationship: has_part PR:000001850 ! cathepsin K relationship: has_part PR:000001937 ! tartrate-resistant acid phosphatase type 5 relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000007597 ! protein c-Fos relationship: has_part PR:000011178 ! nuclear factor NF-kappa-B p100 subunit relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001954 ! has plasma membrane part tumor necrosis factor receptor superfamily member 11A relationship: RO:0002104 PR:000002062 ! has plasma membrane part macrophage colony-stimulating factor 1 receptor [Term] id: CL:0000093 name: obsolete osteochondroclast def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Consider using 'osteoclast ; CL:0000092' instead. is_obsolete: true [Term] id: CL:0000094 name: granulocyte def: "A leukocyte with abundant granules in the cytoplasm." [GOC:amm, GOC:tfm, http://en.wikipedia.org/wiki/Granulocyte, MESH:D006098] subset: human_reference_atlas synonym: "granular leucocyte" EXACT [] synonym: "granular leukocyte" EXACT [] synonym: "polymorphonuclear leukocyte" EXACT [] xref: BTO:0000539 xref: BTO:0001026 xref: CALOHA:TS-0422 xref: FMA:62854 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000081 ! blood cell is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: capable_of GO:0008015 ! blood circulation intersection_of: has_part GO:0030141 ! secretory granule intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001332 ! has plasma membrane part carcinoembryonic antigen-related cell adhesion molecule 8 intersection_of: RO:0002104 PR:000001969 ! has plasma membrane part urokinase plasminogen activator surface receptor relationship: has_part GO:0030141 ! secretory granule relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: RO:0002104 PR:000001332 ! has plasma membrane part carcinoembryonic antigen-related cell adhesion molecule 8 relationship: RO:0002104 PR:000001969 ! has plasma membrane part urokinase plasminogen activator surface receptor [Term] id: CL:0000095 name: neuron associated cell is_a: CARO:0000000 ! anatomical entity is_a: CL:0002319 ! neural cell relationship: develops_from CL:0000133 ! neurectodermal cell [Term] id: CL:0000096 name: mature neutrophil def: "A fully differentiated neutrophil, a granular leukocyte having a nucleus with three to five lobes connected by slender threads, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes. They are produced in bone marrow at a rate of 5e10-10e10/day and have a half-life of 6-8 hours. Neutrophils are CD15-positive, CD16-positive, CD32-positive, CD43-positive, CD181-positive, and CD182-positive." [GOC:add, GOC:tfm, http://www.cap.org, MESH:D009504, PMID:11138776, PMID:12560239, PMID:15514007, PMID:7880385] comment: Neutrophils are also capable of secreting GRO-alpha, IL-1beta, IL-1ra, IL-3, IL-12, IP-10, MIG, MIP-1alpha, MIP-1beta, TGF-beta, TNF-alpha, VEGF, and anti-microbial peptides. They can positively influence the chemotaxis of basophils, T-cells, monocytes, macrophages, dendritic cells, and other neutrophils. Neutrophils are also CD35-positive, CD64-positive, CD89-positive, CD184-positive, and fMLP receptor-positive Ly-6G-positive (mouse), TLR2-low, TLR4-low, and lineage-negative (CD2, CD3, CD5, CD9, CD19, CD36, CD49d, CD56, CD61, CD235a (glycophorin-A)). subset: human_reference_atlas synonym: "mature neutrocyte" EXACT [] synonym: "mature neutrophil leucocyte" EXACT [] synonym: "mature neutrophil leukocyte" EXACT [] synonym: "mature neutrophilic leucocyte" EXACT [] synonym: "mature neutrophilic leukocyte" EXACT [] synonym: "PMN" EXACT [] synonym: "poly" BROAD [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] synonym: "polymorphonuclear neutrophil" EXACT [] synonym: "polynuclear neutrophilic leucocyte" EXACT [] synonym: "polynuclear neutrophilic leukocyte" EXACT [] xref: BTO:0003473 is_a: CL:0000234 ! phagocyte is_a: CL:0000775 {is_inferred="true"} ! neutrophil relationship: capable_of GO:0002536 ! respiratory burst involved in inflammatory response relationship: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis relationship: capable_of GO:0032637 ! interleukin-8 production relationship: has_part CL:0017500 ! neutrophillic cytoplasm relationship: has_part GO:0070820 ! tertiary granule relationship: lacks_part PR:000009978 ! lactotransferrin relationship: lacks_part PR:000010543 ! myeloperoxidase relationship: lacks_part PR:000010799 ! myb proto-oncogene protein relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001256 ! has plasma membrane part C-X-C chemokine receptor type 1 relationship: RO:0002104 PR:000001257 ! has plasma membrane part C-X-C chemokine receptor type 2 relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001944 ! has plasma membrane part transcription factor PU.1 relationship: RO:0002104 PR:000007597 ! has plasma membrane part protein c-Fos [Term] id: CL:0000097 name: mast cell def: "A cell that is found in almost all tissues containing numerous basophilic granules and capable of releasing large amounts of histamine and heparin upon activation. Progenitors leave bone marrow and mature in connective and mucosal tissue. Mature mast cells are found in all tissues, except the bloodstream. Their phenotype is CD117-high, CD123-negative, CD193-positive, CD200R3-positive, and FceRI-high. Stem-cell factor (KIT-ligand; SCF) is the main controlling signal of their survival and development." [GOC:add, GOC:dsd, GOC:tfm, ISBN:068340007X, MESH:D008407, PMCID:PMC1312421, PMCID:PMC2855166, PMID:15153310, PMID:16455980, PMID:19671378, PMID:212366338, PMID:9354811] comment: Mast cells are generally integrin beta-7-negative and positive for TLR2, TLR3, TLR4, TLR5, TLR7, TLR9, C3aR, C5aR, CR3, CR4, VEGF, FGF2, and renin. They can express MHC Class I and II on their surface. Activated murine mast cells (IgE+Antigen) were capable of expressing the following co-stimulatory molecules: CD95 (Fas), CD120b, CD137 (4-1BB), CD153 (CD30L), CD154 (CD40L), GITR, ICOSL, OX40L, PD-L1, and PD-L2. Note that there was some mouse strain variation. Mast cells have also been demonstrated to produce bFGF, CCL2, CCL4, CCL5, CCL11, CCL20, CXCL2, CXCL8, CXCL10, GM-CSF, IFN-gamma, IL-1, IL-2, IL-3, IL-8, IL-10, IL-11, IL-12, IL-13, IL-16, IL-25, IL-18, MIP-1, prostaglandin D2, SCF, TGF-beta, TNF-alpha, TSLP, VEGF, and XCL1. They express the transcription factors Transcription factors AP-1, GATA1, MITF, Notch2, PIAS3, PU.1, and STAT5. subset: human_reference_atlas synonym: "histaminocyte" EXACT [] synonym: "labrocyte" EXACT [ISBN:0721601464] synonym: "mastocyte" EXACT [ISBN:0721601464] synonym: "tissue basophil" RELATED [ISBN:068340007X] xref: BTO:0000830 xref: CALOHA:TS-0603 xref: FMA:66784 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte is_a: CL:0002274 ! histamine secreting cell intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: capable_of GO:0002349 ! histamine production involved in inflammatory response intersection_of: capable_of GO:0002539 ! prostaglandin production involved in inflammatory response intersection_of: capable_of GO:0002660 ! positive regulation of peripheral tolerance induction intersection_of: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis intersection_of: capable_of GO:0002830 ! positive regulation of type 2 immune response intersection_of: capable_of GO:0030210 ! heparin biosynthetic process intersection_of: has_part GO:0030141 ! secretory granule intersection_of: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain intersection_of: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3 intersection_of: RO:0002104 PR:000006169 ! has plasma membrane part cell surface glycoprotein CD200 receptor 3 intersection_of: RO:0015015 PR:000002065 ! has high plasma membrane amount mast/stem cell growth factor receptor intersection_of: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha relationship: capable_of GO:0002349 ! histamine production involved in inflammatory response relationship: capable_of GO:0002539 ! prostaglandin production involved in inflammatory response relationship: capable_of GO:0002660 ! positive regulation of peripheral tolerance induction relationship: capable_of GO:0002690 ! positive regulation of leukocyte chemotaxis relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response relationship: capable_of GO:0030210 ! heparin biosynthetic process relationship: develops_from CL:0000831 ! mast cell progenitor relationship: has_part GO:0030141 ! secretory granule relationship: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3 relationship: RO:0002104 PR:000006169 ! has plasma membrane part cell surface glycoprotein CD200 receptor 3 relationship: RO:0015015 PR:000002065 ! has high plasma membrane amount mast/stem cell growth factor receptor relationship: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha [Term] id: CL:0000098 name: sensory epithelial cell def: "A specialized epithelial cell involved in sensory perception. Restricted to special sense organs of the olfactory, gustatory, and vestibulocochlear receptor systems; contain sensory cells surrounded by supportive, non-receptive cells." [GOC:tfm, ISBN:0517223651, ISBN:0721662544] comment: The term "neuroepithelial cell" is used to describe both this cell type and neurecto-epithelial cell (CL:0000710). synonym: "neuroepithelial cell" BROAD [] xref: BTO:0004301 is_a: CL:0000066 ! epithelial cell is_a: CL:0000197 ! sensory receptor cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000066 ! epithelial cell intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception [Term] id: CL:0000099 name: interneuron def: "Most generally any neuron which is not motor or sensory. Interneurons may also refer to neurons whose axons remain within a particular brain region as contrasted with projection neurons which have axons projecting to other brain regions." [GOC:tfm, MESH:D007395] subset: human_reference_atlas xref: BTO:0003811 xref: FBbt:00005125 xref: FMA:67313 xref: WBbt:0005113 is_a: CL:0000540 ! neuron relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000100 name: motor neuron def: "An efferent neuron that passes from the central nervous system or a ganglion toward or to a muscle and conducts an impulse that causes or inhibits movement." [MESH:D009046, PMID:16875686] synonym: "motoneuron" EXACT [] xref: BTO:0000312 xref: FBbt:00005123 xref: FMA:83617 xref: WBbt:0005409 is_a: CL:0000527 ! efferent neuron [Term] id: CL:0000101 name: sensory neuron def: "Any neuron having a sensory function; an afferent neuron conveying sensory impulses." [ISBN:0721662544] xref: BTO:0001037 xref: FBbt:00005124 xref: FMA:84649 xref: MESH:D011984 xref: WBbt:0005759 is_a: CL:0000526 ! afferent neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception relationship: capable_of GO:0050906 ! detection of stimulus involved in sensory perception [Term] id: CL:0000102 name: polymodal neuron is_a: CL:0000540 ! neuron [Term] id: CL:0000103 name: bipolar neuron def: "A type of interneuron that has two neurites, usually an axon and a dendrite, extending from opposite poles of an ovoid cell body." [GOC:tfm, ISBN:0444009442] subset: BDS_subset xref: FMA:67282 is_a: CL:0000099 ! interneuron intersection_of: CL:0000099 ! interneuron intersection_of: bearer_of PATO:0070006 ! cortical bipolar morphology relationship: bearer_of PATO:0070006 ! cortical bipolar morphology [Term] id: CL:0000104 name: multipolar neuron def: "A neuron with three or more neurites, usually an axon and multiple dendrites." [FMA:67287, GOC:tfm] subset: BDS_subset xref: FMA:67287 is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: bearer_of PATO:0070026 ! multipolar neuron morphology relationship: bearer_of PATO:0070026 ! multipolar neuron morphology [Term] id: CL:0000105 name: pseudounipolar neuron def: "Neuron with two neurites that are fused grossly when they protrude from the soma and bifurcate a short distance from the soma." [FMA:67305, GOC:tfm] xref: FMA:67305 is_a: CL:0000540 ! neuron [Term] id: CL:0000106 name: unipolar neuron def: "Neuron with one neurite that extends from the cell body." [FMA:67278, GOC:nv] subset: BDS_subset xref: FMA:67278 is_a: CL:0000540 ! neuron [Term] id: CL:0000107 name: autonomic neuron def: "A neuron whose cell body is within an autonomic ganglion." [GOC:tfm] xref: FMA:80121 is_a: CARO:0000000 ! anatomical entity is_a: CL:2000032 ! peripheral nervous system neuron intersection_of: CL:0000540 ! neuron intersection_of: RO:0002100 UBERON:0002410 ! has soma location autonomic nervous system relationship: RO:0002100 UBERON:0002410 ! has soma location autonomic nervous system [Term] id: CL:0000108 name: cholinergic neuron def: "A neuron that uses acetylcholine as a vesicular neurotransmitter." [GOC:tfm] xref: BTO:0004902 xref: FMA:84796 xref: MESH:D059329 xref: WBbt:0006840 is_a: CL:0000151 ! secretory cell is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0014055 ! acetylcholine secretion, neurotransmission relationship: capable_of GO:0014055 ! acetylcholine secretion, neurotransmission [Term] id: CL:0000109 name: adrenergic neuron xref: MESH:D059331 is_a: CL:0000540 ! neuron [Term] id: CL:0000110 name: peptidergic neuron is_a: CL:0000540 ! neuron relationship: capable_of GO:0002790 ! peptide secretion [Term] id: CL:0000112 name: columnar neuron synonym: "columnar neuron" RELATED [] is_a: CL:0000540 ! neuron [Term] id: CL:0000113 name: mononuclear phagocyte def: "A vertebrate phagocyte with a single nucleus." [GOC:add, GOC:tfm, ISBN:0781735149] xref: BTO:0001433 is_a: CL:0000226 ! single nucleate cell is_a: CL:0000518 {is_inferred="true"} ! phagocyte (sensu Vertebrata) intersection_of: CL:0000518 ! phagocyte (sensu Vertebrata) intersection_of: bearer_of PATO:0001407 ! mononucleate [Term] id: CL:0000114 name: surface ectodermal cell synonym: "cell of surface ectoderm" EXACT [] synonym: "surface ectoderm cell" EXACT [] xref: FMA:72552 is_a: CL:0000221 ! ectodermal cell [Term] id: CL:0000115 name: endothelial cell def: "An endothelial cell comprises the outermost layer or lining of anatomical structures and can be squamous or cuboidal. In mammals, endothelial cell has vimentin filaments and is derived from the mesoderm." [GOC:tfm, http://en.wikipedia.org/wiki/Endothelial_cell, https://sourceforge.net/tracker/?func=detail&atid=440764&aid=3364936&group_id=36855, MESH:D042783, PMID:21275341] comment: From FMA: 9.07.2001: Endothelial cell has always been classified as a kind of epithelial cell, specifically a squamous cell but that is not true. First, endothelial cell can either be squamous or cuboidal (e.g. high-endothelial cell) and secondly, it has different embryological derivation (mesodermal) than a true epithelial cell (ectodermal and endodermal). The basis for present classification is the fact that it comprises the outermost layer or lining of anatomical structures (location-based) but a better structural basis for the differentia is the cytoskeleton of the cell. Endothelial cell has vimentin filaments while an epithelial cell has keratin filaments. [Onard]. subset: human_reference_atlas synonym: "endotheliocyte" EXACT [] xref: BTO:0001176 xref: CALOHA:TS-0278 xref: FMA:66772 is_a: CL:0000213 ! lining cell is_a: CL:0002078 ! meso-epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000116 name: pioneer neuron def: "Pioneer neurons establish a pathway in the developing central nervous system and then undergo programmed cell death once the adult axons, which follow them, have made connections with the target site. Thus, they are a transient cell type involved in axon guidance." [GOC:cvs, GOC:tfm] xref: FBbt:00005128 is_a: CL:0000540 ! neuron [Term] id: CL:0000117 name: CNS neuron (sensu Vertebrata) is_a: CARO:0000000 ! anatomical entity is_a: CL:0000540 ! neuron relationship: develops_from CL:0000031 ! neuroblast (sensu Vertebrata) relationship: part_of UBERON:0001017 ! central nervous system [Term] id: CL:0000118 name: basket cell def: "Basket cells are inhibitory GABAergic interneurons of the brain. In general, dendrites of basket cells are free branching and contain smooth spines. Axons are highly branched. The branched axonal arborizations give rise to basket-like structures that surround the soma of the target cell. Basket cells form axo-somatic synapses, meaning their synapses target somas of other cells." [WikipediaVersioned:Basket_cell&oldid=951703880] subset: BDS_subset is_a: CL:0000104 ! multipolar neuron is_a: CL:0011005 ! GABAergic interneuron intersection_of: CL:0000099 ! interneuron intersection_of: bearer_of PATO:0070002 ! basket cell morphology intersection_of: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission relationship: bearer_of PATO:0070002 ! basket cell morphology relationship: dc-contributor https://orcid.org/0000-0002-2825-0621 [Term] id: CL:0000119 name: cerebellar Golgi cell def: "Large intrinsic neuron located in the granule layer of the cerebellar cortex that extends its dendrites into the molecular layer where they receive contact from parallel fibers. The axon of the Golgi cell ramifies densely in the granule layer and enters into a complex arrangement with mossy fiber terminals and granule cell dendrites to form the cerebellar glomerulus. Llinas, Walton and Lang. In The Synaptic Organization of the Brain. 5th ed. 2004." [NIFSTD:sao1415726815] synonym: "cerebellar Golgi neuron" EXACT [] synonym: "cerebellum Golgi cell" EXACT [] synonym: "Golgi cell" EXACT [] synonym: "Golgi neuron" EXACT [] xref: MESH:D000080906 is_a: CL:0000402 ! CNS interneuron is_a: CL:0011005 ! GABAergic interneuron is_a: CL:1001611 ! cerebellar neuron relationship: RO:0002100 UBERON:0002129 ! has soma location cerebellar cortex [Term] id: CL:0000120 name: granule cell xref: BTO:0003393 is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) [Term] id: CL:0000121 name: Purkinje cell def: "The output neuron of the cerebellar cortex." [MESH:D011689] synonym: "cerebellar Purkinje cell" EXACT [] synonym: "cerebellum Purkinje cell" EXACT [] synonym: "Purkinje neuron" EXACT [] synonym: "Purkinje's cell" EXACT [] xref: BTO:0001011 xref: CALOHA:TS-0845 xref: FMA:67969 is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) is_a: CL:0000527 ! efferent neuron is_a: CL:1001611 ! cerebellar neuron relationship: RO:0002100 UBERON:0002129 ! has soma location cerebellar cortex [Term] id: CL:0000122 name: stellate neuron def: "A neuron that has dendritic processes radiating from the cell body forming a star-like shape." [ISBN:9780123973481] subset: BDS_subset xref: BTO:0002316 is_a: CL:0000104 ! multipolar neuron is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) intersection_of: CL:0000117 ! CNS neuron (sensu Vertebrata) intersection_of: bearer_of PATO:0070010 ! stellate morphology relationship: bearer_of PATO:0070010 ! stellate morphology [Term] id: CL:0000123 name: neuron associated cell (sensu Vertebrata) is_a: CL:0000095 ! neuron associated cell relationship: develops_from CL:0000333 ! migratory neural crest cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata [Term] id: CL:0000124 name: obsolete glial cell (sensu Nematoda and Protostomia) comment: This is a grouping class that is no longer needed or wanted. property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/715 xsd:string is_obsolete: true [Term] id: CL:0000125 name: glial cell def: "A non-neuronal cell of the nervous system. They not only provide physical support, but also respond to injury, regulate the ionic and chemical composition of the extracellular milieu. Guide neuronal migration during development, and exchange metabolites with neurons." [MESH:D009457] comment: Not all glial cells develop from glioblasts, with microglia developing from the mesoderm instead. See https://github.com/obophenotype/cell-ontology/issues/1571 synonym: "neuroglia" RELATED [] synonym: "neuroglial cell" EXACT [] xref: BTO:0002606 xref: CALOHA:TS-0415 xref: FBbt:00005144 xref: FMA:54536 is_a: CL:0000095 ! neuron associated cell [Term] id: CL:0000126 name: macroglial cell def: "A neuroglial cell of ectodermal origin, i.e., the astrocytes and oligodendrocytes considered together." [GOC:tfm, ISBN:0721662544] synonym: "macrogliocyte" EXACT [] xref: BTO:0000771 xref: CALOHA:TS-2027 xref: FMA:54538 is_a: CL:0000125 ! glial cell relationship: develops_from CL:0000339 ! glioblast (sensu Vertebrata) [Term] id: CL:0000127 name: astrocyte def: "A class of large neuroglial (macroglial) cells in the central nervous system - the largest and most numerous neuroglial cells in the brain and spinal cord. Astrocytes (from 'star' cells) are irregularly shaped with many long processes, including those with 'end feet' which form the glial (limiting) membrane and directly and indirectly contribute to the blood-brain barrier. They regulate the extracellular ionic and chemical environment, and 'reactive astrocytes' (along with microglia) respond to injury." [GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Astrocyte, MESH:D001253, PMID:11746784, PMID:12162730, PMID:12898703, PMID:20942978] comment: Astrocytes are reportedly CD68-negative, CD121a-positive, CD184-positive, CD192-positive, CRF-positive, EGFR-positive, GFAP-positive, GLUT1-positive, MBP-negative, and NGFR-positive. synonym: "astrocytic glia" EXACT [] xref: BTO:0000099 xref: CALOHA:TS-0060 xref: FMA:54537 is_a: CL:0000126 ! macroglial cell [Term] id: CL:0000128 name: oligodendrocyte def: "A class of large neuroglial (macroglial) cells in the central nervous system. Form the insulating myelin sheath of axons in the central nervous system." [http://en.wikipedia.org/wiki/Oligodendrocyte, MESH:D009836] comment: Oligodendrocytes are reportedly MDP-positive and CD4-negative. synonym: "oligodendroglia" RELATED [] synonym: "OLs" EXACT [PMID:8734446] xref: BTO:0000962 xref: CALOHA:TS-0709 xref: FMA:54540 is_a: CL:0000126 {is_inferred="true"} ! macroglial cell is_a: CL:4023154 ! myelinating glial cell relationship: develops_from CL:0002453 ! oligodendrocyte precursor cell relationship: part_of UBERON:0001017 ! central nervous system [Term] id: CL:0000129 name: microglial cell def: "A central nervous system macrophage found in the parenchyma of the central nervous system. Marker include CD11b-positive, F4/80-positive, and CD68-positive." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Microglia, ISBN:0721601464, MESH:D017628, PMID:11517395, PMID:12430718, PMID:14561199, PMID:14612429, PMID:16177057, PMID:19461673, PMID:2089275] comment: Unlike macroglial cells, microglial cells arise from hematopoietic stem cells in the yolk sac during early embryogenesis that populate the central nervous system. They derive from embryonic mesoderm and are not from neuroectoderm where glioblast develops from. Markers: Mouse: CD11b+, F4/80+, CD68+. They represent ~12% of the cells in the CNS, but they are not uniformly distributed within the CNS. A normal adult mouse brain has approximately 3.5x10e6 microglia. Microglia are also reportedly CD3-negative, CD4-positive, CD8-negative, CD11b-positive, CD11c-high, CD14-negative, CD19-negative, CD45-low, CD56-negative, CD163-negative, CD200R-positive, CD281-positive, CD282-positive, CD283-positive, CD284-positive, CD285-positive, CD286-positive, CD287-positive, CD288-positive, CD289-positive, Gr1-negative, nestin-positive, and PU.1-positive. {xref="PMID:23616747"} subset: human_reference_atlas synonym: "brain macrophage" BROAD [] synonym: "brain-resident macrophage" EXACT [] synonym: "hortega cells" EXACT [http://www.copewithcytokines.de/] synonym: "MF.microglia.CNS" RELATED [] synonym: "microglia" EXACT [] synonym: "microgliocyte" EXACT [http://www.copewithcytokines.de/] xref: BTO:0000078 xref: BTO:0000962 xref: FMA:54539 xref: FMA:54540 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000125 ! glial cell is_a: CL:0000878 ! central nervous system macrophage intersection_of: CL:0000125 ! glial cell intersection_of: capable_of GO:0045087 ! innate immune response intersection_of: part_of UBERON:0001017 ! central nervous system intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: capable_of GO:0045087 ! innate immune response relationship: develops_from CL:0000222 ! mesodermal cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin [Term] id: CL:0000130 name: neuron associated cell (sensu Nematoda and Protostomia) is_a: CL:0000095 ! neuron associated cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000131 name: gut endothelial cell is_a: CL:0000115 ! endothelial cell relationship: develops_from CL:0000223 ! endodermal cell [Term] id: CL:0000132 name: corneal endothelial cell def: "Cell of the single layer of large flattened cells covering the surface of the cornea." [GOC:tfm, MESH:A09.371.060.067.31] subset: human_reference_atlas xref: CALOHA:TS-0172 xref: FMA:70614 is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0000710 ! neurecto-epithelial cell relationship: develops_from CL:0000008 ! migratory cranial neural crest cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000133 name: neurectodermal cell def: "Ectoderm destined to be nervous tissue." [GOC:tfm, ISBN:068340007X] synonym: "neurectoderm cell" EXACT [] is_a: CL:0000221 ! ectodermal cell [Term] id: CL:0000134 name: mesenchymal stem cell alt_id: CL:0002452 def: "A connective tissue cell that normally gives rise to other cells that are organized as three-dimensional masses. In humans, this cell type is CD73-positive, CD90-positive, CD105-positive, CD45-negative, CD34-negative, and MHCII-negative. They may further differentiate into osteoblasts, adipocytes, myocytes, neurons, or chondroblasts in vitro. Originally described as residing in the bone marrow, this cell type is now known to reside in many, if not all, adult organs." [FB:ma, GOC:dsd, http://en.wikipedia.org/wiki/Mesenchymal_stem_cell, http://www.copewithcytokines.de/cope.cgi?key=mesenchymal%20stem%20cells, PMCID:PMC2613570, PMID:10102814, PMID:16923606, PMID:17986482, PMID:19960544] comment: Many but not all mesenchymal cells derive from the mesoderm. MSCs are reportedly CD3-negative, CD4-negative, CD5-negative, CD8-negative, CD11a-negative, CD11b-negative, CD14-negative, CD19-negative, CD29-positive, CD31-negative, CD34-negative, CD38-negative, CD40-negative, CD44-positive, CD45-negative, CD49-positive, CD54-positive, CD66b-negative, CD79a-negative, CD80-negative, CD102-positive, CD106-positive, CD117-positive, CD121a-positive, CD121b-positive, CD123-positive, CD124-positive, CD133-negative, CD146-positive, CD166-positive, CD271-positive, B220-negative, Gr1-negative, MHCI-positive, MHCII-negative, SSEA4-negative, sca1-positive, Ter119-negative, and glycophorin A-negative. Cultured MSCs are capable of producing stem cell factor, IL7, IL8, IL11, TGF-beta, cofilin, galectin-1, laminin-receptor 1, cyclophilin A, and MMP-2. synonym: "BMSC" NARROW [] synonym: "bone marrow stromal cells" NARROW [] synonym: "CFU-F" RELATED [] synonym: "colony-forming unit-fibroblast" NARROW [] synonym: "marrow stromal cells" NARROW [PMID:11378515] synonym: "mesenchymal precursor cell" RELATED [] synonym: "mesenchymal progenitor cells" RELATED PLURAL [MESH:D044982] synonym: "mesenchymal stem cell" RELATED [] synonym: "mesenchymal stromal cell" RELATED [] synonym: "mesenchymal stromal cells" RELATED PLURAL [] synonym: "MSC" RELATED [PMID:11378515] synonym: "stem cells, mesenchymal" RELATED PLURAL [MESH:D044982] xref: BTO:0002625 xref: BTO:0003298 xref: FMA:70546 is_a: CL:0000048 ! multi fate stem cell is_a: CL:0002320 {is_inferred="true"} ! connective tissue cell property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/474 xsd:string [Term] id: CL:0000135 name: fibrocyte def: "An inactive fibroblast; cytoplasm is sparse, endoplasmic reticulum is scanty with flattened nucleus. Term used by some histologists; when fibroblasts become relatively inactive in fiber formation. However, this cell has the potential for fibrogenesis in quiescent connective tissue of the adult, as well as during development, other histologists prefer to use the term fibroblast in all circumstances. These cells represent ~0.5% of peripheral blood leukocytes." [GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Fibrocyte, ISBN:0412046911, ISBN:0517223651, PMID:11641248, PMID:15010326, PMID:17607298, PMID:18222966, PMID:8790603, PMID:9551999] comment: Cultured human fibrocytes are MHCI-positive, MHCII-positive, CD1a-negative, CD3-negative, CD4-negative, CD8-negative, CD10-negative, CD11b-positive, CD13-positive, CD14-negative, CD16-negative, CD18-positive, CD19-negative, CD25-negative, CD29-positive, CD32-positive, CD33-negative, CD34-positive, CD38-negative, CD40-positive, CD44-negative, CD45RO-positive, CD49a-positive, CD49b-positive, CD49c-negative, CD49d-negative, CD49e-positive, CD49f-negative, CD56-negative, CD58-positive, CD61-positive, CD64-positive, CD70-negative, CD71-positive, CD80-positive, CD83-negative, CD86-positive, CD103-negative, CD105-positive, CD181-positive, CD182-negative, CD183-positive, CD184-positive, CD185-negative, CD186-negative, CD191-positive, CD192-negative, CD193-positive, CD194-positive, CD195-positive, CD196-negative, CD197-positive, CD199-positive, desmin-negative, F4/80-positive, Gr1-positive, LSP-1-positive, MHCI-positive, MHCII-positive, alpha-SMA-negative, TCRab-negative, TCRgd-negative, and vimentin-positive. Fibrocytes are also capable of secreting angiogenin, bFGF, CCL2, CCL3, CCL4, CCL8, CXCL1, type I collagen, type III collagen, CTGF, fibronectin, GM-CSF, IL-1a, IL-6, IL-8, IL-10, M-CSF, MMP-9, PDGF-A, TGF-alpha, TGF-beta1, TNF-alpha, and VEGF-A. xref: FMA:63879 is_a: BFO:0000040 ! material entity is_a: CL:0000499 {is_inferred="true"} ! stromal cell intersection_of: CL:0000499 ! stromal cell intersection_of: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II intersection_of: capable_of GO:0045766 ! positive regulation of angiogenesis relationship: capable_of GO:0002495 ! antigen processing and presentation of peptide antigen via MHC class II relationship: capable_of GO:0045766 ! positive regulation of angiogenesis relationship: develops_from CL:0000057 ! fibroblast [Term] id: CL:0000136 name: fat cell alt_id: CL:0000450 def: "A fat-storing cell found mostly in the abdominal cavity and subcutaneous tissue of mammals. Fat is usually stored in the form of triglycerides." [MESH:D017667] subset: human_reference_atlas synonym: "adipocyte" EXACT [] synonym: "adipose cell" EXACT [] xref: BTO:0000443 xref: CALOHA:TS-0012 xref: FMA:63880 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000325 ! stuff accumulating cell is_a: CL:0002320 ! connective tissue cell relationship: develops_from CL:0000134 ! mesenchymal stem cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000137 name: osteocyte def: "A mature osteoblast that has become embedded in the bone matrix. They occupy a small cavity, called lacuna, in the matrix and are connected to adjacent osteocytes via protoplasmic projections called canaliculi." [GOC:tfm, MESH:D010011] comment: VSAO relationship simplified OBO_REL:integral_part_of VSAO:0000118 subset: human_reference_atlas synonym: "bone cell" BROAD [] xref: BTO:0002038 xref: CALOHA:TS-1167 xref: FMA:66779 xref: VSAO:0000124 is_a: CARO:0000000 ! anatomical entity is_a: CL:0001035 ! bone cell relationship: develops_from CL:0001040 ! non-terminally differentiated osteoblast relationship: part_of UBERON:0002481 ! bone tissue relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000138 name: chondrocyte def: "Skeletogenic cell that is terminally differentiated, secretes an avascular, GAG-rich matrix, is embedded in cartilage tissue matrix, retains the ability to divide, and develops from a chondroblast cell." [GO_REF:0000034, MESH:D019902] synonym: "cartilage cell" EXACT [] xref: BTO:0000249 xref: CALOHA:TS-0138 xref: FMA:66782 is_a: CL:0000153 ! glycosaminoglycan secreting cell is_a: CL:0000667 ! collagen secreting cell relationship: develops_from CL:0000058 ! chondroblast relationship: located_in UBERON:0002418 ! cartilage tissue [Term] id: CL:0000140 name: odontocyte def: "Skeletogenic cell that secretes dentine matrix, is derived from odontogenic papilla. Embedded in dentine tissue, and is the transformation of a non-terminally differentiated odontoblast cell." [GO_REF:0000034] is_a: BFO:0000040 ! material entity is_a: CARO:0000000 ! anatomical entity is_a: CL:0002320 ! connective tissue cell relationship: develops_from CL:0000060 ! odontoblast relationship: develops_from CL:0000134 ! mesenchymal stem cell relationship: produces UBERON:0001751 ! dentine [Term] id: CL:0000141 name: cementocyte def: "An osteocytelike cell with numerous processes, trapped in a lacuna in the cement of the tooth." [ISBN:0781733901] comment: CHECK: wikipedia says that cementocytes no longer produce cementum, but the phenoscape def is: Skeletogenic cell that produces cementum, is part of the odontogenic papilla, and is a transformation of a cementoblast cell (no change to existing def). xref: FMA:63003 is_a: CL:0000137 ! osteocyte relationship: develops_from CL:0000061 ! cementoblast relationship: part_of UBERON:0005176 ! tooth enamel organ [Term] id: CL:0000142 name: hyalocyte def: "A cell occurring in the peripheral part of the vitreous body of the eye that may be responsible for production of hyaluronic acid and collagen." [GOC:tfm, PMID:19073178] synonym: "vitreous cell" RELATED [] xref: BTO:0004271 xref: FMA:70620 is_a: CL:0000499 ! stromal cell [Term] id: CL:0000143 name: guidepost cell is_a: CL:0000130 ! neuron associated cell (sensu Nematoda and Protostomia) [Term] id: CL:0000144 name: obsolete cell by function def: "OBSOLETE: A classification of cells by their primary end goal or behavior." [FB:ma] comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its function or behavior. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000145 name: professional antigen presenting cell def: "A cell capable of processing and presenting lipid and protein antigens to T cells in order to initiate an immune response." [GOC:add, ISBN:0781735149] comment: Note change of name; nearly all somatic cells can present antigens to T cells via MHC Class I complexes leading to effector responses, but professional antigen presenting cells constitutively express MHC Class II as well as costimulatory molecules, and thus can initiate immune responses via T cells. synonym: "APC" BROAD [] is_a: CL:0000738 ! leukocyte intersection_of: CL:0000738 ! leukocyte intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II relationship: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [Term] id: CL:0000146 name: simple columnar epithelial cell subset: human_reference_atlas is_a: CL:0000075 ! columnar/cuboidal epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000147 name: pigment cell def: "A pigment cell is a cell that contains pigment granules." [GOC:tfm] synonym: "chromatocyte" EXACT [] synonym: "chromatophore" EXACT [] xref: VHOG:0001678 is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000148 name: melanocyte alt_id: CL:0000572 def: "A pigment cell derived from the neural crest. Contains melanin-filled pigment granules, which gives a brown to black appearance." [SANBI:mhl] subset: human_reference_atlas synonym: "melanophore" NARROW [] xref: BTO:0000847 xref: CALOHA:TS-0613 xref: FMA:70545 xref: MESH:D008544 xref: VHOG:0001679 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 {is_inferred="true"} ! pigment cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000147 ! pigment cell intersection_of: develops_from CL:0000541 ! melanoblast intersection_of: has_part GO:0042470 ! melanosome relationship: develops_from CL:0000541 ! melanoblast relationship: has_part GO:0042470 ! melanosome relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000149 name: visual pigment cell synonym: "pigment cell" BROAD [] is_a: CL:0000147 ! pigment cell [Term] id: CL:0000150 name: glandular epithelial cell def: "A specialized epithelial cell that is capable of synthesizing and secreting certain biomolecules." [GOC:tfm] xref: CALOHA:TS-2085 xref: FMA:86494 is_a: CL:0000066 ! epithelial cell is_a: CL:0000151 ! secretory cell is_a: CL:0002371 ! somatic cell relationship: part_of UBERON:0006799 ! glandular epithelium [Term] id: CL:0000151 name: secretory cell def: "A cell that specializes in controlled release of one or more substances." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas xref: BTO:0003659 xref: FMA:86916 is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0032940 ! secretion by cell relationship: capable_of GO:0032940 ! secretion by cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000152 name: exocrine cell def: "A cell of an exocrine gland; i.e. a gland that discharges its secretion via a duct." [ISBN:0198547684] xref: FMA:16014 is_a: CL:0000151 ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: part_of UBERON:0002365 ! exocrine gland relationship: part_of UBERON:0002365 ! exocrine gland [Term] id: CL:0000153 name: glycosaminoglycan secreting cell def: "A cell that secretes glycosaminoglycans." [GOC:tfm] synonym: "GAG secreting cell" EXACT [] synonym: "hyaluronic acid secreting cell" NARROW [] is_a: CL:0000327 ! extracellular matrix secreting cell is_a: CL:0000447 ! carbohydrate secreting cell [Term] id: CL:0000154 name: protein secreting cell is_a: CL:0000151 ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0009306 ! protein secretion relationship: capable_of GO:0009306 ! protein secretion [Term] id: CL:0000155 name: peptic cell def: "A cell that is usually basal in position, cuboidal with round nucleus, short microvilli, secretes pepsinogen." [GOC:tfm] synonym: "chief cell of stomach" EXACT [] synonym: "gastric chief cell" EXACT [] synonym: "pepsinogen secreting cell" EXACT [] synonym: "zymogenic cell" EXACT [] xref: FMA:62902 is_a: CL:0000154 ! protein secreting cell is_a: CL:0002659 ! glandular cell of stomach [Term] id: CL:0000156 name: obsolete antibody secreting cell def: "OBSOLETE: A cell of the lymphoid series that can react with antigen to produce specific cell products called antibodies. Various cell subpopulations, often B cells, can be defined, based on the different classes of immunoglobulins that they synthesize." [] comment: Consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000157 name: surfactant secreting cell def: "A cell that specializes in secretion of surfactant in the alveoli of the lung." [GOC:tfm, ISBN:0721662544] is_a: CL:0000151 {is_inferred="true"} ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0043129 ! surfactant homeostasis relationship: capable_of GO:0043129 ! surfactant homeostasis [Term] id: CL:0000158 name: club cell def: "Epithelial progenitor cell of the lung. Club cells are dome-shaped with short microvilli but no cilia. They function to protect the bronchiolar epithelium. Club cells also multiply and differentiate into ciliated cells to regenerate the bronchiolar epithelium." [DOI:10.1183/09031936.00146609, DOI:https\://doi.org/10.1378/chest.12-2762, GOC:tfm, PMID:28128362, PMID:7905712] subset: human_reference_atlas synonym: "bronchiolar non-ciliated cell" EXACT [] synonym: "Clara cell" EXACT [] synonym: "club cell of bronchiole" EXACT [] xref: BTO:0004811 xref: FMA:14119 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000157 ! surfactant secreting cell is_a: CL:0002328 {is_inferred="true"} ! bronchial epithelial cell intersection_of: CL:0002328 ! bronchial epithelial cell intersection_of: bearer_of PATO:0001789 ! domed intersection_of: capable_of GO:0032940 ! secretion by cell intersection_of: capable_of GO:0043129 ! surfactant homeostasis intersection_of: RO:0002104 GO:0005902 ! has plasma membrane part microvillus relationship: bearer_of PATO:0001789 ! domed relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0005902 ! has plasma membrane part microvillus [Term] id: CL:0000159 name: seromucus secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000160 name: goblet cell def: "A cell of the epithelial lining that produce and secrete mucins." [MESH:D020397] synonym: "chalice cell" EXACT [] xref: BTO:0001540 xref: FMA:13148 xref: http://en.wikipedia.org/wiki/Goblet_cell is_a: CL:0000150 ! glandular epithelial cell is_a: CL:0000319 ! mucus secreting cell [Term] id: CL:0000161 name: acid secreting cell is_a: CL:0000151 {is_inferred="true"} ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0046717 ! acid secretion relationship: capable_of GO:0046717 ! acid secretion [Term] id: CL:0000162 name: parietal cell def: "A large, oval stomach epithelial cell with a central nucleus; source of gastric acid. Secretes HCl." [GOC:tfm, ISBN:0517223651] synonym: "oxyntic cell" EXACT [] xref: BTO:0001780 xref: FMA:62901 is_a: CL:0000161 ! acid secreting cell is_a: CL:0002659 ! glandular cell of stomach [Term] id: CL:0000163 name: endocrine cell def: "A cell of an endocrine gland, ductless glands that secrete substances which are released directly into the circulation and which influence metabolism and other body functions." [MESH:D055098] subset: human_reference_atlas synonym: "endocrinocyte" EXACT [] xref: FMA:83809 is_a: CL:0000151 ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0060986 ! endocrine hormone secretion relationship: capable_of GO:0060986 ! endocrine hormone secretion relationship: part_of UBERON:0002368 ! endocrine gland relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000164 name: enteroendocrine cell def: "An endocrine cell that is located in the epithelium of the gastrointestinal tract or in the pancreas." [GOC:tfm, SANBI:mhl] xref: BTO:0003865 xref: FMA:62930 xref: MESH:D019858 is_a: CL:0000150 ! glandular epithelial cell is_a: CL:0000163 ! endocrine cell [Term] id: CL:0000165 name: neuroendocrine cell def: "An endocrine cell that has the specialized function to produce and secrete hormones in response to neuronal signals." [MESH:D055099] subset: human_reference_atlas synonym: "neurosecretory cell" EXACT [] xref: BTO:0002691 xref: FMA:83810 is_a: CL:0000163 ! endocrine cell is_a: CL:0000393 ! electrically responsive cell is_a: CL:0000710 ! neurecto-epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000166 name: chromaffin cell def: "A cell that stores epinephrine secretory vesicles. During times of stress, the nervous system signals the vesicles to secrete their hormonal content. Their name derives from their ability to stain a brownish color with chromic salts. Characteristically, they are located in the adrenal medulla and paraganglia of the sympathetic nervous system." [MESH:D019439] synonym: "phaeochromocyte" EXACT [] xref: BTO:0000259 xref: FMA:69263 is_a: CL:0000568 ! amine precursor uptake and decarboxylation cell relationship: develops_from CL:0000333 ! migratory neural crest cell [Term] id: CL:0000167 name: peptide hormone secreting cell is_a: CL:0000151 ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0030072 ! peptide hormone secretion relationship: capable_of GO:0030072 ! peptide hormone secretion [Term] id: CL:0000168 name: insulin secreting cell xref: BTO:0000783 is_a: CL:0000154 ! protein secreting cell is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0030073 ! insulin secretion relationship: capable_of GO:0030073 ! insulin secretion [Term] id: CL:0000169 name: type B pancreatic cell def: "A cell that secretes insulin and is located towards the center of the islets of Langerhans." [GOC:tfm, http://en.wikipedia.org/wiki/Pancreatic_b_cell, ISBN:0517223651] comment: Pancreatic beta cells are also reportedly CD284-positive. Upon activation, they upregulate their CD14 expression. subset: human_reference_atlas synonym: "B-cell of pancreatic islet" EXACT [FMA:70586] synonym: "beta cell" BROAD [ZFA:0009102] synonym: "beta cell islet" RELATED [MA:0002419] synonym: "beta cell of pancreatic islet" EXACT [FMA:70586] synonym: "insulin-secreting cell" EXACT [FMA:70586] synonym: "pancreatic B cell" EXACT [] synonym: "pancreatic B-cell" EXACT [FMA:70586] synonym: "pancreatic beta cell" EXACT [FMA:70586] synonym: "pancreatic islet core" EXACT [MA:0002419] synonym: "type B enteroendocrine cell" EXACT [FMA:70586] xref: BTO:0000783 xref: EV:0200009 xref: FMA:70586 xref: MA:0002419 xref: ncithesaurus:Beta_Cell is_a: CL:0000083 ! epithelial cell of pancreas is_a: CL:0000164 {is_inferred="true"} ! enteroendocrine cell is_a: CL:0000168 {is_inferred="true"} ! insulin secreting cell is_a: CL:0008024 ! pancreatic endocrine cell intersection_of: CL:0000164 ! enteroendocrine cell intersection_of: capable_of GO:0030073 ! insulin secretion intersection_of: part_of UBERON:0000006 ! islet of Langerhans relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas relationship: part_of UBERON:0000006 ! islet of Langerhans relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000170 name: glucagon secreting cell def: "A cell that secretes glucagon." [GOC:tfm] synonym: "glucagon-secreting cell" EXACT [] xref: FMA:84045 is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0070091 ! glucagon secretion relationship: capable_of GO:0070091 ! glucagon secretion [Term] id: CL:0000171 name: pancreatic A cell def: "A type of enteocrine cell found in the periphery of the islets of Langerhans that secretes glucagon." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas synonym: "alpha cell of islet of Langerhans" EXACT [] synonym: "pancreatic alpha cell" EXACT [] xref: BTO:0000990 xref: FMA:70585 xref: MESH:D050416 is_a: CL:0000083 ! epithelial cell of pancreas is_a: CL:0002067 ! type A enteroendocrine cell is_a: CL:0008024 ! pancreatic endocrine cell intersection_of: CL:0002067 ! type A enteroendocrine cell intersection_of: part_of UBERON:0001264 ! pancreas relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas relationship: part_of UBERON:0000006 ! islet of Langerhans relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000172 name: somatostatin secreting cell is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0070253 ! somatostatin secretion relationship: capable_of GO:0070253 ! somatostatin secretion [Term] id: CL:0000173 name: pancreatic D cell def: "A D cell located in the pancreas. Peripherally placed within the islets like type A cells; contains somatostatin." [FMA:0517223651, GOC:tfm] subset: human_reference_atlas synonym: "D-cell of pancreatic islet" EXACT [] synonym: "delta cell of islet" EXACT [] synonym: "delta cell of pancreatic islet" EXACT [] synonym: "pancreatic D-cell" EXACT [] synonym: "pancreatic delta cell" EXACT [] synonym: "somatostatin-secreting pancreatic cell" EXACT [] xref: BTO:0000803 xref: FMA:70587 is_a: CL:0000083 ! epithelial cell of pancreas is_a: CL:0000502 ! type D enteroendocrine cell is_a: CL:0008024 ! pancreatic endocrine cell intersection_of: CL:0000502 ! type D enteroendocrine cell intersection_of: part_of UBERON:0001264 ! pancreas relationship: develops_from CL:0002351 ! progenitor cell of endocrine pancreas relationship: part_of UBERON:0000006 ! islet of Langerhans relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000174 name: steroid hormone secreting cell is_a: CL:0000163 ! endocrine cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035929 ! steroid hormone secretion relationship: capable_of GO:0035929 ! steroid hormone secretion [Term] id: CL:0000175 name: luteal cell def: "A progesterone secreting cell in the corpus luteum. The large luteal cells develop from the granulosa cells. The small luteal cells develop from the theca cells." [MESH:D008184] subset: human_reference_atlas synonym: "lutein cell" EXACT [] xref: BTO:0003939 xref: FMA:18688 is_a: CL:0000179 ! progesterone secreting cell is_a: CL:0002132 ! stromal cell of ovary relationship: part_of UBERON:0002512 ! corpus luteum relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000176 name: ecdysteroid secreting cell is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0045457 ! ecdysteroid secretion relationship: capable_of GO:0045457 ! ecdysteroid secretion [Term] id: CL:0000177 name: testosterone secreting cell is_a: CL:0000151 ! secretory cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035936 ! testosterone secretion relationship: capable_of GO:0035936 ! testosterone secretion [Term] id: CL:0000178 name: Leydig cell def: "A Leydig cell is a testosterone-secreting cell in the interstitial area, between the seminiferous tubules, in the testis." [GOC:tfm, PMID:12050120] comment: Note that the Amphibian Anatomy Ontology (AA) has a class 'leydig cells' but this is unrelated synonym: "interstitial cell" BROAD [] synonym: "interstitial cell of Leydig" EXACT [] xref: BTO:0000755 xref: CALOHA:TS-1150 xref: EMAPA:29655 xref: FMA:72297 xref: MESH:D007985 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000177 ! testosterone secreting cell relationship: develops_from CL:0009091 ! Leydig stem cell relationship: part_of UBERON:0005212 ! Leydig cell region of testis [Term] id: CL:0000179 name: progesterone secreting cell is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0042701 ! progesterone secretion relationship: capable_of GO:0042701 ! progesterone secretion [Term] id: CL:0000180 name: estradiol secreting cell def: "A steroid hormone secreting cell that secretes estradiol." [https://orcid.org/0000-0001-5208-3432] is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035938 ! estradiol secretion relationship: capable_of GO:0035938 ! estradiol secretion [Term] id: CL:0000181 name: obsolete metabolising cell def: "A cell whose primary function is intermediary metabolism." [FB:ma] comment: Removing this grouping class, because the groupings are incomplete and too hard to maintain. property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/720 xsd:string is_obsolete: true [Term] id: CL:0000182 name: hepatocyte def: "The main structural component of the liver. They are specialized epithelial cells that are organized into interconnected plates called lobules. Majority of cell population of liver, polygonal in shape, arranged in plates or trabeculae between sinusoids; may have single nucleus or binucleated." [GOC:tfm, http://en.wikipedia.org/wiki/Hepatocyte, ISBN:0412046911, MESH:D022781, PMID:19717280] comment: Hepatocytes are reportedly MHC Class I-positive and MHC Class II-positive. subset: human_reference_atlas xref: BTO:0000575 xref: CALOHA:TS-0454 xref: FMA:14515 is_a: BFO:0000040 ! material entity is_a: CARO:0000000 ! anatomical entity is_a: CL:0000066 ! epithelial cell is_a: CL:0000417 ! endopolyploid cell is_a: CL:0002371 ! somatic cell relationship: capable_of GO:0006699 ! bile acid biosynthetic process relationship: capable_of GO:0098754 ! detoxification relationship: develops_from CL:0005026 ! hepatoblast relationship: part_of UBERON:0002107 ! liver relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000183 name: contractile cell def: "A cell whose primary function is to shorten." [FB:ma] is_a: CL:0000003 ! native cell [Term] id: CL:0000185 name: myoepithelial cell def: "Contractile cells resembling smooth muscle cells that are present in glands, notably the mammary gland, and aid in secretion. This cell has long weaving dendritic processes containing myofilament." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas synonym: "basket epithelial cell" EXACT [] synonym: "myoepitheliocyte" EXACT [] xref: BTO:0002309 xref: CALOHA:TS-2379 xref: FMA:67799 is_a: CL:0000075 ! columnar/cuboidal epithelial cell is_a: CL:0000183 ! contractile cell is_a: CL:0002078 ! meso-epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000186 name: myofibroblast cell def: "An animal cell that has characteristics of both a fibroblast cell and a smooth muscle cell." [GOC:dsd, GOC:tfm, MESH:D058628, PMID:19800625, PMID:20630469] comment: Myofibroblasts are alpha-SMA-positive, CD34-negative, CD45-negative. They are reportedly capable of secreting IL-1beta, IL-6, and TNF-alpha. subset: human_reference_atlas synonym: "MFB" EXACT [PMID:8731193] is_a: CL:0000183 ! contractile cell is_a: CL:0000548 ! animal cell is_a: CL:0002371 ! somatic cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000187 name: muscle cell def: "A mature contractile cell, commonly known as a myocyte. This cell has as part of its cytoplasm myofibrils organized in various patterns." [MESH:D032342] synonym: "muscle fiber" EXACT [] synonym: "myocyte" EXACT [] xref: BTO:0000888 xref: BTO:0000902 xref: CALOHA:TS-2032 xref: FBbt:00005074 xref: FMA:67328 xref: WBbt:0003675 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000183 ! contractile cell is_a: CL:0000393 ! electrically responsive cell is_a: CL:0000548 ! animal cell is_a: CL:0002371 ! somatic cell relationship: develops_from CL:0000056 ! myoblast [Term] id: CL:0000188 name: cell of skeletal muscle def: "A somatic cell located in skeletal muscle." [GOC:tfm] subset: human_reference_atlas synonym: "skeletal muscle cell" EXACT [] xref: BTO:0004392 xref: CALOHA:TS-2158 xref: FMA:9727 is_a: BFO:0000004 ! independent continuant is_a: CL:0002371 ! somatic cell intersection_of: CL:0002371 ! somatic cell intersection_of: part_of UBERON:0001134 ! skeletal muscle tissue relationship: part_of UBERON:0001134 ! skeletal muscle tissue relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000189 name: slow muscle cell def: "A muscle cell that develops tension more slowly than a fast-twitch fiber." [GOC:tfm, ISBN:0323052908] synonym: "slow muscle fiber" RELATED [ISBN:0815316208] xref: FMA:84448 is_a: CL:0008046 ! extrafusal muscle fiber relationship: develops_from CL:0000857 ! slow muscle myoblast [Term] id: CL:0000190 name: fast muscle cell def: "A muscle cell that can develop high tension rapidly. It is usually innervated by a single alpha neuron." [GOC:tfm, ISBN:0323052908] synonym: "glycolytic muscle fiber" EXACT [] is_a: CL:0008046 ! extrafusal muscle fiber relationship: develops_from CL:0000858 ! fast muscle myoblast [Term] id: CL:0000192 name: smooth muscle cell alt_id: CL:0000191 def: "A non-striated, elongated, spindle-shaped cell found lining the digestive tract, uterus, and blood vessels. They develop from specialized myoblasts (smooth muscle myoblast)." [http://en.wikipedia.org/wiki/Smooth_muscle_cell, MESH:D032389, PMID:9315361] subset: human_reference_atlas synonym: "myocytes, smooth muscle" EXACT [MESH:D032389] synonym: "non-striated muscle cell" BROAD [] synonym: "SMCs" EXACT [PMID:9315361] synonym: "smooth muscle fiber" EXACT [] xref: BTO:0004576 xref: CALOHA:TS-2159 xref: FMA:14072 is_a: CL:0008000 ! non-striated muscle cell is_a: CL:0008007 ! visceral muscle cell relationship: develops_from CL:0000514 ! smooth muscle myoblast relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000193 name: cardiac muscle cell (sensu Arthopoda) alt_id: CL:0000466 def: "A striated muscle cell of an arthropod heart that participates in heart contraction." [MESH:D032383] is_a: CL:0000746 ! cardiac muscle cell intersection_of: CL:0000746 ! cardiac muscle cell intersection_of: develops_from CL:0000465 ! cardioblast (sensu Arthropoda) relationship: develops_from CL:0000465 ! cardioblast (sensu Arthropoda) [Term] id: CL:0000194 name: obsolete nodal cardiac cell comment: Consider CL:0002072. is_obsolete: true [Term] id: CL:0000195 name: obsolete Purkinje fiber is_obsolete: true [Term] id: CL:0000196 name: flight muscle cell is_a: CL:0008003 ! somatic muscle myotube [Term] id: CL:0000197 name: sensory receptor cell def: "A cell that is capable of detection of a stimulus involved in sensory perception." [] synonym: "receptor cell" EXACT [] xref: MESH:D011984 is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell intersection_of: CL:0000000 ! cell intersection_of: capable_of GO:0050906 ! detection of stimulus involved in sensory perception intersection_of: part_of UBERON:0001032 ! sensory system relationship: capable_of GO:0050906 ! detection of stimulus involved in sensory perception relationship: part_of UBERON:0001032 ! sensory system [Term] id: CL:0000198 name: pain receptor cell def: "The peripheral receptor for pain. Includes receptors which are sensitive to painful mechanical stimuli, extreme heat or cold, and chemical stimuli. All mammalian nociceptors are free nerve endings." [MESH:D009619] comment: Editor note: request detection of stimulus involved in sensory perception of pain; add develops_from relationship synonym: "nociceptor" EXACT [] synonym: "nocireceptor" EXACT [] is_a: CL:0000006 ! neuronal receptor cell [Term] id: CL:0000199 name: mechanoreceptor cell def: "A cell specialized to transduce mechanical stimuli and relay that information centrally in the nervous system." [MESH:D008465] synonym: "mechanoreceptor" RELATED [MP:0000972] is_a: CL:0000101 ! sensory neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050974 ! detection of mechanical stimulus involved in sensory perception relationship: capable_of GO:0050974 ! detection of mechanical stimulus involved in sensory perception [Term] id: CL:0000200 name: touch receptor cell is_a: CL:0000199 ! mechanoreceptor cell intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050976 ! detection of mechanical stimulus involved in sensory perception of touch relationship: capable_of GO:0050976 ! detection of mechanical stimulus involved in sensory perception of touch [Term] id: CL:0000202 name: auditory hair cell alt_id: CL:0000201 def: "A mechanoreceptor cell of the auditory or vestibular system that is sensitive to auditory stimuli. The accessory sensory structures are arranged so that appropriate stimuli cause movement of the hair-like projections (stereocilia and kinocilia) which relay the information centrally in the nervous system." [MESH:D006198, WikipediaVersioned:Hair_cell&oldid=1045345915] comment: In mammals these cells are located in the organ of Corti. synonym: "auditory receptor cell" RELATED [] xref: FMA:62364 is_a: CL:0000855 ! sensory hair cell relationship: capable_of GO:0050910 ! detection of mechanical stimulus involved in sensory perception of sound [Term] id: CL:0000203 name: gravity sensitive cell is_a: CL:0000006 ! neuronal receptor cell is_a: CL:0000199 ! mechanoreceptor cell intersection_of: CL:0000006 ! neuronal receptor cell intersection_of: capable_of GO:0070999 ! detection of mechanical stimulus involved in sensory perception of gravity relationship: capable_of GO:0070999 ! detection of mechanical stimulus involved in sensory perception of gravity [Term] id: CL:0000204 name: acceleration receptive cell is_a: CL:0000006 ! neuronal receptor cell [Term] id: CL:0000205 name: thermoreceptor cell def: "A cellular receptor which mediates the sense of temperature. Thermoreceptor cells in vertebrates are mostly located under the skin. In mammals there are separate types of thermoreceptors for cold and for warmth and pain receptor cells which detect cold or heat extreme enough to cause pain." [GOC:tfm, MESH:D013823, MP:0000971] is_a: CL:0000006 ! neuronal receptor cell intersection_of: CL:0000006 ! neuronal receptor cell intersection_of: capable_of GO:0050960 ! detection of temperature stimulus involved in thermoception relationship: capable_of GO:0050960 ! detection of temperature stimulus involved in thermoception [Term] id: CL:0000206 name: chemoreceptor cell def: "A cell specialized to detect chemical substances and relay that information centrally in the nervous system. Chemoreceptors may monitor external stimuli, as in taste and olfaction, or internal stimuli, such as the concentrations of oxygen and carbon dioxide in the blood." [MESH:D002628] is_a: CL:0000101 ! sensory neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050907 ! detection of chemical stimulus involved in sensory perception relationship: capable_of GO:0050907 ! detection of chemical stimulus involved in sensory perception [Term] id: CL:0000207 name: olfactory receptor cell synonym: "odorant receptor cell" EXACT [] synonym: "olfactory receptor neuron" EXACT [] synonym: "olfactory sensory neuron" EXACT [] synonym: "Schultze's cell" EXACT [] xref: BTO:0004185 xref: FMA:67860 xref: MESH:D018034 xref: Wikipedia:Olfactory_receptor_neuron is_a: CL:0000006 ! neuronal receptor cell is_a: CL:0000206 ! chemoreceptor cell intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050911 ! detection of chemical stimulus involved in sensory perception of smell relationship: capable_of GO:0050911 ! detection of chemical stimulus involved in sensory perception of smell relationship: part_of UBERON:0005725 ! olfactory system [Term] id: CL:0000208 name: pH receptor cell is_a: CL:0000206 ! chemoreceptor cell [Term] id: CL:0000209 name: taste receptor cell def: "A cell type found in the spherical or ovoid clusters of receptor cells found mainly in the epithelium of the tongue and constituting the end organs of the sense of taste." [GOC:tfm, ISBN:0618947256] synonym: "taste bud cell" EXACT [] xref: FMA:67910 is_a: CL:0000006 ! neuronal receptor cell is_a: CL:0000098 ! sensory epithelial cell is_a: CL:0000206 ! chemoreceptor cell is_a: CL:0000362 ! epidermal cell is_a: CL:0002076 ! endo-epithelial cell intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050912 ! detection of chemical stimulus involved in sensory perception of taste relationship: capable_of GO:0050912 ! detection of chemical stimulus involved in sensory perception of taste relationship: part_of UBERON:0002025 ! stratum basale of epidermis [Term] id: CL:0000210 name: photoreceptor cell def: "A cell specialized to detect and transduce light." [MESH:D010786] xref: BTO:0001060 xref: CALOHA:TS-0868 xref: FMA:86740 is_a: CL:0000006 {is_inferred="true"} ! neuronal receptor cell intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0050962 ! detection of light stimulus involved in sensory perception relationship: capable_of GO:0050962 ! detection of light stimulus involved in sensory perception [Term] id: CL:0000211 name: electrically active cell def: "A cell whose function is determined by the generation or the reception of an electric signal." [FB:ma] is_a: CL:0000003 ! native cell [Term] id: CL:0000212 name: absorptive cell def: "A cell that takes up and metabolizes substances." [CL:CVS] subset: human_reference_atlas is_a: CL:0000003 ! native cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000213 name: lining cell def: "A cell within an epithelial cell sheet whose main function is to act as an internal or external covering for a tissue or an organism." [JB:jb] synonym: "boundary cell" EXACT [] is_a: CL:0000215 ! barrier cell [Term] id: CL:0000214 name: synovial cell def: "A cell located in the synovial joint." [] synonym: "synoviocyte" EXACT [] xref: CALOHA:TS-0995 is_a: CL:0000213 ! lining cell is_a: CL:0002078 {is_inferred="true"} ! meso-epithelial cell relationship: part_of UBERON:0002217 ! synovial joint [Term] id: CL:0000215 name: barrier cell def: "A cell whose primary function is to prevent the transport of stuff across compartments." [JB:jb] is_a: CL:0000003 ! native cell [Term] id: CL:0000216 name: Sertoli cell def: "A supporting cell projecting inward from the basement membrane of seminiferous tubules. They surround and nourish the developing male germ cells and secrete androgen binding protein. Their tight junctions with the spermatogonia and spermatocytes provide a blood-testis barrier." [MESH:D012708] xref: BTO:0001238 xref: CALOHA:TS-0922 xref: FMA:72298 xref: VHOG:0001348 is_a: CL:0000511 ! androgen binding protein secreting cell is_a: CL:0000630 {is_inferred="true"} ! supporting cell is_a: CL:0002625 ! seminiferous tubule epithelial cell intersection_of: CL:0000630 ! supporting cell intersection_of: part_of UBERON:0001343 ! seminiferous tubule of testis [Term] id: CL:0000217 name: insulating cell is_a: CL:0000215 ! barrier cell [Term] id: CL:0000218 name: myelinating Schwann cell def: "A neuroglial cell of the peripheral nervous system which forms the insulating myelin sheaths of peripheral axons." [GOC:cvs, GOC:tfm, MESH:D012583] synonym: "neurilemmal cell" EXACT [] synonym: "peripheral neuroglial cell" BROAD [] synonym: "Schwann cell" BROAD [] xref: CALOHA:TS-0898 xref: FMA:62121 is_a: CL:0000217 ! insulating cell is_a: CL:0002573 ! Schwann cell is_a: CL:4023154 ! myelinating glial cell relationship: develops_from CL:0002377 ! immature Schwann cell [Term] id: CL:0000219 name: motile cell def: "A cell that moves by its own activities." [FB:ma] is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0048870 ! cell motility relationship: capable_of GO:0048870 ! cell motility [Term] id: CL:0000220 name: obsolete cell by lineage comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell in a multicellular organiam, apart from a zygote, can potentially be classified by its lineage. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000221 name: ectodermal cell def: "A cell of the outer of the three germ layers of the embryo." [MESH:D004475] synonym: "ectoderm cell" EXACT [] xref: FMA:72549 is_a: BFO:0000004 ! independent continuant is_a: CL:0002321 ! embryonic cell (metazoa) relationship: part_of UBERON:0000924 ! ectoderm [Term] id: CL:0000222 name: mesodermal cell def: "A cell of the middle germ layer of the embryo." [MESH:D008648] synonym: "mesoblast" EXACT [] synonym: "mesoderm cell" EXACT [] xref: FMA:72554 is_a: BFO:0000004 ! independent continuant is_a: CL:0002321 ! embryonic cell (metazoa) relationship: part_of UBERON:0000926 ! mesoderm [Term] id: CL:0000223 name: endodermal cell def: "A cell of the inner of the three germ layers of the embryo." [MESH:D004707] synonym: "endoderm cell" EXACT [] xref: FMA:72555 is_a: BFO:0000004 ! independent continuant is_a: CL:0002321 ! embryonic cell (metazoa) relationship: part_of UBERON:0000925 ! endoderm [Term] id: CL:0000224 name: obsolete cell by nuclear number def: "OBSOLETE: A classification of cells by the number of their nuclei." [FB:ma, GOC:tfm] comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell can be classified by its nuclear number (note that this term was previously used as a parent class of enucleate cell). If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0001034 [Term] id: CL:0000225 name: anucleate cell def: "A cell that lacks a nucleus." [FB:ma] synonym: "non-nucleated cell" EXACT [] xref: FMA:68647 is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001405 ! anucleate disjoint_from: CL:0002242 ! nucleate cell relationship: bearer_of PATO:0001405 ! anucleate [Term] id: CL:0000226 name: single nucleate cell def: "A cell with a single nucleus." [FB:ma, GOC:tfm] is_a: CL:0002242 ! nucleate cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001407 ! mononucleate relationship: bearer_of PATO:0001407 ! mononucleate [Term] id: CL:0000227 name: binucleate cell is_a: CL:0000228 ! multinucleate cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001406 ! binucleate relationship: bearer_of PATO:0001406 ! binucleate [Term] id: CL:0000228 name: multinucleate cell def: "A cell with more than one nucleus." [FB:ma] synonym: "syncitium" EXACT [] synonym: "syncytial cell" EXACT [] synonym: "syncytium" EXACT [] xref: AEO:0000203 xref: WBbt:0008074 is_a: CL:0002242 ! nucleate cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001908 ! multinucleate relationship: bearer_of PATO:0001908 ! multinucleate [Term] id: CL:0000229 name: obsolete lymphoblast def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Refers to an activated mature lymphocyte phenotype rather than a distinct cell type; consider using 'lymphocyte ; CL:0000542' or one of its children instead. is_obsolete: true [Term] id: CL:0000230 name: obsolete T lymphoblast def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Refers to an activated mature T lymphocyte phenotype rather than a distinct cell type; consider using 'T cell ; CL:0000084' or one of its children instead. is_obsolete: true [Term] id: CL:0000231 name: obsolete B lymphoblast def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Refers to an activated mature B lymphocyte phenotype rather than a distinct cell type; consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000232 name: erythrocyte def: "A red blood cell. In mammals, mature erythrocytes are biconcave disks containing hemoglobin whose function is to transport oxygen." [GOC:tfm, MESH:D004912] subset: human_reference_atlas synonym: "RBC" EXACT [] synonym: "red blood cell" EXACT [] xref: BTO:0000424 xref: CALOHA:TS-0290 xref: FMA:81100 is_a: CL:0000081 ! blood cell is_a: CL:0000329 ! oxygen accumulating cell is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell intersection_of: CL:0000764 ! erythroid lineage cell intersection_of: bearer_of PATO:0002039 ! biconcave intersection_of: capable_of GO:0008015 ! blood circulation intersection_of: capable_of GO:0015671 ! oxygen transport intersection_of: lacks_part GO:0005840 ! ribosome intersection_of: lacks_plasma_membrane_part PR:000001945 ! transferrin receptor protein 1 relationship: bearer_of PATO:0002039 ! biconcave relationship: develops_from CL:0000558 ! reticulocyte relationship: lacks_part GO:0005840 ! ribosome relationship: lacks_plasma_membrane_part PR:000001945 ! transferrin receptor protein 1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000233 name: platelet def: "A non-nucleated disk-shaped cell formed by extrusion from megakaryocytes, found in the blood of all mammals, and mainly involved in blood coagulation." [GOC:add, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/Platelet, MESH:D001792, PMID:11110672, PMID:16987572, PMID:17204662, PMID:17479180, PMID:20414831] comment: Platelets are reportedly CCR1-positive, CCR2-negative, CCR3-positive, CCR4-positive, CCR5-negative, CCR6-negative, CCR7-negative, CCR8-negative, CCR9-negative, CCR10-negative, CD16-positive, CD23-positive, CD32-positive, CD40-positive, CD41-positive CD42-positive, CD61-positive, CD62P-positive, CD64-positive, CD89-positive, CD102-positive, CD147-positive (activated platelets), CD154-positive (activated platelets), CD162-positive, CD209, CD282-positive, CD284-positive, CD289-positive, CD181-negative, CD182-negative, CD183-negative, CD184-positive, CLEC2-positive, GPVI-positive, JAMC-positive, PAR1-positive, PAR2-negative, PAR3-positive, PAR4-positive, TSP1-positive, and TXA2R-positive. Platelets can reportedly produce CCL2, CCL3, CCL5, CCL7, CCL17, CD40L, CXCL1, CXCL4, CXCL4L1, CXCL5, CXCL7, CXCL8, CXCL12, EGF, factor V, factor VII, factor XI, factor XIII, bFGF, histamine, IGF-1, IL-1beta, PAI-1, PDGF, plasminogen, protein S, serotonin, TGF-beta, TFPI, VEGF, and vWF. subset: human_reference_atlas synonym: "anucleate thrombocyte" EXACT [] synonym: "blood platelet" EXACT [] synonym: "enucleate thrombocyte" EXACT [] xref: BTO:0000132 xref: CALOHA:TS-0803 xref: FMA:62851 is_a: CL:0000081 ! blood cell is_a: CL:0000225 ! anucleate cell is_a: CL:0000458 ! serotonin secreting cell is_a: CL:0000763 {is_inferred="true"} ! myeloid cell intersection_of: CL:0000763 ! myeloid cell intersection_of: bearer_of PATO:0001405 ! anucleate intersection_of: bearer_of PATO:0001874 ! discoid intersection_of: capable_of GO:0007596 ! blood coagulation intersection_of: capable_of GO:0008015 ! blood circulation relationship: bearer_of PATO:0001874 ! discoid relationship: capable_of GO:0007596 ! blood coagulation relationship: develops_from CL:0000556 ! megakaryocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000234 name: phagocyte def: "Any cell capable of ingesting particulate matter via phagocytosis." [GOC:add, ISBN:0721601464] xref: BTO:0001044 xref: FMA:83806 xref: MESH:D010586 is_a: CL:0000219 ! motile cell is_a: CL:0000325 ! stuff accumulating cell is_a: CL:0000473 ! defensive cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0006909 ! phagocytosis relationship: capable_of GO:0006909 ! phagocytosis [Term] id: CL:0000235 name: macrophage def: "A mononuclear phagocyte present in variety of tissues, typically differentiated from monocytes, capable of phagocytosing a variety of extracellular particulate material, including immune complexes, microorganisms, and dead cells." [GO_REF:0000031, GOC:add, GOC:tfm, PMID:16213494, PMID:1919437] comment: Morphology: Diameter 30_M-80 _M, abundant cytoplasm, low N/C ratio, eccentric nucleus. Irregular shape with pseudopods, highly adhesive. Contain vacuoles and phagosomes, may contain azurophilic granules; markers: Mouse & Human: CD68, in most cases CD11b. Mouse: in most cases F4/80+; role or process: immune, antigen presentation, & tissue remodelling; lineage: hematopoietic, myeloid. subset: human_reference_atlas synonym: "histiocyte" EXACT [] xref: BTO:0000801 xref: CALOHA:TS-0587 xref: FMA:63261 xref: FMA:83585 xref: MESH:D008264 is_a: CL:0000145 ! professional antigen presenting cell is_a: CL:0000234 ! phagocyte is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II intersection_of: capable_of GO:0006909 ! phagocytosis intersection_of: capable_of GO:0031268 ! pseudopodium organization relationship: capable_of GO:0031268 ! pseudopodium organization relationship: develops_from CL:0000576 ! monocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000236 name: B cell def: "A lymphocyte of B lineage that is capable of B cell mediated immunity." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] subset: human_reference_atlas synonym: "B lymphocyte" EXACT [] synonym: "B-cell" EXACT [] synonym: "B-lymphocyte" EXACT [] xref: BTO:0000776 xref: CALOHA:TS-0068 xref: FMA:62869 xref: MESH:D001402 xref: VHOG:0001480 is_a: CL:0000945 {is_inferred="true"} ! lymphocyte of B lineage intersection_of: CL:0000945 ! lymphocyte of B lineage intersection_of: capable_of GO:0019724 ! B cell mediated immunity relationship: capable_of GO:0019724 ! B cell mediated immunity relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000237 name: keratinizing barrier epithelial cell is_a: CL:0000240 ! stratified squamous epithelial cell is_a: CL:0000311 ! keratin accumulating cell is_a: CL:0002077 ! ecto-epithelial cell relationship: develops_from CL:0000114 ! surface ectodermal cell [Term] id: CL:0000238 name: non keratinizing barrier epithelial cell is_a: CL:0000240 ! stratified squamous epithelial cell [Term] id: CL:0000239 name: brush border epithelial cell is_a: CL:0000067 ! ciliated epithelial cell is_a: CL:0000075 ! columnar/cuboidal epithelial cell [Term] id: CL:0000240 name: stratified squamous epithelial cell subset: human_reference_atlas is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0000079 ! stratified epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000241 name: stratified cuboidal epithelial cell subset: human_reference_atlas is_a: CL:0000075 ! columnar/cuboidal epithelial cell is_a: CL:0000079 ! stratified epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000242 name: Merkel cell def: "A modified epidermal cell located in the stratum basale. They are found mostly in areas where sensory perception is acute. Merkel cells are closely associated with an expanded terminal bulb of an afferent myelinated nerve fiber." [MESH:D018862] subset: human_reference_atlas synonym: "Merkel's cell" EXACT [] xref: FMA:70548 is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata) is_a: CL:0000312 {xref="PMID:19782676"} ! keratinocyte is_a: CL:0000710 ! neurecto-epithelial cell relationship: part_of UBERON:0002025 ! stratum basale of epidermis relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000243 name: obsolete glial cell (sensu Vertebrata) def: "A non-neuronal cell of the nervous system. They not only provide physical support, but also respond to injury, regulate the ionic and chemical composition of the extracellular milieu. Form the myelin insulation of nervous pathways, guide neuronal migration during development, and exchange metabolites with neurons. Neuroglia have high-affinity transmitter uptake systems, voltage-dependent and transmitter-gated ion channels, and can release transmitters, but their role in signaling (as in many other functions) is unclear." [MESH:D009457] comment: This is a grouping class that is no longer needed or wanted. property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/715 xsd:string is_obsolete: true [Term] id: CL:0000244 name: transitional epithelial cell def: "A cell characteristically found lining hollow organs that are subject to great mechanical change due to contraction and distention; originally thought to represent a transition between stratified squamous and columnar epithelium." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas xref: FMA:66778 is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000245 name: obsolete passage cell def: "Obsolete. Use PO:0000353 from Plant Ontology instead. Cell in exodermis or endodermis that remains thin walled when the associated cells develop thick secondary walls. Has casparian strip in endodermis." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000353 [Term] id: CL:0000246 name: Mauthner neuron is_a: CL:0000099 ! interneuron [Term] id: CL:0000247 name: Rohon-Beard neuron def: "Type of neuron that is a primary mechanosensory cell, with peripheral neurites innervating the skin with free nerve endings." [VHOG:0001484] synonym: "RB neuron" RELATED [VHOG:0001484] synonym: "Rohon Beard cell" EXACT [VHOG:0001484] synonym: "Rohon-Beard cell" EXACT [] xref: AAO:0010316 xref: EFO:0003711 xref: VHOG:0001484 xref: ZFA:0009150 is_a: CL:0000006 ! neuronal receptor cell is_a: CL:0000531 ! primary sensory neuron is_a: CL:4023168 ! somatosensory neuron [Term] id: CL:0000248 name: obsolete microsporocyte def: "Obsolete. Use PO:0020047 from Plant Ontology instead. A diploid (2n) cell that undergoes meiosis and forms four haploid (1n) microspores; also called microspore mother cell and, in seed plants, pollen mother cell." [ISBN:0471245208] synonym: "pollen mother cell" EXACT [] synonym: "primary sporogenous cell" EXACT [] is_obsolete: true replaced_by: PO:0020047 [Term] id: CL:0000249 name: hatching gland cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000250 name: obsolete megaspore def: "Obsolete. Use PO:0020019 from Plant Ontology instead. A haploid (1n) spore developing into a female gametophyte in heterosporous plants." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0020019 [Term] id: CL:0000251 name: extramedullary cell is_a: CL:0000101 ! sensory neuron [Term] id: CL:0000252 name: obsolete microspore def: "Obsolete. Use PO:0020048 from Plant Ontology instead. A haploid (1n) spore developing into a male gametophyte in heterosporous plants; the uninucleate pollen grain in seed plants." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0020048 [Term] id: CL:0000253 name: eurydendroid cell is_a: CL:0000527 ! efferent neuron [Term] id: CL:0000254 name: obsolete egg cell def: "Obsolete. Use PO:0020094 from Plant Ontology instead. The female gamete of plants." [TAIR:lr] synonym: "female gametophyte egg cell" EXACT [] is_obsolete: true replaced_by: PO:0020094 [Term] id: CL:0000255 name: eukaryotic cell xref: MESH:D005057 is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: only_in_taxon NCBITaxon:2759 ! Eukaryota disjoint_from: CL:0000520 ! prokaryotic cell relationship: only_in_taxon NCBITaxon:2759 ! Eukaryota [Term] id: CL:0000256 name: uric acid accumulating cell is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000257 name: Eumycetozoan cell is_a: CL:0000255 ! eukaryotic cell intersection_of: CL:0000003 ! native cell intersection_of: only_in_taxon NCBITaxon:142796 ! Eumycetozoa relationship: only_in_taxon NCBITaxon:142796 ! Eumycetozoa [Term] id: CL:0000258 name: obsolete fiber tracheid def: "Obsolete. Use PO:0000355 from Plant Ontology instead. A fiber like tracheid in the secondary xylem; commonly thick walled, with pointed ends and bordered pits that have lenticular to slit like apertures." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000355 [Term] id: CL:0000259 name: obsolete aggregate cell is_obsolete: true replaced_by: DDANAT:0000403 [Term] id: CL:0000260 name: obsolete mucilage cell def: "Obsolete. Use PO:0000373 from Plant Ontology instead. Cell containing mucilages or gums or similar carbohydrate material characterized by the property of swelling in water." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000373 [Term] id: CL:0000261 name: obsolete anterior cell comment: Obsoleted becuase this term has an overly general name, no definition, and by it's classification appears to refer to a very specific cell type in dictystelium. If needed, the term should be in DDANAT - probably as a subclass of http://purl.obolibrary.org/obo/DDANAT_0000002 is_obsolete: true consider: false consider: http://purl.obolibrary.org/obo/DDANAT_0000002 [Term] id: CL:0000262 name: obsolete guard mother cell def: "Obsolete. Use PO:0000351 from Plant Ontology instead. An epidermal cell that divides to produce the guard cells." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000351 [Term] id: CL:0000263 name: obsolete vegetative cell (sensu Mycetozoa) is_obsolete: true replaced_by: DDANAT:0000002 [Term] id: CL:0000264 name: obsolete phloem initial def: "Obsolete. Use PO:0000400 from Plant Ontology instead. A cambial cell on the phloem side of the cambial zone that is the source of one or more cells arising by periclinal divisions and differentiating into phloem elements with or without additional divisions in various planes." [ISBN:0471245208] synonym: "phloem mother cell" EXACT [] is_obsolete: true replaced_by: PO:0000400 [Term] id: CL:0000265 name: obsolete anterior like cell is_obsolete: true replaced_by: DDANAT:0000404 [Term] id: CL:0000266 name: obsolete meristemoid def: "Obsolete. Use PO:0004011 from Plant Ontology instead. A cell constituting an active locus of meristematic activity in a tissue composed of somewhat older, differentiating cells." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0004011 [Term] id: CL:0000267 name: obsolete prespore cell is_obsolete: true replaced_by: DDANAT:0000405 [Term] id: CL:0000268 name: obsolete sieve element def: "Obsolete. Consult Plant Ontology instead. The cell in the phloem tissue concerned with mainly longitudinal conduction of food materials. Classified into sieve cell and sieve tube member." [ISBN:0471245208] is_obsolete: true [Term] id: CL:0000269 name: obsolete prestalk cell is_obsolete: true replaced_by: DDANAT:0000406 [Term] id: CL:0000270 name: obsolete subsidiary cell def: "Obsolete. Use PO:0000284 from Plant Ontology instead. An epidermal cell associated with a stoma and at least morphologically distinguishable from the epidermal cells composing the groundmass of the tissue." [ISBN:047124520] is_obsolete: true replaced_by: PO:0000284 [Term] id: CL:0000271 name: obsolete prestalk A cell is_obsolete: true replaced_by: DDANAT:0000408 [Term] id: CL:0000272 name: obsolete cambial initial def: "OBSOLETE, use term from Plant Ontology. A cell localized in the vascular cambium or phellogen. Its periclinal division can contribute cells either to the outside or to the inside of the axis; in vascular cambium, classified into fusiform initials (source of axial cells of xylem and phloem) and ray initials (source of the ray cells)." [ISBN:0471245208] comment: replaced_by PO:0000295 is_obsolete: true [Term] id: CL:0000273 name: obsolete prestalk AB cell is_obsolete: true replaced_by: DDANAT:0000410 [Term] id: CL:0000275 name: obsolete prestalk B cell is_obsolete: true replaced_by: DDANAT:0000409 [Term] id: CL:0000276 name: obsolete sclerenchyma cell def: "Obsolete. Use PO:0000077 from Plant Ontology instead. Cell variable in form and size, being more or less thick, often lignified, secondary walls. Belongs to the category of subcells and may or may not be devoid of protoplast at maturity." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000077 [Term] id: CL:0000277 name: obsolete prestalk I cell def: "OBSOLETE: Initial population of prestalk cells that activate the ecmA promoter at the mound stage and that presumably further differentiate into pstA and pstO cells." [DictyBase:DDB] comment: This cell type does not exist in Dictyostelium. it has been long deleted in their anatomy ontology. is_obsolete: true replaced_by: DDANAT:0000406 [Term] id: CL:0000278 name: obsolete central cell def: "Obsolete. Use PO:0020090 from Plant Ontology instead. OBSOLETED, use term from Plant Ontology. A cell containing the two polar nuclei which, after double fertilization, will develop into the endosperm." [TAIR:lr] is_obsolete: true replaced_by: PO:0020090 [Term] id: CL:0000279 name: obsolete prestalk 0 cell is_obsolete: true replaced_by: DDANAT:0000407 [Term] id: CL:0000280 name: obsolete generative cell def: "Obsolete. Use PO:0020097 from Plant Ontology instead. The cell that will give rise to the generative nuclei which will participate in fertilization." [TAIR:lr] is_obsolete: true replaced_by: PO:0020097 [Term] id: CL:0000281 name: obsolete pstAB/ALC is_obsolete: true replaced_by: DDANAT:0000411 [Term] id: CL:0000282 name: obsolete trichome def: "Obsolete. Use PO:0000282 from Plant Ontology instead. An outgrowth from the epidermis. Trichomes vary in size and complexity and include hairs, scales, and other structures and may be glandular. In Arabidopsis, patterning of trichome development is not random but does not appear to be lineage-based like stomata." [ISBN:0471245208, PMID:10938806] is_obsolete: true replaced_by: PO:0000282 [Term] id: CL:0000283 name: obsolete pstO/ALC is_obsolete: true replaced_by: DDANAT:0000412 [Term] id: CL:0000284 name: obsolete companion cell def: "Obsolete. Use PO:0000071 from Plant Ontology instead. A specialized parenchyma cell associated with a sieve-tube member in angiosperm phloem and arising from the same mother cell as the sieve-tube member." [ISBN:0879015322] is_obsolete: true replaced_by: PO:0000071 [Term] id: CL:0000285 name: obsolete stalk cell is_obsolete: true replaced_by: DDANAT:0000413 [Term] id: CL:0000286 name: hyphal cell def: "A cell of a filament of a fungal mycelium." [ISBN:08199377X] is_a: CL:0000521 ! fungal cell [Term] id: CL:0000287 name: eye photoreceptor cell subset: human_reference_atlas is_a: CL:0000210 ! photoreceptor cell intersection_of: CL:0000210 ! photoreceptor cell intersection_of: part_of UBERON:0000970 ! eye relationship: part_of UBERON:0000970 ! eye relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000288 name: obsolete synergid def: "Obsolete. Use PO:0000191 from Plant Ontology instead. A cell in the micropylar end of the embryo sac associated with the egg in the egg apparatus of angiosperms. Plays a vital role in fertilization." [ISBN:047125208] is_obsolete: true replaced_by: PO:0000191 [Term] id: CL:0000289 name: obsolete chemotactic amoeboid cell (sensu Mycetozoa) is_obsolete: true replaced_by: DDANAT:0000402 [Term] id: CL:0000290 name: obsolete xylem fiber cell def: "Obsolete. Use PO:0000274 from Plant Ontology instead. A fiber of the xylem tissue, Two types are recognized in the secondary xylem: fiber tracheids and libriform fibers." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000274 [Term] id: CL:0000291 name: obsolete spore (sensu Mycetozoa) is_obsolete: true replaced_by: DDANAT:0000414 [Term] id: CL:0000292 name: obsolete guard cell def: "Obsolete. Use PO:0000293 from Plant Ontology instead. One of a pair of cells flanking the stomatal pore and causing the opening and closing of the pore by changes in turgor." [ISBN:0471245208] synonym: "stomatal guard cell" EXACT [] is_obsolete: true replaced_by: PO:0000293 [Term] id: CL:0000293 name: structural cell def: "A cell whose primary function is to provide structural support, to provide strength and physical integrity to the organism." [TAIR:sr] is_a: CL:0000003 ! native cell [Term] id: CL:0000294 name: obsolete sieve cell def: "Obsolete. Consult Plant Ontology instead. A type of sieve element that has relatively undifferentiated sieve areas (with narrow pores), rather uniform in structure on all walls; that is, there are no sieve plates. Typical of gymnosperms and lower vascular plants." [ISBN:0471245208] is_obsolete: true [Term] id: CL:0000295 name: somatotropin secreting cell alt_id: CL:0000471 def: "A peptide hormone secreting cell that produces growth hormone, somatotropin." [GOC:tfm, SANBI:mhl] synonym: "growth hormone secreting cell" EXACT [] synonym: "somatotrophin secreting cell" EXACT [] is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0030252 ! growth hormone secretion relationship: capable_of GO:0030252 ! growth hormone secretion [Term] id: CL:0000296 name: obsolete vegetative cell def: "Obsolete. Use PO:0020099 from Plant Ontology instead. Cell type formed after the first mitotic division of the microgametophye, The nucleus of this cell migrates to the tip of the pollen tube after germination and disintegrates when the pollen tube penetrates the nucellus." [ISBN:0140514031, TAIR:lr] is_obsolete: true replaced_by: PO:0020099 [Term] id: CL:0000297 name: obsolete socket cell def: "Obsolete. Use PO:0000115 from Plant Ontology instead. A cell that surrounds a trichome and provides support for the trichome." [PMID:10938806] is_obsolete: true replaced_by: PO:0000115 [Term] id: CL:0000298 name: obsolete xylem element def: "Obsolete. Use PO:0000273 from Plant Ontology instead. A cell composing the xylem." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000273 [Term] id: CL:0000299 name: obsolete trichoblast def: "OBSOLETED. Commonly used for a cell in root epidermis that gives rise to a root hair. The daughter cell produced by the asymmetric division of a root epidermal cell that gives rise to a root hair." [ISBN:0471245208] comment: Obsoleted. Use trichoblast from the plant ontology (PO:0000262). is_obsolete: true [Term] id: CL:0000300 name: gamete def: "A mature sexual reproductive cell having a single set of unpaired chromosomes." [GOC:tfm, ISBN:0721662544] synonym: "haploid germ cell" RELATED [] synonym: "haploid nucleated cell" EXACT [] xref: CALOHA:TS-0395 xref: FBbt:00005412 xref: FMA:18649 is_a: CL:0000413 ! haploid cell is_a: CL:0000586 {is_inferred="true"} ! germ cell intersection_of: CL:0000586 ! germ cell intersection_of: bearer_of PATO:0001375 ! haploid intersection_of: capable_of GO:0009566 ! fertilization relationship: capable_of GO:0009566 ! fertilization [Term] id: CL:0000301 name: pole cell xref: FBbt:00000092 is_a: CL:0000670 ! primordial germ cell [Term] id: CL:0000302 name: obsolete IgM B cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Not a differentiation state per se; consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000303 name: obsolete IgG B cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Not a differentiation state per se, and IgG isotypes vary by species; consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000304 name: obsolete IgA B cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Not a differentiation state per se, and IgA isotypes vary by species. Consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000305 name: obsolete IgE B cell def: "OBSOLETE (was not defined before being made obsolete)." [] comment: Not a differentiation state per se; consider using 'B cell ; CL:0000236' or one of its children instead. is_obsolete: true [Term] id: CL:0000306 name: crystallin accumulating cell synonym: "lens cell" EXACT [] is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000307 name: tracheal epithelial cell alt_id: CL:1000474 def: "An epithelial cell found in the trachea." [GOC:tfm] comment: This class is for the vertebrate tracheal structure. For the analagous insect cell type, see 'respiratory tube epithelial cell' synonym: "tracheocyte" EXACT [] xref: FBbt:00005038 xref: FMA:74793 is_a: CL:0002202 {is_inferred="true"} ! epithelial cell of tracheobronchial tree intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0003126 ! trachea relationship: develops_from CL:0000377 ! tracheoblast relationship: part_of UBERON:0003126 ! trachea [Term] id: CL:0000308 name: metal ion accumulating cell is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000309 name: copper accumulating cell synonym: "cuprophilic cell" EXACT [] is_a: CL:0000308 ! metal ion accumulating cell [Term] id: CL:0000310 name: iron accumulating cell is_a: CL:0000308 ! metal ion accumulating cell [Term] id: CL:0000311 name: keratin accumulating cell is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000312 name: keratinocyte alt_id: CL:0002185 def: "An epidermal cell which synthesizes keratin and undergoes a characteristic change as it moves upward from the basal layers of the epidermis to the cornified (horny) layer of the skin. Successive stages of differentiation of the keratinocytes forming the epidermal layers are basal cell, spinous or prickle cell, and the granular cell." [GOC:dsd, http://en.wikipedia.org/wiki/Keratinocyte, MESH:D015603, PMID:15582983, PMID:15749908, PMID:19727116] comment: Keratinocytes are reportedly CDw210a-negative, CDw210b-positive, CD281-positive, CD282-positive, CD285-positive, IL22Ra1-positive, Human keratinocytes are reportedly capable of secreting BD-2, BD-3, hCAP-18, CXCL1, CXCL5, CXCL8, elafin, MMP-3, NGAL, PDGF-A, S100A7, S100A8, and S100A9. Transcription factors: STAT3-positive. subset: human_reference_atlas synonym: "keratinized cell of epidermis" EXACT [] synonym: "malpighian cell" EXACT [] xref: BTO:0000667 xref: CALOHA:TS-0500 xref: FMA:62879 is_a: BFO:0000040 ! material entity is_a: CL:0000237 {is_inferred="true"} ! keratinizing barrier epithelial cell is_a: CL:0000362 {is_inferred="true"} ! epidermal cell intersection_of: CL:0000237 ! keratinizing barrier epithelial cell intersection_of: part_of UBERON:0001003 ! skin epidermis relationship: capable_of GO:0002775 ! antimicrobial peptide production relationship: capable_of GO:0002776 ! antimicrobial peptide secretion relationship: capable_of GO:0090023 ! positive regulation of neutrophil chemotaxis relationship: part_of UBERON:0001003 ! skin epidermis relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000313 name: serous secreting cell def: "Columnar glandular cell with irregular nucleus, copious granular endoplasmic reticulum and supranuclear granules. Secretes a watery fluid containing proteins known as serous fluid." [GOC:tfm, ISBN:0517223651, ISBN:0721662544] subset: human_reference_atlas synonym: "serous cell" EXACT [] xref: BTO:0003687 xref: FMA:62511 is_a: CL:0000159 ! seromucus secreting cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000314 name: milk secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000315 name: tear secreting cell def: "A cell secreting tears, the fluid secreted by the lacrimal glands. This fluid moistens the conjunctiva and cornea." [MESH:D013666] synonym: "tears secreting cell" EXACT [] is_a: CL:0000152 ! exocrine cell relationship: part_of UBERON:0001817 ! lacrimal gland [Term] id: CL:0000316 name: obsolete ray initial def: "Obsolete. Use PO:0000082 from Plant Ontology instead. A meristemic ray cell in the vascular cambium that gives rise to ray cells of the secondary xylem and secondary phloem." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000082 [Term] id: CL:0000317 name: sebum secreting cell def: "A cell secreting sebun, an oily substance secreted by sebaceous glands, composed of keratin, fat, and cellular debris." [MESH:D012629] subset: human_reference_atlas synonym: "sebocyte" EXACT [] is_a: CL:0000152 ! exocrine cell is_a: CL:2000021 ! sebaceous gland cell intersection_of: CL:0000151 ! secretory cell intersection_of: part_of UBERON:0001821 ! sebaceous gland relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000318 name: sweat secreting cell def: "A cell secreting sweat, the fluid excreted by the sweat glands of mammals. It consists of water containing sodium chloride, phosphate, urea, ammonia, and other waste products." [MESH:D013542] is_a: CL:0000150 ! glandular epithelial cell [Term] id: CL:0000319 name: mucus secreting cell synonym: "mucous cell" EXACT [] xref: BTO:0003689 is_a: CL:0000159 ! seromucus secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0070254 ! mucus secretion relationship: capable_of GO:0070254 ! mucus secretion [Term] id: CL:0000320 name: obsolete megasporocyte def: "Obsolete. Use PO:0000431 from Plant Ontology instead. A diploid (2n) cell that undergoes meiosis and produces four haploid (1n) megaspores; also called megaspore mother cell." [ISBN:0471245208] synonym: "archesporial cell" EXACT [] synonym: "megaspore mother cell" EXACT [] is_obsolete: true replaced_by: PO:0000431 [Term] id: CL:0000321 name: seminal fluid secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000322 name: pneumocyte def: "An epithelial cell that lines the peripheral gas exchange region of the lungs of air-breathing vertebrates." [GOC:tfm, PMID:20054144] synonym: "alveolar epithelial cell" EXACT [] synonym: "pneumonocyte" EXACT [] xref: BTO:0000395 xref: CALOHA:TS-2168 xref: FMA:62499 is_a: CL:0010003 ! epithelial cell of alveolus of lung relationship: part_of UBERON:0004821 ! pulmonary alveolus epithelium [Term] id: CL:0000323 name: lysozyme secreting cell is_a: CL:0000154 ! protein secreting cell [Term] id: CL:0000324 name: metanephric mesenchyme stem cell is_a: CARO:0000000 ! anatomical entity is_a: CL:0000134 ! mesenchymal stem cell relationship: develops_from CL:0000222 ! mesodermal cell [Term] id: CL:0000325 name: stuff accumulating cell def: "A cell that is specialised to accumulate a particular substance(s)." [FB:ma] subset: ubprop:upper_level is_a: CL:0000003 ! native cell [Term] id: CL:0000326 name: glycogen accumulating cell is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000327 name: extracellular matrix secreting cell is_a: CL:0000499 ! stromal cell [Term] id: CL:0000329 name: oxygen accumulating cell is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0015671 ! oxygen transport relationship: capable_of GO:0015671 ! oxygen transport [Term] id: CL:0000330 name: obsolete collenchymal cell def: "Obsolete. Use PO:0000075 from Plant Ontology instead. An elongated living cell with unevenly thickened nonlignified primary walls." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000075 [Term] id: CL:0000331 name: obsolete tracheid def: "Obsolete. Use PO:0000301 from Plant Ontology instead. A tracheary element of the xylem that has no perforations, as contrasted with a vessel member. May occur in primary and in secondary xylem. May have any kind of secondary wall thickening found in tracheary elements." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000301 [Term] id: CL:0000332 name: obsolete atrichoblast def: "OBSOLETE, use term from Plant Ontology. A cell formed after asymmetric division of root epidermal cell that does not give rise to a root hair." [ISBN:0387987819] synonym: "non-hair cell" RELATED [] is_obsolete: true replaced_by: PO:0020090 [Term] id: CL:0000333 name: migratory neural crest cell def: "A cell derived from the specialized ectoderm flanking each side of the embryonic neural plate, which after the closure of the neural tube, forms masses of cells that migrate out from the dorsal aspect of the neural tube to spread throughout the body." [MESH:A16.254.600] xref: FMA:86667 is_a: CL:0000219 ! motile cell is_a: CL:0011012 ! neural crest cell is_a: CL:0011026 ! progenitor cell relationship: develops_from CL:0007004 ! premigratory neural crest cell [Term] id: CL:0000334 name: vegetative cell (sensu Fungi) synonym: "yeast-form" RELATED [] xref: BTO:0002307 xref: FAO:0000032 is_a: CL:0000521 ! fungal cell [Term] id: CL:0000335 name: mesenchyme condensation cell def: "A mesenchymal cell in embryonic development found in a contracting mass and that gives rise to osteoprogenitors." [GOC:tfm, PMID:5025404] is_a: CL:0008019 ! mesenchymal cell [Term] id: CL:0000336 name: adrenal medulla chromaffin cell alt_id: CL:1000422 def: "A cell found within the adrenal medulla that secrete biogenic amine hormones upon stimulation." [GOC:tfm, http://www.britannica.com/EBchecked/topic/6405/adrenal-gland] synonym: "medullary chromaffin cell of adrenal gland" EXACT [FMA:69262] xref: FMA:69262 is_a: CL:0000457 ! biogenic amine secreting cell is_a: CL:1000426 ! chromaffin cell of adrenal gland intersection_of: CL:0000166 ! chromaffin cell intersection_of: part_of UBERON:0001236 ! adrenal medulla relationship: develops_from CL:0000011 ! migratory trunk neural crest cell relationship: part_of UBERON:0001236 ! adrenal medulla [Term] id: CL:0000338 name: neuroblast (sensu Nematoda and Protostomia) synonym: "neuroblast" BROAD [] xref: FBbt:00005146 is_a: CL:0000047 ! neural stem cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000339 name: glioblast (sensu Vertebrata) def: "An early neural cell developing from the early ependymal cell of the neural tube." [GOC:tfm, ISBN:0618947256] synonym: "spongioblast" EXACT [] xref: FMA:70564 is_a: CL:0000030 ! glioblast is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata) is_a: CL:0011026 ! progenitor cell [Term] id: CL:0000340 name: glioblast (sensu Nematoda and Protostomia) xref: FBbt:00005145 is_a: CL:0000030 ! glioblast is_a: CL:0000130 ! neuron associated cell (sensu Nematoda and Protostomia) relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000341 name: pigment cell (sensu Nematoda and Protostomia) is_a: CL:0000147 ! pigment cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000342 name: pigment cell (sensu Vertebrata) def: "Any animal cell containing pigment granules." [GOC:tfm, ISBN:0721662544] is_a: CL:0000147 ! pigment cell is_a: CL:0000548 ! animal cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata [Term] id: CL:0000343 name: visual pigment cell (sensu Vertebrata) def: "A pigment cell that is capable of detecting light stimulus that is involved in visual perception." [GOC:tfm] xref: FMA:63846 is_a: BFO:0000040 ! material entity is_a: CL:0000149 ! visual pigment cell is_a: CL:0000342 {is_inferred="true"} ! pigment cell (sensu Vertebrata) intersection_of: CL:0000342 ! pigment cell (sensu Vertebrata) intersection_of: capable_of GO:0050908 ! detection of light stimulus involved in visual perception relationship: capable_of GO:0050908 ! detection of light stimulus involved in visual perception [Term] id: CL:0000344 name: obsolete non-visual cell (sensu Vertebrata) is_obsolete: true [Term] id: CL:0000345 name: dental papilla cell def: "A mesenchymal cell that is part of a small mass of condensed mesenchyme in the enamel organ; it differentiates into the dentin and dental pulp." [GOC:tfm, ISBN:0721662544] comment: Merge with odontoblast? is_a: CARO:0000000 ! anatomical entity is_a: CL:0008019 ! mesenchymal cell relationship: develops_from CL:0000008 ! migratory cranial neural crest cell relationship: part_of UBERON:0001763 ! odontogenic papilla [Term] id: CL:0000346 name: hair follicle dermal papilla cell def: "A specialized mesenchymal cell that resides in the dermal papilla located at the bottom of hair follicles. This cell plays a pivotal roles in hair formation, growth, and cycling." [GOC:tfm, PMID:9893172] comment: Are these really all stem cells? is_a: CL:0000134 {is_inferred="true"} ! mesenchymal stem cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000134 ! mesenchymal stem cell intersection_of: part_of UBERON:0000412 ! dermal papilla relationship: develops_from CL:0000333 ! migratory neural crest cell relationship: part_of UBERON:0000412 ! dermal papilla [Term] id: CL:0000347 name: scleral cell def: "A cell of the sclera of the eye." [GOC:add] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000293 ! structural cell intersection_of: CL:0000293 ! structural cell intersection_of: part_of UBERON:0001773 ! sclera relationship: develops_from CL:0000008 ! migratory cranial neural crest cell relationship: part_of UBERON:0001773 ! sclera [Term] id: CL:0000348 name: choroidal cell of the eye def: "A cell of the choroid of the eye." [GOC:add] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000293 ! structural cell intersection_of: CL:0000293 ! structural cell intersection_of: part_of UBERON:0001776 ! optic choroid relationship: develops_from CL:0000008 ! migratory cranial neural crest cell relationship: part_of UBERON:0001776 ! optic choroid [Term] id: CL:0000349 name: extraembryonic cell is_a: BFO:0000004 ! independent continuant is_a: CL:0000548 ! animal cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000548 ! animal cell intersection_of: part_of UBERON:0000478 ! extraembryonic structure relationship: part_of UBERON:0000478 ! extraembryonic structure [Term] id: CL:0000350 name: amnioserosal cell is_a: CL:0000349 ! extraembryonic cell intersection_of: CL:0000349 ! extraembryonic cell intersection_of: part_of UBERON:0010302 ! amnioserosa relationship: part_of UBERON:0010302 ! amnioserosa [Term] id: CL:0000351 name: trophoblast cell def: "A cell lining the outside of the blastocyst. After binding to the endometrium, trophoblast cells develop into two distinct layers, an inner layer of mononuclear cytotrophoblast cells and an outer layer of continuous multinuclear cytoplasm, the syncytiotrophoblast cells, which form the early fetal-maternal interface." [GOC:tfm, MESH:D014327] synonym: "trophoblastic cell" EXACT [] xref: FMA:83028 is_a: CL:0000349 {is_inferred="true"} ! extraembryonic cell relationship: part_of UBERON:0000358 ! blastocyst [Term] id: CL:0000352 name: epiblast cell def: "A cell of the outer layer of a blastula that gives rise to the ectoderm after gastrulation." [GOC:tfm, ISBN:0618947256] is_a: CL:0000052 ! totipotent stem cell [Term] id: CL:0000353 name: blastoderm cell def: "An undifferentiated cell produced by early cleavages of the fertilized egg (zygote)." [MESH:D001756] synonym: "blastomere" EXACT [] xref: BTO:0001473 xref: FMA:72551 is_a: CL:0000007 ! early embryonic cell (metazoa) [Term] id: CL:0000354 name: blastemal cell synonym: "blastema cell" EXACT [] xref: ncithesaurus:Blastemal_Cell is_a: CL:0000048 ! multi fate stem cell [Term] id: CL:0000355 name: multi-potent skeletal muscle stem cell def: "A multifate stem cell found in skeletal muscle than can differentiate into many different cell types, including muscle. Distinct cell type from satellite cell." [PMID:18282570] comment: Multi-potency demonstrated ex vivo. At the time of writing, it is unclear whether the endogenous population differentiates into multiple cell types in vivo. xref: FMA:86767 is_a: CL:0000048 {is_inferred="true"} ! multi fate stem cell is_a: CL:0000188 ! cell of skeletal muscle intersection_of: CL:0000048 ! multi fate stem cell intersection_of: part_of UBERON:0001134 ! skeletal muscle tissue [Term] id: CL:0000356 name: hair matrix stem cell is_a: CL:0000035 ! single fate stem cell [Term] id: CL:0000357 name: stratified epithelial stem cell is_a: CL:0000036 ! epithelial fate stem cell [Term] id: CL:0000358 name: sphincter associated smooth muscle cell def: "A smooth muscle cell that is part of a sphincter. A sphincter is a typically circular muscle that normally maintains constriction of a natural body passage or orifice and which relaxes as required by normal physiological functioning." [GOC:cjm] is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell intersection_of: CL:0000192 ! smooth muscle cell intersection_of: part_of UBERON:0004590 ! sphincter muscle relationship: part_of UBERON:0004590 ! sphincter muscle [Term] id: CL:0000359 name: vascular associated smooth muscle cell def: "A smooth muscle cell associated with the vasculature." [GOC:dsd, GOC:tfm] subset: human_reference_atlas synonym: "vascular smooth muscle cell" EXACT [] synonym: "VSMC" EXACT [] is_a: CL:0000192 {is_inferred="true"} ! smooth muscle cell intersection_of: CL:0000192 ! smooth muscle cell intersection_of: part_of UBERON:0002049 ! vasculature relationship: part_of UBERON:0002049 ! vasculature relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000360 name: morula cell def: "A cell of the early embryo at the developmental stage in which the blastomeres, resulting from repeated mitotic divisions of the fertilized ovum (zygote), form a compact cell mass." [MESH:D009028] is_a: BFO:0000004 ! independent continuant is_a: CL:0000007 ! early embryonic cell (metazoa) relationship: part_of UBERON:0000085 ! morula [Term] id: CL:0000361 name: gastrula cell def: "A cell of the embryo in the early stage following the blastula, characterized by morphogenetic cell movements, cell differentiation, and the formation of the three germ layers." [MESH:D005775] is_a: BFO:0000004 ! independent continuant is_a: CL:0000007 ! early embryonic cell (metazoa) relationship: part_of UBERON:0004734 ! gastrula [Term] id: CL:0000362 name: epidermal cell alt_id: CL:1000396 def: "An epithelial cell of the integument (the outer layer of an organism)." [Flybase:dsj, MA:ma] synonym: "cell of epidermis" EXACT [FMA:62411] synonym: "epithelial cell of skin" NARROW [FMA:62411] xref: BTO:0001470 xref: CALOHA:TS-0283 xref: FMA:62411 xref: MESH:D000078404 is_a: CL:0002159 ! general ecto-epithelial cell intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0007376 ! outer epithelium relationship: part_of UBERON:0007376 ! outer epithelium [Term] id: CL:0000363 name: obsolete axial cell def: "Obsolete. Use PO:0000081 from Plant Ontology instead. OBSOLETE, use term from the Plant Ontology. A secondary vascular cell that develops from the fusiform cambial initials and oriented with their longest diameter parallel with the main axis of stem or root. These cells make up the axial system, also known as vertical or longitudinal system." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000081 [Term] id: CL:0000364 name: obsolete ray cell def: "Obsolete. Consult Plant Ontology. A cell that develops from the ray initial and composes all rays (panels of tissue variable in height and width, formed by the ray initials in the vascular cambium and extending radially in the secondary xylem and secondary phloem) in the secondary vascular tissues." [ISBN:0471245208] is_obsolete: true [Term] id: CL:0000365 name: animal zygote def: "Diploid cell produced by the fusion of sperm cell nucleus and egg cell." [ISBN:0471245208] synonym: "zygote" BROAD [] xref: BTO:0000854 xref: EHDAA2:0004546 xref: FMA:72395 is_a: CL:0000007 ! early embryonic cell (metazoa) is_a: CL:0010017 ! zygote intersection_of: CL:0010017 ! zygote intersection_of: only_in_taxon NCBITaxon:33208 ! Metazoa [Term] id: CL:0000366 name: obsolete sperm cell (sensu Viridiplantae) def: "Obsolete. Use PO:0000084 from Plant Ontology instead. Male gamete, part of male germ unit." [ISBN:0471245208] synonym: "gametophyte sperm cell" RELATED [] synonym: "male gametophyte sperm cell" RELATED [] synonym: "pollen germ cell" RELATED [] is_obsolete: true replaced_by: PO:0000084 [Term] id: CL:0000367 name: sheath cell (sensu Nematoda) synonym: "glial cell (sensu Nematoda)" RELATED [] is_a: CL:0000619 ! supporting cell (sensu Nematoda) [Term] id: CL:0000368 name: obsolete myrosin cell def: "Obsolete. Use PO:0000352 from Plant Ontology instead. Cell containing glucosinolates ('mustard oil glucosides') and myrosinases, enzymes hydrolyzing the glucosinolates. Occurs in eleven dicotyledon families, the two largest of which are the Brassicaceae and Euphorbiaceae." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000352 [Term] id: CL:0000370 name: obsolete transfer cell def: "Obsolete. Use PO:0000078 from Plant Ontology instead. Parenchyma cell with the wall ingrowth (or invaginations) that increase the surface of the plasmalemma. Appears to be specialized for short-distance transfer of solutes." [ISBN:0471245208] synonym: "intermediary cell" RELATED [] is_obsolete: true replaced_by: PO:0000078 [Term] id: CL:0000371 name: protoplast def: "The cell protoplasm after removal of the cell wall." [ISBN:08199377X] xref: MESH:D011523 is_a: CL:0000578 ! experimentally modified cell in vitro relationship: never_in_taxon NCBITaxon:33208 ! Metazoa [Term] id: CL:0000372 name: tormogen cell def: "An epidermal cell that is part of a cell cluster organ of the insect integument (such as a sensillum) and that secretes a cuticular specialization that forms a socket around the base of a cuticular specialization produced by a trichogen cell." [ISBN:978-0801481253] synonym: "socket cell" BROAD [ISBN:978-0801481253] xref: FBbt:00005171 is_a: CL:0000463 ! epidermal cell (sensu Arthropoda) [Term] id: CL:0000373 name: histoblast xref: FBbt:00001789 is_a: CL:0000146 ! simple columnar epithelial cell [Term] id: CL:0000374 name: trichogen cell def: "An epidermal cell that is part of a cell cluster organ of the insect integument (such as a sensillum) and that secretes a cuticular specialization, often in the form of a hair, bristle, peg or scale. The base of this specialization is often surrounded by a socket produced by a closely associated tormogen cell." [ISBN:978-0801481253] synonym: "hair cell" BROAD [] xref: BTO:0004744 xref: FBbt:00005169 is_a: CL:0000463 ! epidermal cell (sensu Arthropoda) [Term] id: CL:0000375 name: obsolete osteoprogenitor cell xref: BTO:0002051 is_obsolete: true replaced_by: CL:0007010 [Term] id: CL:0000376 name: humidity receptor cell is_a: CL:0000006 ! neuronal receptor cell [Term] id: CL:0000377 name: tracheoblast is_a: CL:0000069 ! branched duct epithelial cell [Term] id: CL:0000378 name: supporting cell (sensu Nematoda and Protostomia) synonym: "support cell (sensu Nematoda and Protostomia)" EXACT [] is_a: CL:0000630 ! supporting cell [Term] id: CL:0000379 name: sensory processing neuron is_a: CL:0000540 ! neuron [Term] id: CL:0000380 name: thecogen cell def: "The support cell that makes the thecogen dendritic cap - a cuticle-like matrix around the tip of the eo-dendrite and which encloses the soma of the eo-neuron." [Fbbt:00005173] synonym: "fly sheath cell" EXACT [] is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia) [Term] id: CL:0000381 name: neurosecretory neuron xref: FBbt:00005130 is_a: CL:0000151 ! secretory cell is_a: CL:0000527 ! efferent neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0046879 ! hormone secretion relationship: capable_of GO:0046879 ! hormone secretion [Term] id: CL:0000382 name: scolopale cell xref: FBbt:00005219 is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia) [Term] id: CL:0000383 name: nephrogenic mesenchyme stem cell is_a: CL:0000134 ! mesenchymal stem cell is_a: CL:0011026 ! progenitor cell relationship: develops_from CL:0000134 ! mesenchymal stem cell [Term] id: CL:0000384 name: ligament cell is_a: CL:0000630 ! supporting cell [Term] id: CL:0000385 name: prohemocyte (sensu Nematoda and Protostomia) xref: FBbt:00005062 is_a: CL:0000390 ! blood cell (sensu Nematoda and Protostomia) relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000386 name: attachment cell is_a: CL:0000630 ! supporting cell [Term] id: CL:0000387 name: hemocyte (sensu Arthropoda) xref: FBbt:00005063 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia) is_a: CL:0000548 ! animal cell relationship: capable_of GO:0035010 {xref="PMID:18025161"} ! encapsulation of foreign target relationship: develops_from CL:0000385 ! prohemocyte (sensu Nematoda and Protostomia) relationship: only_in_taxon NCBITaxon:6656 ! Arthropoda [Term] id: CL:0000388 name: tendon cell def: "An elongated fibrocyte that is part of a tendon. The cytoplasm is stretched between the collagen fibres of the tendon. They have a central cell nucleus with a prominent nucleolus. Tendon cells have a well-developed rough endoplasmic reticulum and they are responsible for synthesis and turnover of tendon fibres and ground substance." [GOC:NV, GOC:tfm, PMID:957445] synonym: "muscle attachment cell" EXACT [] synonym: "tenocyte" RELATED [] is_a: CL:0000135 {is_inferred="true"} ! fibrocyte is_a: CL:0000386 ! attachment cell intersection_of: CL:0000135 ! fibrocyte intersection_of: part_of UBERON:0000043 ! tendon relationship: part_of UBERON:0000043 ! tendon [Term] id: CL:0000389 name: socket cell (sensu Nematoda) is_a: CL:0000619 ! supporting cell (sensu Nematoda) is_a: CL:0000658 ! cuticle secreting cell [Term] id: CL:0000390 name: blood cell (sensu Nematoda and Protostomia) is_a: CL:0000081 ! blood cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000391 name: podocyte (sensu Diptera) def: "An insect immune cell that develops from plasmatocyte." [PMID:12930778] is_a: CL:0000387 ! hemocyte (sensu Arthropoda) relationship: develops_from CL:0000394 ! plasmatocyte [Term] id: CL:0000392 name: crystal cell xref: FMA:63847 is_a: CL:0000391 ! podocyte (sensu Diptera) [Term] id: CL:0000393 name: electrically responsive cell def: "A cell whose function is determined by its response to an electric signal." [FB:ma] is_a: CL:0000211 ! electrically active cell [Term] id: CL:0000394 name: plasmatocyte xref: FBbt:00001685 is_a: CL:0000387 ! hemocyte (sensu Arthropoda) [Term] id: CL:0000395 name: procrystal cell xref: FBbt:00001689 is_a: CL:0000387 ! hemocyte (sensu Arthropoda) [Term] id: CL:0000396 name: lamellocyte xref: FBbt:00001687 is_a: CL:0000394 ! plasmatocyte [Term] id: CL:0000397 name: ganglion interneuron is_a: CL:0000099 {is_inferred="true"} ! interneuron intersection_of: CL:0000099 ! interneuron intersection_of: RO:0002100 UBERON:0000045 ! has soma location ganglion relationship: RO:0002100 UBERON:0000045 ! has soma location ganglion [Term] id: CL:0000398 name: polygonal cell xref: FBbt:00001691 is_a: CL:0000387 ! hemocyte (sensu Arthropoda) [Term] id: CL:0000399 name: obsolete phloem element def: "Obsolete. Consult Plant Ontology instead. OBSOLETED, not defined prior to obsoletion." [GOC:tfm] is_obsolete: true [Term] id: CL:0000400 name: obsolete pavement cell def: "Obsolete. Use PO:0000332 from Plant Ontology instead. An epidermal cell with a characteristic convoluted anticlinal cell wall that gives a jigsaw like appearance to the lamina." [ISBN:087694289] is_obsolete: true replaced_by: PO:0000332 [Term] id: CL:0000401 name: macrophage (sensu Diptera) is_a: CL:0000394 ! plasmatocyte [Term] id: CL:0000402 name: CNS interneuron is_a: CL:0000099 {is_inferred="true"} ! interneuron is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) is_a: CL:2000029 ! central nervous system neuron intersection_of: CL:0000099 ! interneuron intersection_of: RO:0002100 UBERON:0001017 ! has soma location central nervous system [Term] id: CL:0000404 name: electrically signaling cell def: "A cell that initiates an electrical signal and passes that signal to another cell." [FB:ma] is_a: CL:0000211 ! electrically active cell [Term] id: CL:0000405 name: neuroepidermoblast xref: FBbt:00005148 is_a: CL:0000338 ! neuroblast (sensu Nematoda and Protostomia) [Term] id: CL:0000406 name: CNS short range interneuron is_a: CL:0000402 ! CNS interneuron [Term] id: CL:0000407 name: scolopidial ligament cell xref: FBbt:00005221 is_a: CL:0000384 ! ligament cell [Term] id: CL:0000408 name: male gamete xref: BTO:0001277 xref: CALOHA:TS-0949 is_a: CL:0000015 {is_inferred="true"} ! male germ cell is_a: CL:0000300 {is_inferred="true"} ! gamete intersection_of: CL:0000015 ! male germ cell intersection_of: bearer_of PATO:0001375 ! haploid intersection_of: capable_of GO:0009566 ! fertilization [Term] id: CL:0000409 name: scolopidial sheath cell is_a: CL:0000618 ! sheath cell [Term] id: CL:0000410 name: CNS long range interneuron is_a: CL:0000402 ! CNS interneuron [Term] id: CL:0000411 name: Caenorhabditis hypodermal cell def: "An epithelial cell of the hypodermis of Caenorhabditis." [GOC:tfm, http://www.wormatlas.org/hermaphrodite/hypodermis/mainframe.htm] comment: This term was originally added to CL for parity with the Worm anatomy ontology, which is dedicated to C elegans. It is not clear if it makes sense to try and generalize the concept and include in CL, and this term may be obsoleted in future. Note there is no similarity to the hypodermis in vertebrates. synonym: "roundworm hypodermal cell" BROAD [] xref: WBbt:0007846 is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0000228 ! multinucleate cell is_a: CL:0002371 ! somatic cell relationship: in_taxon NCBITaxon:6237 ! Caenorhabditis [Term] id: CL:0000412 name: polyploid cell def: "A cell whose nucleus, or nuclei, each contain more than two haploid genomes." [FB:ma] is_a: CL:0000003 ! native cell [Term] id: CL:0000413 name: haploid cell def: "A cell whose nucleus contains a single haploid genome." [FB:ma, GOC:tfm] is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: bearer_of PATO:0001375 ! haploid relationship: bearer_of PATO:0001375 ! haploid [Term] id: CL:0000414 name: obsolete cell by ploidy def: "OBSOLETE: A classification of cells by the number of haploid genome equivalents of their nucleus or nuclei." [FB:ma, GOC:tfm] comment: This term was made obsolete because there is no difference in meaning between it and 'cell', as any cell with chromosomes can be classified by its ploidy. If you have used this term in annotation, please replace it with cell (CL:0000000), native cell (CL:0000003), eukaryotic cell (CL:0000255) or cell in vitro (CL:0001034) as appropriate. is_obsolete: true consider: CL:0000000 consider: CL:0000003 consider: CL:0000255 consider: CL:0001034 [Term] id: CL:0000415 name: diploid cell def: "A cell whose nucleus has two haploid genomes." [FB:ma] xref: FMA:72300 is_a: CL:0000003 ! native cell [Term] id: CL:0000416 name: polytene cell is_a: CL:0000412 ! polyploid cell [Term] id: CL:0000417 name: endopolyploid cell is_a: CL:0000412 ! polyploid cell [Term] id: CL:0000418 name: arcade cell def: "An epithelial cell found in C. elegans that firmly hold the outer body wall and the lips to the inner cylinder of the pharynx in a manner that keeps these organs from breaking apart, while still giving each organ freedom of movement during feeding." [GOC:tfm, http://www.wormatlas.org/ver1/handbook/hypodermis/hypsupportother.htm#arcadecells] xref: WBbt:0005793 is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell relationship: in_taxon NCBITaxon:6237 ! Caenorhabditis [Term] id: CL:0000419 name: seam cell def: "An epithelial fate stem cell found in flatworms." [GOC:tfm, http://www.wormatlas.org/hermaphrodite/seam%20cells/mainframe.htm] xref: BTO:0003039 is_a: CL:0000036 ! epithelial fate stem cell [Term] id: CL:0000420 name: syncytial epithelial cell is_a: CL:0000066 ! epithelial cell is_a: CL:0000228 ! multinucleate cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000421 name: coelomocyte def: "A free floating cell, including amebocytes and eleocytes, in the coelom of certain animals, especially annelids." [GOC:tfm, ISBN:0721662544] xref: BTO:0002856 xref: WBbt:0005751 is_a: CL:0000080 ! circulating cell is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia) [Term] id: CL:0000422 name: mitogenic signaling cell def: "A cell whose primary function is to cause growth by stimulating cell division in its immediate cellular environment." [FB:ma] is_a: CL:0000003 ! native cell [Term] id: CL:0000423 name: tip cell is_a: CL:0000422 ! mitogenic signaling cell [Term] id: CL:0000424 name: excretory cell def: "A cell involved in the elimination of metabolic and foreign toxins, and in maintaining the ionic, acid-base and water balance of biological fluids." [GOC:tfm, PMID:19783135] xref: WBbt:0005812 is_a: CL:0000151 ! secretory cell [Term] id: CL:0000425 name: pore cell def: "Forms the terminal part of the cuticle-lined excretory duct of C. elegans." [JB:jb] is_a: CL:0000658 ! cuticle secreting cell [Term] id: CL:0000426 name: obsolete scaffold cell comment: This is a cell used in tissue engineering and is out of scope for CL. property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/708 xsd:string is_obsolete: true [Term] id: CL:0000427 name: GLR cell def: "A scaffolding cell type found in C. elegans, this cell plays a supportive role to the muscle arms. May also have an endocrine role." [GOC:tfm, http://wormatlas.psc.edu/hermaphrodite/muscleGLR/mainframe.htm] is_a: CL:0002320 ! connective tissue cell [Term] id: CL:0000428 name: yolk cell is_a: CL:0000325 ! stuff accumulating cell is_a: CL:0000349 ! extraembryonic cell [Term] id: CL:0000429 name: imaginal disc cell is_a: CL:0000146 ! simple columnar epithelial cell [Term] id: CL:0000430 name: xanthophore cell def: "A pigment cell derived from the neural crest. Contains cartenoid pigments in structures called pterinosomes or xanthosomes. This gives an appearance ranging from a golden yellow to orange and red." [SANBI:mhl] synonym: "xanthophore" RELATED [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 ! pigment cell relationship: develops_from CL:0005002 ! xanthoblast [Term] id: CL:0000431 name: iridophore def: "A pigment cell derived from the neural crest. The cell contains flat light-reflecting platelets, probably of guanine, in stacks called reflecting platets or iridisomes. The color-generating components produce a silver, gold, or iridescent color." [SANBI:mhl] synonym: "guanophore" RELATED [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 ! pigment cell relationship: develops_from CL:0005001 ! iridoblast [Term] id: CL:0000432 name: reticular cell def: "A fibroblast that synthesizes collagen and uses it to produce reticular fibers, thus providing structural support. Reticular cells are found in many organs, including the spleen, lymph nodes and kidneys. Subtypes of reticular cells include epithelial, mesenchymal, and fibroblastic reticular cells. Fibroblastic reticular cells are involved in directing B cells and T cells to specific regions within a tissue, whereas epithelial and mesenchymal reticular cells are associated with certain areas of the brain." [GOC:tfm, http://en.wikipedia.org/wiki/Reticular_cell, ISBN:0517223651] synonym: "reticulum cell" EXACT [] xref: FMA:62877 is_a: CL:0000057 ! fibroblast property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/1472 xsd:string [Term] id: CL:0000433 name: obsolete functional megaspore def: "Obsolete. Use PO:0000244 from Plant Ontology instead. In monosporic and bisporic megasporogenesis: the megaspore(s) that will undergo megagametogenesis." [TAIR:lr] is_obsolete: true replaced_by: PO:0000244 [Term] id: CL:0000434 name: eccrine cell def: "A secretory cell that discharges its product without loss of cytoplasm." [ISBN:0198547684] subset: human_reference_atlas is_a: CL:0000150 ! glandular epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000435 name: alkali secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000436 name: vaginal lubricant secreting cell is_a: CL:0000151 ! secretory cell relationship: part_of UBERON:0000996 ! vagina [Term] id: CL:0000437 name: gonadtroph def: "A rounded cell that is usually situated next to sinusoids; secretes follicular stimulating hormone (FSH) and luteinizing hormone (LH)." [GOC:tfm, http://en.wikipedia.org/wiki/Gonadotroph, ISBN:0517223651] synonym: "delta basophil" EXACT [] synonym: "follicle stimulating hormone secreting cell" EXACT [] synonym: "gonadotrope" EXACT [] synonym: "gonadotrope cell" EXACT [] synonym: "gonadotroph" EXACT [] synonym: "gonadotropic cell" EXACT [] synonym: "pituitary delta cell" EXACT [] xref: BTO:0002482 xref: FMA:83100 is_a: CL:0000438 ! luteinizing hormone secreting cell is_a: CL:0000639 ! basophil cell of pars distalis of adenohypophysis [Term] id: CL:0000438 name: luteinizing hormone secreting cell def: "A peptide hormone secreting cell pituitary that produces luteinizing hormone." [GOC:tfm] is_a: CL:0000163 ! endocrine cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0032275 ! luteinizing hormone secretion relationship: capable_of GO:0032275 ! luteinizing hormone secretion [Term] id: CL:0000439 name: prolactin secreting cell def: "A peptide hormone cell that secretes prolactin." [GOC:tfm, SANBI:mhl] is_a: CL:0000154 ! protein secreting cell is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0070459 ! prolactin secretion relationship: capable_of GO:0070459 ! prolactin secretion [Term] id: CL:0000440 name: melanocyte stimulating hormone secreting cell def: "A cell of the intermediate pituitary that produces melanocyte stimulating hormone." [SANBI:mhl] synonym: "melanotrope" EXACT [] synonym: "melanotroph" EXACT [] xref: BTO:0002277 is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0036160 ! melanocyte-stimulating hormone secretion relationship: capable_of GO:0036160 ! melanocyte-stimulating hormone secretion [Term] id: CL:0000441 name: follicle stem cell xref: FBbt:00004903 is_a: CL:0000036 ! epithelial fate stem cell [Term] id: CL:0000442 name: follicular dendritic cell def: "A cell with extensive dendritic processes found in the B cell areas (primary follicles and germinal centers) of lymphoid tissue. They are unrelated to the dendritic cell associated with T cells. Follicular dendritic cells have Fc receptors and C3b receptors, but unlike other dendritic cells, they do not process or present antigen in a way that allows recognition by T cells. Instead, they hold antigen in the form of immune complexes on their surfaces for long periods and can present antigen to B cells during an immune response." [ISBN:127520252] comment: Due to its unique lineage and distinct function, this is not a type of dendritic cell; CL:0000451. subset: human_reference_atlas xref: BTO:0004267 xref: FMA:83037 xref: MESH:D020566 is_a: CL:0000473 ! defensive cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000443 name: calcitonin secreting cell is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0036161 ! calcitonin secretion relationship: capable_of GO:0036161 ! calcitonin secretion [Term] id: CL:0000444 name: obliquely striated muscle cell def: "A muscle cell in which the fibers are organised into sarcomeres but in which adjacent myofibrils are offset from each other, producing an oblique banding pattern." [GOC:DOS, PMID:8720463] comment: Examples include the somatic muscles of nemotodes and cephalopods. is_a: CL:0000737 ! striated muscle cell intersection_of: CL:0000187 ! muscle cell intersection_of: bearer_of PATO:0002479 ! obliquely striated intersection_of: has_part GO:0030017 ! sarcomere relationship: bearer_of PATO:0002479 ! obliquely striated [Term] id: CL:0000445 name: apoptosis fated cell is_a: CL:0000003 ! native cell [Term] id: CL:0000446 name: chief cell of parathyroid gland def: "An epithelial cell of the parathyroid gland that is arranged in wide, irregular interconnecting columns; responsible for the synthesis and secretion of parathyroid hormone." [FMA:69078, GOC:tfm, ISBN:0517223651] synonym: "parathyroid chief cell" EXACT [] synonym: "parathyroid gland chief cell" EXACT [] synonym: "parathyroid hormone secreting cell" EXACT [] synonym: "principal cell of parathyroid gland" EXACT [] xref: BTO:0004712 xref: CALOHA:TS-2140 xref: FMA:69078 is_a: CL:0000167 ! peptide hormone secreting cell is_a: CL:0002260 ! epithelial cell of parathyroid gland [Term] id: CL:0000447 name: carbohydrate secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000448 name: white fat cell def: "Fat cells with light coloration and few mitochondria. They contain a scant ring of cytoplasm surrounding a single large lipid droplet or vacuole." [GOC:tfm, MESH:D052438] synonym: "white adipocyte" RELATED [] synonym: "white adipose cell" EXACT [] synonym: "white fat cell" EXACT [] xref: CALOHA:TS-1119 xref: FMA:83434 is_a: CL:0000136 ! fat cell relationship: develops_from CL:0002334 ! preadipocyte relationship: part_of UBERON:0001347 ! white adipose tissue [Term] id: CL:0000449 name: brown fat cell def: "A cell from the thermogenic form of adipose tissue found in many species, particularly in newborns and hibernating mammals, but also in lesser amounts in adults of other mammals including humans. Brown fat is capable of rapid liberation of energy and seems to be important in the maintenance of body temperature immediately after birth and upon waking from hibernation." [MESH:D002001] synonym: "brown adipocyte" EXACT [] synonym: "brown adipose cell" EXACT [] xref: CALOHA:TS-0099 xref: FMA:83435 is_a: CL:0000136 ! fat cell relationship: develops_from CL:0002335 ! brown preadipocyte relationship: part_of UBERON:0001348 ! brown adipose tissue [Term] id: CL:0000451 name: dendritic cell def: "A cell of hematopoietic origin, typically resident in particular tissues, specialized in the uptake, processing, and transport of antigens to lymph nodes for the purpose of stimulating an immune response via T cell activation. These cells are lineage negative (CD3-negative, CD19-negative, CD34-negative, and CD56-negative)." [GOC:add, ISBN:0781735149] subset: human_reference_atlas synonym: "interdigitating cell" RELATED [] synonym: "veiled cell" RELATED [] xref: BTO:0002042 xref: CALOHA:TS-0194 xref: FMA:83036 xref: MESH:D003713 is_a: CL:0000145 ! professional antigen presenting cell is_a: CL:0000842 ! mononuclear cell intersection_of: CL:0000738 ! leukocyte intersection_of: bearer_of PATO:0001407 ! mononucleate intersection_of: capable_of GO:0001816 ! cytokine production intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II intersection_of: capable_of GO:0019882 ! antigen processing and presentation intersection_of: capable_of GO:0045580 ! regulation of T cell differentiation intersection_of: has_part GO:0042613 ! MHC class II protein complex intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 disjoint_from: CL:0000542 ! lymphocyte relationship: capable_of GO:0001816 ! cytokine production relationship: capable_of GO:0045580 ! regulation of T cell differentiation relationship: has_part GO:0042613 ! MHC class II protein complex relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001003 ! CD34 molecule relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000452 name: thyroid hormone secreting cell is_a: CL:0000163 ! endocrine cell [Term] id: CL:0000453 name: Langerhans cell def: "Langerhans cell is a conventional dendritic cell that has plasma membrane part CD207. A Langerhans cell is a stellate dendritic cell of myeloid origin, that appears clear on light microscopy and has a dark-staining, indented nucleus and characteristic inclusions (Birbeck granules) in the cytoplasm; Langerhans cells are found principally in the stratum spinosum of the epidermis, but they also occur in other stratified epithelia and have been identified in the lung, lymph nodes, spleen, and thymus." [GO_REF:0000031, GOC:add, GOC:amm, ISBN:0721601464, ISBN:0781735149, PMCID:PMC2346585, PMID:17850486] comment: Originally described in the dendritic cell ontology (DC_CL:0000021 )(PMID:19243617). These cells are also CD1a-high, CD14-negative, CD207-positive (langerin), CD324-positive (E-cadherin), and DCIR-positive. They reside in the epidermis. subset: human_reference_atlas synonym: "LC" EXACT [] xref: BTO:0000705 xref: CALOHA:TS-2375 xref: FMA:63072 xref: MESH:D007801 is_a: CL:0000766 ! myeloid leukocyte is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell intersection_of: CL:0000990 ! conventional dendritic cell intersection_of: capable_of GO:0002828 ! regulation of type 2 immune response intersection_of: RO:0002104 PR:000001293 ! has plasma membrane part C-type lectin domain family 4 member K relationship: capable_of GO:0002828 ! regulation of type 2 immune response relationship: develops_from CL:0000763 ! myeloid cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001293 ! has plasma membrane part C-type lectin domain family 4 member K [Term] id: CL:0000454 name: epinephrine secreting cell def: "A cell capable of producing epinephrine. Epiniphrine is synthesized from norepiniphrine by the actions of the phenylethanolamine N-methyltransferase enzyme, which is expressed in the adrenal glands, androgenic neurons, and in other cell types." [GOC:tfm, PMID:12438093] synonym: "adrenaline secreting cell" EXACT [GO:0048242] synonym: "epinephrin secreting cell" EXACT [] is_a: CL:0000457 ! biogenic amine secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0048242 ! epinephrine secretion relationship: capable_of GO:0048242 ! epinephrine secretion [Term] id: CL:0000455 name: obsolete starch sheath cell def: "Obsolete. Use PO:0004531 from Plant Ontology instead. A cell characterized by conspicuous and rather stable accumulation of starch." [ISBN:044174520] is_obsolete: true replaced_by: PO:0004531 [Term] id: CL:0000456 name: mineralocorticoid secreting cell is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035931 ! mineralocorticoid secretion relationship: capable_of GO:0035931 ! mineralocorticoid secretion [Term] id: CL:0000457 name: biogenic amine secreting cell is_a: CL:0000151 ! secretory cell [Term] id: CL:0000458 name: serotonin secreting cell def: "A cell type that secretes 5-Hydroxytryptamine (serotonin)." [GOC:tfm, PMID:19630576] synonym: "5-HT secreting cell" EXACT [] synonym: "5-Hydroxytryptamine secreting cell" EXACT [] is_a: CL:0000457 ! biogenic amine secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0001820 ! serotonin secretion relationship: capable_of GO:0001820 ! serotonin secretion [Term] id: CL:0000459 name: noradrenergic cell def: "A cell capable of producting norepiniphrine. Norepiniphrine is a catecholamine with multiple roles including as a hormone and a neurotransmitter. In addition, epiniphrine is synthesized from norepiniphrine by the actions of the phenylethanolamine N-methyltransferase enzyme." [GOC:tfm, ISBN:068340007X] synonym: "noradrenaline secreting cell" EXACT [] synonym: "norepinephrin secreting cell" EXACT [] synonym: "norepinephrine secreting cell" EXACT [] is_a: CL:0000457 ! biogenic amine secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0048243 ! norepinephrine secretion relationship: capable_of GO:0048243 ! norepinephrine secretion [Term] id: CL:0000460 name: glucocorticoid secreting cell is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035933 ! glucocorticoid secretion relationship: capable_of GO:0035933 ! glucocorticoid secretion [Term] id: CL:0000462 name: adepithelial cell xref: FBbt:00003219 is_a: CL:0000680 ! muscle precursor cell [Term] id: CL:0000463 name: epidermal cell (sensu Arthropoda) def: "An epidermal cell that secretes chitinous cuticle from its apical side." [FlyBase:ds, ISBN:ISBN\:978-0801481253] comment: While insect epidermis is generally columnar/cuboidal, there are certainly well studied cases where it is not (e.g.- Rhodnius prolixus when starved). So it would be safer to add this as a differentium for particular species where this is known. -DSJ. is_a: CL:0000362 ! epidermal cell is_a: CL:0000710 ! neurecto-epithelial cell relationship: develops_from CL:0000464 ! epidermoblast relationship: only_in_taxon NCBITaxon:6656 ! Arthropoda [Term] id: CL:0000464 name: epidermoblast def: "An epidermal progenitor cell that arises from neuroectoderm and in turn gives rise to the epidermal sheath of ventral and cephalic regions." [GOC:tfm, PMID:7576311] xref: FBbt:00004994 is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0000710 ! neurecto-epithelial cell relationship: develops_from CL:0000114 ! surface ectodermal cell [Term] id: CL:0000465 name: cardioblast (sensu Arthropoda) xref: FBbt:00001666 is_a: CL:0010021 ! cardiac myoblast [Term] id: CL:0000467 name: adrenocorticotropic hormone secreting cell alt_id: CL:0000640 def: "A peptide hormone secreting cell that produces adrenocorticotropin, or corticotropin." [GOC:tfm, SANBI:mhl] synonym: "ACTH secreting cell" EXACT [GO:0051458] synonym: "adrenocorticotrophic hormone secreting cell" EXACT [] synonym: "corticotrophin hormone secreting cell" EXACT [] synonym: "corticotropin hormone secreting cell" EXACT [] synonym: "corticotropin secreting cell" EXACT [GO:0051458] is_a: CL:0000163 ! endocrine cell is_a: CL:0000167 ! peptide hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0051458 ! corticotropin secretion relationship: capable_of GO:0051458 ! corticotropin secretion [Term] id: CL:0000468 name: neuroglioblast (sensu Nematoda and Protostomia) synonym: "neuroglioblast" EXACT [] xref: FBbt:00005147 is_a: CL:0000047 ! neural stem cell relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000469 name: ganglion mother cell def: "A neural progenitor cell that is the daughter of a neuroblast (sensu arthopoda). The progeny of ganglion mother cells develop into neurons, glia and (occasionally) epithelial cells." [] xref: FBbt:00005149 is_a: CARO:0000000 ! anatomical entity is_a: CL:0011020 ! neural progenitor cell relationship: develops_from CL:0000338 ! neuroblast (sensu Nematoda and Protostomia) [Term] id: CL:0000470 name: digestive enzyme secreting cell is_a: CL:0000154 ! protein secreting cell [Term] id: CL:0000472 name: obsolete chlorenchyma cell def: "Obsolete. Use PO:0000076 from Plant Ontology instead. OBSOLETE, use term from Plant Ontology. Parenchyma cells containing chloroplasts; a component of leaf mesophyll and other green parenchyma tissue." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000076 [Term] id: CL:0000473 name: defensive cell def: "A cell whose primary function is to protect the organism." [JB:jb] is_a: CL:0000003 ! native cell [Term] id: CL:0000474 name: pericardial nephrocyte def: "An insect renal cell that filters hemolymph and is found with other pericardial nephrocytes in two rows flanking the dorsal vessel." [FBbt:00003184, GO:0061320, GOC:tfm, PMID:19783135] synonym: "pericardial cell" NARROW [FBbt:00005058, GO:0061320] xref: FBbt:00005058 is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia) is_a: CL:0002520 ! nephrocyte [Term] id: CL:0000475 name: obsolete degenerate megaspore def: "Obsolete. Use PO:0000245 from Plant Ontology instead. In monosporic and bisporic megasporogenesis: the megaspore(s) that do not participate in megagametogenesis." [TAIR:lr] is_obsolete: true replaced_by: PO:0000245 [Term] id: CL:0000476 name: thyrotroph def: "A basophil cell of the anterior pituitary that produces thyroid stimulating hormone, thyrotrophin. This cell type is elongated, polygonal and lie in clusters towards the adenohypophyseal center." [ISBN:0517223651, SANBI:mhl] synonym: "beta-basophil" EXACT [] synonym: "thyroid stimulating hormone secreting cell" EXACT [] synonym: "thyrotrope" EXACT [] xref: FMA:83099 xref: MESH:D052684 is_a: CL:0000639 ! basophil cell of pars distalis of adenohypophysis relationship: capable_of GO:0070460 ! thyroid-stimulating hormone secretion [Term] id: CL:0000477 name: follicle cell of egg chamber def: "A somatic epithelial cell of the insect egg chamber." [] synonym: "follicle cell" BROAD [] synonym: "ovarian follicle cell" BROAD [] xref: FBbt:00004904 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000500 ! follicular epithelial cell is_a: CL:2000064 ! ovarian surface epithelial cell relationship: develops_from CL:0000441 ! follicle stem cell relationship: only_in_taxon NCBITaxon:50557 {source="https://github.com/obophenotype/cell-ontology/issues/589"} ! Insecta [Term] id: CL:0000478 name: oxytocin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes oxytocin stimulating hormone" [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000479 name: vasopressin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes vasopressin stimulating hormone" [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000480 name: secretin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes secretin stimulating hormone" [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000481 name: cholecystokin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes cholecystokin stimulating hormone." [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000482 name: juvenile hormone secreting cell def: "An endocrine cell that secretes juvenile hormone." [GO:tfm] is_a: CL:0000163 ! endocrine cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0045443 ! juvenile hormone secretion relationship: capable_of GO:0045443 ! juvenile hormone secretion [Term] id: CL:0000483 name: bombesin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes bombesin stimulating hormone." [GO:tfm, https://orcid.org/0000-0001-5208-3432] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000484 name: connective tissue type mast cell def: "Mast cell subtype whose granules contain both the serine proteases tryptase and chymase. These cells are primarily found in connective tissue, such as the peritoneal cavity, skin, and intestinal submucosa. Their development is T-cell independent." [GOC:add, GOC:dsd, GOC:tfm, PMID:19923473, PMID:9354811] comment: They are CD88-positive. The cytoplasmic granules contain high levels of histamine and heparin (mouse) or major neutral proteases, tryptase, chymase, carboxypeptidase A, and cathepsin G (humans). Reportedly, they cannot produce leukotrienes (LTC4) and IL-4. They are reportedly very heterogeneous depending upon location and can convert to the MC(T) phenotype. subset: human_reference_atlas synonym: "MC(TC)" EXACT [] synonym: "MCTC" EXACT [] synonym: "TC mast cells" EXACT [] is_a: CL:0000097 {is_inferred="true"} ! mast cell is_a: CL:0002320 ! connective tissue cell intersection_of: CL:0000097 ! mast cell intersection_of: part_of UBERON:0002384 ! connective tissue relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000485 name: mucosal type mast cell def: "Mast cell subtype that contains only the serine protease trypase in its granules. These cells are primarily found in mucosal tissue, such as intestinal mucosa and alveoli. They depend upon T-cells for development of phenotype." [GOC:add, GOC:dsd, PMID:19923473, PMID:9354811] comment: They are CD88-negative. The cytoplasmic granules contain low levels of histamine and high levels of chondroitin sulfate (mouse) or major neutral proteases and tryptase (humans). Additionally, they can produce leukotrienes (LTC4), IL-5, IL-6, and low levels of IL-4. They are reportedly very heterogeneous depending upon location and can convert to the MC(T) phenotype. subset: human_reference_atlas synonym: "MC(T)" EXACT [] synonym: "MCT" EXACT [] synonym: "T mast cells" EXACT [] is_a: CL:0000097 {is_inferred="true"} ! mast cell intersection_of: CL:0000097 ! mast cell intersection_of: capable_of GO:0002540 ! leukotriene production involved in inflammatory response intersection_of: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue relationship: capable_of GO:0002540 ! leukotriene production involved in inflammatory response relationship: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000486 name: garland cell def: "A large binucleate cell that forms a 'garland' around the anterior end of the proventriculus (cardia) at its junction with the esophagus in both adults and larvae flies. Each cell is surrounded by a basement membrane and there are numerous micro-invaginations (lacunae) extending from the surface into the cytoplasm. At the mouth of each lacuna is a doubled filament forming a specialised filtration system (diaphragm). The filtrate is endocytosed from the lacunae." [fbbt:00005059, GOC:tfm, PMID:19783135] synonym: "garland nephrocyte" BROAD [GO:0061321] xref: BTO:0004596 xref: FBbt:00005059 is_a: CL:0000227 ! binucleate cell is_a: CL:0000519 ! phagocyte (sensu Nematoda and Protostomia) is_a: CL:0002520 ! nephrocyte [Term] id: CL:0000487 name: oenocyte def: "A large secretory cell found in clusters underlying the epidermis of the abdominal segments of larval abdominal segments." [GOC:bf, PMID:11171397] xref: FBbt:00004995 is_a: CL:0000151 ! secretory cell relationship: in_taxon NCBITaxon:6656 ! Arthropoda [Term] id: CL:0000488 name: visible light photoreceptor cell def: "A photoreceptor cell that detects visible light." [GOC:tfm] is_a: CL:0000210 ! photoreceptor cell intersection_of: CL:0000210 ! photoreceptor cell intersection_of: capable_of GO:0009584 ! detection of visible light relationship: capable_of GO:0009584 ! detection of visible light [Term] id: CL:0000489 name: scotopic photoreceptor cell is_a: CL:0000210 ! photoreceptor cell [Term] id: CL:0000490 name: photopic photoreceptor cell is_a: CL:0000488 ! visible light photoreceptor cell [Term] id: CL:0000491 name: obsolete cytotoxic T cell def: "OBSOLETE: A cell responsible for spontaneous cytotoxicity of a variety of tumor cells without prior immunization. These natural killer cells are found in non-immune humans and experimental animals and are thought by some to be the same as killer cells (killing by antibody-dependent cell cytotoxicity), but they can also kill in the absence of antibody." [] comment: This term had an incorrect definition and was overly broad. Consider using 'cytotoxic T cell ; CL:0000910' (in most cases) or another lymphocyte cell type if cytotoxicity is shown to be part of the cell's phenotype in a particular experimental situation. is_obsolete: true [Term] id: CL:0000492 name: CD4-positive helper T cell def: "A CD4-positive, alpha-beta T cell that cooperates with other lymphocytes via direct contact or cytokine release to initiate a variety of immune functions." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149, MESH:D006377] subset: human_reference_atlas synonym: "CD4-positive helper T lymphocyte" EXACT [] synonym: "CD4-positive helper T-cell" EXACT [] synonym: "CD4-positive helper T-lymphocyte" EXACT [] synonym: "CD4-positive T-helper cell" EXACT [] xref: CALOHA:TS-1146 xref: FMA:70572 is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: capable_of GO:0001816 ! cytokine production relationship: capable_of GO:0001816 ! cytokine production relationship: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell relationship: has_completed GO:0030217 ! T cell differentiation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000493 name: obsolete regulatory T cell def: "OBSOLETE: Subpopulation of CD4+ cells which induce CD8+ suppressor T cells to suppress antibody production by B cells. They also stimulate other cellular immune responses." [] comment: This term was defined too narrowly; consider using the term 'regulatory T cell ; CL:0000815' instead. is_obsolete: true [Term] id: CL:0000494 name: UV sensitive photoreceptor cell def: "A photoreceptor cell that detects ultraviolet light." [GOC:tfm] is_a: CL:0000210 ! photoreceptor cell intersection_of: CL:0000210 ! photoreceptor cell intersection_of: capable_of GO:0009589 ! detection of UV relationship: capable_of GO:0009589 ! detection of UV [Term] id: CL:0000495 name: blue sensitive photoreceptor cell def: "A photoreceptor cell that is sensitive to blue light." [GO:tfm] is_a: CL:0000490 ! photopic photoreceptor cell [Term] id: CL:0000496 name: green sensitive photoreceptor cell def: "A photoreceptor cell that is sensitive to green light." [GO:tfm] is_a: CL:0000490 ! photopic photoreceptor cell [Term] id: CL:0000497 name: red sensitive photoreceptor cell def: "A photoreceptor cell that is sensitive to red light." [GO:tfm] is_a: CL:0000490 ! photopic photoreceptor cell [Term] id: CL:0000498 name: inhibitory interneuron def: "An interneuron (also called relay neuron, association neuron or local circuit neuron) is a multipolar neuron which connects afferent neurons and efferent neurons in neural pathways. Like motor neurons, interneuron cell bodies are always located in the central nervous system (CNS)." [GOC:tfm, http://en.wikipedia.org/wiki/Interneuron] xref: FMA:84776 is_a: CL:0000099 ! interneuron [Term] id: CL:0000499 name: stromal cell def: "A connective tissue cell of an organ found in the loose connective tissue. These are most often associated with the uterine mucosa and the ovary as well as the hematopoietic system and elsewhere." [GOC:tfm, MESH:D017154] subset: human_reference_atlas xref: BTO:0002064 xref: FMA:83624 is_a: CARO:0000000 ! anatomical entity is_a: CL:0002320 ! connective tissue cell relationship: develops_from CL:0000134 ! mesenchymal stem cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000500 name: follicular epithelial cell def: "An epithelial somatic cell associated with a maturing oocyte." [] is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000501 name: granulosa cell def: "A supporting cell for the developing female gamete in the ovary of mammals. They develop from the coelomic epithelial cells of the gonadal ridge. Granulosa cells form a single layer around the mammalian oocyte in the primordial ovarian follicle and advance to form a multilayered cumulus oophorus surrounding the ovum in the Graafian follicle. The major functions of granulosa cells include the production of steroids and LH receptors." [MESH:D006107] synonym: "granulosa cell of ovary" EXACT [] xref: BTO:0000542 xref: CALOHA:TS-0729 xref: FMA:18718 is_a: CL:0000174 ! steroid hormone secreting cell is_a: CL:0002174 ! follicular cell of ovary [Term] id: CL:0000502 name: type D enteroendocrine cell def: "A cell found throughout the gastrointestinal tract and in the pancreas. They secrete somatostatin in both an endocrine and paracrine manner. Somatostatin inhibits gastrin, cholecystokinin, insulin, glucagon, pancreatic enzymes, and gastric hydrochloric acid. A variety of substances which inhibit gastric acid secretion (vasoactive intestinal peptide, calcitonin gene-related peptide, cholecystokinin, beta-adrenergic agonists, and gastric inhibitory peptide) are thought to act by releasing somatostatin." [MESH:D019864] synonym: "D cell" EXACT [] xref: FMA:62935 is_a: CL:0000164 ! enteroendocrine cell is_a: CL:0000172 ! somatostatin secreting cell [Term] id: CL:0000503 name: theca cell def: "A flattened stroma cell forming a sheath or theca outside the basal lamina lining the mature ovarian follicle. Thecal interstitial or stromal cells are steroidogenic, and produce primarily androgens which serve as precusors of estrogens in the granulosa cells." [MESH:D013799] subset: human_reference_atlas xref: BTO:0002850 xref: FMA:18690 is_a: CL:0000593 ! androgen secreting cell is_a: CL:0002132 ! stromal cell of ovary relationship: part_of UBERON:0001305 ! ovarian follicle relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000504 name: enterochromaffin-like cell def: "A enteroendocrine cell part of the glands of the gastric mucosa. They produce histamine and peptides such as chromogranins. This cell type respond to gastrin by releasing histamine which acts as a paracrine stimulator of the release of hydrochloric acid from the gastric parietal cells." [GOC:tfm, MESH:D019861] comment: Consider enterochromaffin cell (CL:0002065). For several years this cell type was "enterochromaffin cell" despite a MESH dbxref and a free text definition that clearly meant enterochromaffin-like cell. synonym: "ECL" EXACT [] xref: BTO:0002692 is_a: CL:0000164 ! enteroendocrine cell is_a: CL:0002274 ! histamine secreting cell [Term] id: CL:0000505 name: substance P secreting cell def: "A peptide hormone secreting cell that secretes substance P." [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000506 name: enkephalin secreting cell def: "An endorphine cell that secretes enkephalin." [GO:tfm] is_a: CL:0000507 ! endorphin secreting cell [Term] id: CL:0000507 name: endorphin secreting cell def: "A peptide hormone secreting cell that secretes endorphin." [GO:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000508 name: type G enteroendocrine cell def: "An endocrine cell found in the pyloric gland mucosa (antral mucosa) of the stomach of mammals and responsible for the secretion of gastrin and enkephalin. Most abundant in pyloric antrum, pyramidal in form with a narrow apex bearing long microvilli." [GOC:tfm, ISBN:0517223651, MESH:D019863] synonym: "G cell" EXACT [] xref: BTO:0004108 xref: FMA:67609 is_a: CL:0000164 ! enteroendocrine cell is_a: CL:0000506 ! enkephalin secreting cell is_a: CL:0000509 ! gastrin secreting cell is_a: CL:0002180 ! mucous cell of stomach relationship: part_of UBERON:0004997 ! mucosa of pyloric antrum [Term] id: CL:0000509 name: gastrin secreting cell def: "A peptide hormone secreting cell that secretes gastrin." [GO:tfm] subset: human_reference_atlas is_a: CL:0000167 ! peptide hormone secreting cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000510 name: paneth cell def: "An epithelial cell found in the basal part of the intestinal glands (crypts of Lieberkuhn) including the appendix. Paneth cells synthesize and secrete lysozyme and cryptdins. Numerous in the deeper parts of the intestinal crypts, particularly in the duodenum, rich in zinc, contain large acidophilic granules, with irregular apical microvilli and prominent membrane-bound vacuoles containing matrix." [GOC:tfm, ISBN:0517223651, MESH:D019879] xref: BTO:0000993 xref: FMA:62897 is_a: CL:0000150 {is_inferred="true"} ! glandular epithelial cell is_a: CL:0000323 ! lysozyme secreting cell is_a: CL:0002563 ! intestinal epithelial cell [Term] id: CL:0000511 name: androgen binding protein secreting cell def: "A peptide hormone secreting cell that secretes androgen binding protein." [GO:tfm] is_a: CL:0000154 ! protein secreting cell [Term] id: CL:0000512 name: paracrine cell def: "A paracrine cell is a secretory cell that secretes an agonist into intercellular spaces in which it diffuses to a target cell other than that which produced it." [GOC:tfm, ISBN:0198529171] is_a: CL:0000151 ! secretory cell [Term] id: CL:0000513 name: cardiac muscle myoblast alt_id: CL:0000714 def: "A precursor cell destined to differentiate into cardiac muscle cell." [GOC:tfm, MESH:D032386] synonym: "cardiac muscle progenitor cell" EXACT [] synonym: "cardiomyocyte progenitor cell" EXACT [] xref: FMA:84797 is_a: CL:0002494 ! cardiocyte is_a: CL:0010021 ! cardiac myoblast intersection_of: CL:0000056 ! myoblast intersection_of: part_of UBERON:0001133 ! cardiac muscle tissue intersection_of: RO:0002203 CL:0000746 ! develops into cardiac muscle cell relationship: part_of UBERON:0001133 ! cardiac muscle tissue [Term] id: CL:0000514 name: smooth muscle myoblast def: "A precursor cell destined to differentiate into smooth muscle myocytes." [GOC:tfm, MESH:D032390] synonym: "myoblast, smooth muscle" EXACT [MESH:D032390] synonym: "satellite cell" RELATED [] xref: FMA:84798 is_a: CL:0000056 {is_inferred="true"} ! myoblast intersection_of: CL:0000056 ! myoblast intersection_of: RO:0002203 CL:0000192 ! develops into smooth muscle cell relationship: RO:0002203 CL:0000192 ! develops into smooth muscle cell [Term] id: CL:0000515 name: skeletal muscle myoblast def: "A myoblast that differentiates into skeletal muscle fibers." [SANBI:mhl] synonym: "skeletal myoblast" EXACT [] xref: FMA:84799 is_a: CL:0000056 {is_inferred="true"} ! myoblast is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000056 ! myoblast intersection_of: RO:0002203 CL:0008002 ! develops into skeletal muscle fiber relationship: develops_from CL:0000355 ! multi-potent skeletal muscle stem cell relationship: RO:0002203 CL:0008002 ! develops into skeletal muscle fiber [Term] id: CL:0000516 name: perineuronal satellite cell def: "A non-neuronal cell that surrounds the neuronal cell bodies of the ganglia." [GOC:tfm, MESH:D027161] synonym: "perineural satellite cell" EXACT [] synonym: "perineuronal satellite oligodendroglial cell" EXACT [] synonym: "satellite oligodendrocyte" EXACT [] xref: FMA:54550 is_a: CL:0000123 ! neuron associated cell (sensu Vertebrata) relationship: develops_from CL:0000339 ! glioblast (sensu Vertebrata) [Term] id: CL:0000517 name: macrophage derived foam cell def: "A type of foam cell derived from a macrophage containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add, PMID:20213546] synonym: "lipophage" EXACT [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000891 ! foam cell relationship: develops_from CL:0000235 ! macrophage [Term] id: CL:0000518 name: phagocyte (sensu Vertebrata) def: "A phagocyte in vertebrates that is able to phagocytosis." [GOC:tfm] is_a: CL:0000234 ! phagocyte is_a: CL:0000548 ! animal cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata [Term] id: CL:0000519 name: phagocyte (sensu Nematoda and Protostomia) def: "A phagocyte from organisms in the Nematoda or Protostomia clades." [GOC:tfm] is_a: CL:0000234 ! phagocyte relationship: never_in_taxon NCBITaxon:33511 ! Deuterostomia [Term] id: CL:0000520 name: prokaryotic cell xref: MESH:D011387 is_a: CL:0000003 ! native cell relationship: never_in_taxon NCBITaxon:2759 ! Eukaryota [Term] id: CL:0000521 name: fungal cell is_a: CL:0000255 ! eukaryotic cell intersection_of: CL:0000003 ! native cell intersection_of: only_in_taxon NCBITaxon:4751 ! Fungi disjoint_from: CL:0000548 ! animal cell relationship: only_in_taxon NCBITaxon:4751 ! Fungi [Term] id: CL:0000522 name: obsolete spore def: "OBSOLETE: The reproductive structure of bacteria, fungi and cryptograms." [ISBN:08199377X] is_obsolete: true [Term] id: CL:0000523 name: mononuclear cytotrophoblast cell def: "A cell from the inner layer of the trophoblast of the early mammalian embryo that gives rise to the outer surface and villi of the chorion. Mononuclear crytoblasts fuse to give rise to a multinuclear cytotrophoblast." [GOC:tfm, ISBN:0323052908] subset: human_reference_atlas xref: FMA:83042 is_a: CL:0000351 ! trophoblast cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000524 name: spheroplast def: "A cell, usually of bacteria or yeast, which has partially lost its cell wall." [MESH:D013104] synonym: "sphaeroplast" EXACT [] is_a: CL:0000371 ! protoplast [Term] id: CL:0000525 name: syncytiotrophoblast cell def: "A cell from the outer syncytial layer of the trophoblast of an early mammalian embryo, directly associated with the maternal blood supply. It secretes hCG in order to maintain progesterone secretion and sustain a pregnancy." [GOC:tfm, ISBN:0323052908] subset: human_reference_atlas synonym: "plasmidotrophoblast" EXACT [] synonym: "syncytial trophoblast" EXACT [] synonym: "syntrophoblast" EXACT [] xref: FMA:83043 is_a: CL:0000228 ! multinucleate cell is_a: CL:2000060 ! placental villous trophoblast intersection_of: CL:0000351 ! trophoblast cell intersection_of: bearer_of PATO:0001908 ! multinucleate relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000526 name: afferent neuron def: "A neuron which conveys sensory information centrally from the periphery." [GOC:tfm, MESH:D009475] subset: human_reference_atlas synonym: "input neuron" EXACT [] xref: FMA:87653 is_a: CL:0000540 ! neuron relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000527 name: efferent neuron def: "A neuron which sends impulses peripherally to activate muscles or secretory cells." [MESH:D009476] synonym: "output neuron" EXACT [] is_a: CL:0000540 ! neuron [Term] id: CL:0000528 name: nitrergic neuron def: "A nerve cell where transmission is mediated by nitric oxide." [MESH:D026602] xref: FMA:84792 is_a: CL:0000540 ! neuron [Term] id: CL:0000529 name: pigmented epithelial cell is_a: CL:0000710 ! neurecto-epithelial cell [Term] id: CL:0000530 name: primary neuron is_a: CL:0000540 ! neuron [Term] id: CL:0000531 name: primary sensory neuron is_a: CL:0000101 ! sensory neuron is_a: CL:0000530 ! primary neuron intersection_of: CL:0000101 ! sensory neuron intersection_of: CL:0000530 ! primary neuron [Term] id: CL:0000532 name: CAP motoneuron is_a: CL:0000533 ! primary motor neuron [Term] id: CL:0000533 name: primary motor neuron xref: FMA:83619 is_a: CL:0000100 ! motor neuron is_a: CL:0000530 ! primary neuron [Term] id: CL:0000534 name: primary interneuron is_a: CL:0000099 ! interneuron is_a: CL:0000530 ! primary neuron [Term] id: CL:0000535 name: secondary neuron is_a: CL:0000540 ! neuron [Term] id: CL:0000536 name: secondary motor neuron xref: FMA:83620 is_a: CL:0000100 ! motor neuron is_a: CL:0000535 ! secondary neuron intersection_of: CL:0000100 ! motor neuron intersection_of: CL:0000535 ! secondary neuron [Term] id: CL:0000537 name: obsolete antipodal cell def: "Obsolete. Use PO:0020093 from Plant Ontology instead. OBSOLETE, use term from plant ontology. A cell located at the chalazal end of the mature embryo sac in angiosperms." [ISBN:047125208] is_obsolete: true replaced_by: PO:0020093 [Term] id: CL:0000538 name: obsolete epidermal initial def: "Obsolete. Use PO:0000349 from Plant Ontology instead. A relatively unspecialized cell that will give rise to specialized cell types of the epidermis." [TAIR:lr] is_obsolete: true replaced_by: PO:0000349 [Term] id: CL:0000539 name: obsolete idioblast def: "OBSOLETE: A cell in a tissue that markedly differs in form, size, or contents from other cells in the same tissue." [ISBN:0471245208] is_obsolete: true [Term] id: CL:0000540 name: neuron def: "The basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system." [http://en.wikipedia.org/wiki/Neuron, MESH:D009474] comment: These cells are also reportedly CD4-negative and CD200-positive. They are also capable of producing CD40L and IFN-gamma. subset: human_reference_atlas synonym: "nerve cell" EXACT [] xref: BTO:0000938 xref: CALOHA:TS-0683 xref: FBbt:00005106 xref: FMA:54527 xref: VHOG:0001483 xref: WBbt:0003679 is_a: BFO:0000040 ! material entity is_a: CL:0000393 ! electrically responsive cell is_a: CL:0000404 ! electrically signaling cell is_a: CL:0002319 ! neural cell relationship: capable_of GO:0019226 ! transmission of nerve impulse relationship: develops_from CL:0000031 {gci_relation="in_taxon", gci_filler="NCBITaxon:7742", xref="https://github.com/obophenotype/cell-ontology/issues/757"} ! neuroblast (sensu Vertebrata) relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000541 name: melanoblast def: "A cell that originates from the neural crest and differentiates into a pigment cell." [GOC:tfm, SANBI:mhl] comment: Derived from UBERON:0002342 neural crest. xref: BTO:0003217 xref: FMA:83377 is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0002371 ! somatic cell is_a: CL:0011026 ! progenitor cell relationship: develops_from CL:0000333 ! migratory neural crest cell [Term] id: CL:0000542 name: lymphocyte def: "A lymphocyte is a leukocyte commonly found in the blood and lymph that has the characteristics of a large nucleus, a neutral staining cytoplasm, and prominent heterochromatin." [GOC:add, ISBN:0683073696, ISBN:0781735149] comment: Editors note: consider adding taxon constraint to vertebrata (PMID:18025161) subset: human_reference_atlas xref: BTO:0000775 xref: CALOHA:TS-0583 xref: FMA:62863 xref: MESH:D008214 xref: VHOG:0001535 is_a: CL:0000842 ! mononuclear cell intersection_of: CL:0000738 ! leukocyte intersection_of: bearer_of PATO:0001407 ! mononucleate intersection_of: has_part CL:0017500 ! neutrophillic cytoplasm intersection_of: has_part CL:0017505 ! increased nucleus size intersection_of: has_part GO:0000792 ! heterochromatin disjoint_from: CL:0000766 ! myeloid leukocyte relationship: develops_from CL:0000051 ! common lymphoid progenitor relationship: has_part CL:0017500 ! neutrophillic cytoplasm relationship: has_part CL:0017505 ! increased nucleus size relationship: has_part GO:0000792 ! heterochromatin relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000543 name: obsolete sieve tube member def: "Obsolete. Use PO:0000289 from Plant Ontology instead. One of the series of cellular components of a sieve tube. It shows a more or less pronounced differentiation between sieve plates (wide pores) and lateral sieve areas (narrow pores). Also sieve tube element and the obsolete sieve tube segment." [ISBN:0471245208] synonym: "sieve tube element" EXACT [] is_obsolete: true replaced_by: PO:0000289 [Term] id: CL:0000544 name: slowly adapting mechanoreceptor cell is_a: CL:0000199 ! mechanoreceptor cell [Term] id: CL:0000545 name: T-helper 1 cell def: "A CD4-positive, alpha-beta T cell that has the phenotype T-bet-positive, CXCR3-positive, CCR6-negative, and is capable of producing interferon-gamma." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19375293, PMID:20303875, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'Th1 CD4+ T cell', but its logical definition includes additional known characteristics of T-helper 1 T cells. subset: human_reference_atlas synonym: "helper T cell type 1" EXACT [] synonym: "T helper cells type 1" EXACT [PMID:9419219] synonym: "T(H)-1 cell" EXACT [] synonym: "Th1 CD4+ T cell" EXACT [PMID:22343568] synonym: "Th1 cell" EXACT [] synonym: "Th1 T cell" EXACT [] synonym: "Th1 T lymphocyte" EXACT [] synonym: "Th1 T-cell" EXACT [] synonym: "Th1 T-lymphocyte" EXACT [] xref: BTO:0001678 xref: FMA:84382 is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell intersection_of: CL:0000492 ! CD4-positive helper T cell intersection_of: capable_of GO:0032609 ! type II interferon production intersection_of: has_part PR:000001835 ! T-box transcription factor TBX21 intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 intersection_of: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3 relationship: capable_of GO:0032609 ! type II interferon production relationship: has_part PR:000001835 ! T-box transcription factor TBX21 relationship: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3 [Term] id: CL:0000546 name: T-helper 2 cell def: "A CD4-positive, alpha-beta T cell that has the phenotype GATA-3-positive, CXCR3-negative, CCR6-negative, and is capable of producing interleukin-4." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19375293, PMID:20103781, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'non-Th1/Th17 CD4+ T cell' (see CL:0001051), but includes the additional necessary and sufficient conditions to allow classification as a T-helper 2 T cell. subset: human_reference_atlas synonym: "helper T cell type 2" EXACT [] synonym: "T helper cells type 2" EXACT [PMID:9419219] synonym: "T(H)-2 cell" EXACT [] synonym: "Th2 cell" EXACT [] synonym: "Th2 T cell" EXACT [] synonym: "Th2 T lymphocyte" EXACT [] synonym: "Th2 T-cell" EXACT [] synonym: "Th2 T-lymphocyte" EXACT [] xref: BTO:0001679 xref: FMA:84385 xref: MESH:D018418 is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell is_a: CL:0001051 ! CD4-positive, CXCR3-negative, CCR6-negative, alpha-beta T cell intersection_of: CL:0000492 ! CD4-positive helper T cell intersection_of: capable_of GO:0032633 ! interleukin-4 production intersection_of: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3 intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3 relationship: capable_of GO:0032633 ! interleukin-4 production relationship: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000547 name: proerythroblast def: "An immature, nucleated erythrocyte occupying the stage of erythropoeisis that follows formation of erythroid progenitor cells. This cell is CD71-positive, has both a nucleus and a nucleolus, and lacks hematopoeitic lineage markers." [ISBN:0721601464, MESH:A11.118.290.350.200, PMID:1638021] synonym: "pronormoblast" RELATED [] synonym: "rubriblast" EXACT [ISBN:0721601464] xref: FMA:83518 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell is_a: CL:0002242 ! nucleate cell intersection_of: CL:0000764 ! erythroid lineage cell intersection_of: bearer_of PATO:0002505 ! nucleated intersection_of: has_part CL:0017503 ! basophilic cytoplasm intersection_of: has_part CL:0017505 ! increased nucleus size intersection_of: has_part GO:0005730 ! nucleolus intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 relationship: develops_from CL:0000038 ! erythroid progenitor cell relationship: has_part CL:0017503 ! basophilic cytoplasm relationship: has_part CL:0017505 ! increased nucleus size relationship: has_part GO:0005730 ! nucleolus relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 [Term] id: CL:0000548 name: animal cell subset: ubprop:upper_level is_a: CL:0000255 ! eukaryotic cell intersection_of: CL:0000003 ! native cell intersection_of: only_in_taxon NCBITaxon:33208 ! Metazoa relationship: only_in_taxon NCBITaxon:33208 ! Metazoa [Term] id: CL:0000549 name: basophilic erythroblast def: "A nucleated immature erythrocyte, having cytoplasm generally similar to that of the earlier proerythroblast but sometimes even more basophilic, and usually regular in outline. The nucleus is still relatively large, but the chromatin strands are thicker and more deeply staining, giving a coarser appearance; the nucleoli have disappeared. This cell is CD71-positive and lacks hematopoeitic lineage markers." [GOC:tfm, ISBN:0721601464] synonym: "basophilic normoblast" EXACT [ISBN:0721601464] synonym: "early erythroblast" EXACT [ISBN:0721601464] synonym: "early normoblast" EXACT [ISBN:0721601464] synonym: "prorubricyte" EXACT [ISBN:0721601464] xref: FMA:83505 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000765 {is_inferred="true"} ! erythroblast intersection_of: CL:0000765 ! erythroblast intersection_of: has_part CL:0017503 ! basophilic cytoplasm intersection_of: has_part GO:0000792 ! heterochromatin intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 relationship: has_part CL:0017503 ! basophilic cytoplasm relationship: has_part GO:0000792 ! heterochromatin relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 [Term] id: CL:0000550 name: polychromatophilic erythroblast def: "A nucleated, immature erythrocyte in which the nucleus occupies a relatively smaller part of the cell than in its precursor, the basophilic erythroblast. The cytoplasm is beginning to acquire hemoglobin and thus is no longer a purely basophilic, but takes on acidophilic aspects, which becomes progressively more marked as the cell matures. The chromatin of the nucleus is arranged in coarse, deeply staining clumps. This cell is CD71-positive and lacks hematopoeitic lineage markers." [ISBN:0721601464] synonym: "intermediate erythroblast" EXACT [ISBN:0721601464] synonym: "intermediate normoblast" EXACT [ISBN:0721601464] synonym: "polychromatic erythroblast" EXACT [ISBN:0721601464] synonym: "polychromatic normoblast" EXACT [ISBN:0721601464] synonym: "polychromatophilic normoblast" EXACT [ISBN:0721601464] synonym: "rubricyte" EXACT [ISBN:0721601464] xref: FMA:83506 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000765 {is_inferred="true"} ! erythroblast intersection_of: CL:0000765 ! erythroblast intersection_of: has_part CL:0017504 ! polychromatophilic cytoplasm intersection_of: has_part GO:0000792 ! heterochromatin intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 relationship: develops_from CL:0000549 ! basophilic erythroblast relationship: has_part CL:0017504 ! polychromatophilic cytoplasm relationship: has_part GO:0000792 ! heterochromatin relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 [Term] id: CL:0000551 name: unimodal nocireceptor is_a: CL:0000198 ! pain receptor cell [Term] id: CL:0000552 name: orthochromatic erythroblast def: "The final stage of the nucleated, immature erythrocyte, before nuclear loss. Typically the cytoplasm is described as acidophilic, but it still shows a faint polychromatic tint. The nucleus is small and initially may still have coarse, clumped chromatin, as in its precursor, the polychromatophilic erythroblast, but ultimately it becomes pyknotic, and appears as a deeply staining, blue-black, homogeneous structureless mass. The nucleus is often eccentric and sometimes lobulated." [ISBN:0721601464] synonym: "acidophilic erythroblast" EXACT [ISBN:0721601464] synonym: "eosinophilic erythroblast" EXACT [ISBN:0721601464] synonym: "late erythoblast" EXACT [] synonym: "orthochromatic normoblast" EXACT [ISBN:0721601464] synonym: "pyknotic eto enrythroblast" EXACT [ISBN:0721601464] xref: FMA:84646 is_a: CL:0000765 {is_inferred="true"} ! erythroblast intersection_of: CL:0000765 ! erythroblast intersection_of: has_part CL:0017502 ! acidophilic cytoplasm intersection_of: participates_in GO:0030263 ! apoptotic chromosome condensation relationship: develops_from CL:0000550 ! polychromatophilic erythroblast relationship: has_part CL:0017502 ! acidophilic cytoplasm relationship: participates_in GO:0030263 ! apoptotic chromosome condensation [Term] id: CL:0000553 name: megakaryocyte progenitor cell def: "The earliest cytologically identifiable precursor in the thrombocytic series. This cell is capable of endomitosis and lacks expression of hematopoieitic lineage markers (lin-negative)." [GOC:dsd, GOC:tfm, ISBN:0721601464] comment: Lineage negative is described here as CD2-negative, CD3-negative, CD4-negative, CD5-negative, CD8a-negative, CD14-negative, CD19-negative, CD20-negative, CD56-negative, Ly6g-negative, and Ter119-negative. subset: human_reference_atlas synonym: "CFU-Meg" EXACT [PMID:11722431, PMID:12482498] synonym: "colony-forming unit-megakaryocyte" EXACT [] synonym: "Meg-CFC" EXACT [PMCID:PMC1794060] synonym: "megacaryoblast" EXACT [] synonym: "megacaryocyte progenitor cell" EXACT [] synonym: "megakaryoblast" EXACT [] synonym: "megakaryocytic progenitor cell" EXACT [PMID:12482498] synonym: "MkP" EXACT [PMID:21116988] synonym: "promegacaryocyte" RELATED [] synonym: "promegakaryocyte" RELATED [] xref: BTO:0001164 xref: CALOHA:TS-0610 xref: FMA:84235 xref: MESH:D055016 is_a: CL:0000763 ! myeloid cell is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell intersection_of: capable_of GO:0007113 ! endomitotic cell cycle intersection_of: capable_of GO:0030219 ! megakaryocyte differentiation intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: capable_of GO:0007113 ! endomitotic cell cycle relationship: capable_of GO:0030219 ! megakaryocyte differentiation relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000554 name: gastrin stimulating hormone secreting cell def: "A peptide hormone secreting cell that secretes gastrin stimulating hormone." [GOC:tfm] is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000555 name: neuronal brush cell is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) [Term] id: CL:0000556 name: megakaryocyte def: "A giant cell 50 to 100 micron in diameter, with a greatly lobulated nucleus, found in the bone marrow; mature blood platelets are released from its cytoplasm." [http://en.wikipedia.org/wiki/Megakaryocyte, ISBN:0721601464, MESH:D008533] comment: Megakaryocytes are reportedly CD181-positive and CD182-positive. subset: human_reference_atlas synonym: "megacaryocyte" EXACT [] synonym: "megalocaryocyte" EXACT [] synonym: "megalokaryocyte" EXACT [] xref: BTO:0000843 xref: CALOHA:TS-0611 xref: FMA:83555 is_a: CL:0000763 {is_inferred="true"} ! myeloid cell is_a: CL:1001610 ! bone marrow hematopoietic cell intersection_of: CL:0000763 ! myeloid cell intersection_of: bearer_of PATO:0001393 ! euploid intersection_of: part_of UBERON:0002371 ! bone marrow disjoint_from: CL:0000764 ! erythroid lineage cell relationship: bearer_of PATO:0001393 ! euploid relationship: develops_from CL:0000553 ! megakaryocyte progenitor cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000557 name: granulocyte monocyte progenitor cell def: "A hematopoietic progenitor cell that is committed to the granulocyte and monocyte lineages. These cells are CD123-positive, and do not express Gata1 or Gata2 but do express C/EBPa, and Pu.1." [GO_REF:0000031, GOC:amm, GOC:dsd, GOC:tfm, http://en.wikipedia.org/wiki/CFU-GM, http://www.copewithcytokines.de, ISBN:0721601464, MESH:D055014, PMCID:PMC2213186, PMCID:PMC548021, PMID:16551251, PMID:16647566] comment: Originally described in the dendritic cell ontology (DC_CL:0000042)(PMID:19243617). GMPs are reportedly CD16-positive, CD32-positive, CD34-positive, CD38-positive, CD45RA-positive, CD110-negative, CD117-positive, CD123-positive, and SCA1-negative. subset: human_reference_atlas synonym: "CFU-C , Colony forming unit in culture" BROAD [http://www.copewithcytokines.de] synonym: "CFU-GM" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021] synonym: "colony forming unit granulocyte macrophage" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021] synonym: "GMP" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021] synonym: "granulocyte-macrophage progenitor" EXACT [ISBN:0721601464, PMCID:PMC2213186, PMCID:PMC548021] synonym: "granulocyte/monocyte precursor" EXACT [] synonym: "granulocyte/monocyte progenitor" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0001012 ! CD7-negative lymphoid progenitor OR granulocyte monocyte progenitor is_a: CL:0011026 ! progenitor cell is_a: CL:1001610 ! bone marrow hematopoietic cell intersection_of: CL:0002032 ! hematopoietic oligopotent progenitor cell intersection_of: capable_of GO:0030225 ! macrophage differentiation intersection_of: capable_of GO:0030851 ! granulocyte differentiation intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: lacks_part PR:000007857 ! erythroid transcription factor intersection_of: lacks_part PR:000007858 ! endothelial transcription factor GATA-2 intersection_of: part_of UBERON:0002371 ! bone marrow intersection_of: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain relationship: capable_of GO:0030225 ! macrophage differentiation relationship: capable_of GO:0030851 ! granulocyte differentiation relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: lacks_part PR:000007857 ! erythroid transcription factor relationship: lacks_part PR:000007858 ! endothelial transcription factor GATA-2 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain [Term] id: CL:0000558 name: reticulocyte def: "An immature erythrocyte that changes the protein composition of its plasma membrane by exosome formation and extrusion. The types of protein removed differ between species though removal of the transferrin receptor is apparent in mammals and birds." [GOC:add, GOC:tfm, PMID:15946868, PMID:2037622] xref: BTO:0001173 xref: CALOHA:TS-0864 xref: MESH:D012156 is_a: BFO:0000040 ! material entity is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell intersection_of: CL:0000764 ! erythroid lineage cell intersection_of: capable_of GO:0071971 ! extracellular exosome assembly intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 relationship: capable_of GO:0071971 ! extracellular exosome assembly relationship: develops_from CL:0000552 ! orthochromatic erythroblast relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: RO:0002104 PR:000001945 ! has plasma membrane part transferrin receptor protein 1 [Term] id: CL:0000559 name: promonocyte def: "A precursor in the monocytic series, being a cell intermediate in development between the monoblast and monocyte. This cell is CD11b-positive and has fine azurophil granules." [GOC:tfm, ISBN:0721601464] comment: Morphology: Mononuclear cell, diameter 14-18 _M, fine azurophilic granules; markers: CD11b (shared with many other myeloid cells); location: Adult: bone marrow; Fetal: Liver, Yolk Sac; role or process: hematopoiesis, monocyte development; lineage: hematopoietic, myeloid. subset: human_reference_atlas xref: BTO:0004657 xref: FMA:83551 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0002194 {is_inferred="true"} ! monopoietic cell intersection_of: CL:0002194 ! monopoietic cell intersection_of: capable_of GO:0030224 ! monocyte differentiation intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: develops_from CL:0000040 ! monoblast relationship: has_part GO:0042582 ! azurophil granule relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M [Term] id: CL:0000560 name: band form neutrophil def: "A late neutrophilic metamyelocyte in which the nucleus is indented to more than half the distance to the farthest nuclear margin but in no area being condensed to a single filament. The nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature neutrophil. These cells are fMLP receptor-positive, CD11b-positive, CD35-negative, and CD49d-negative." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007] comment: Found in the Band 1 fraction. synonym: "band" BROAD [] synonym: "band cell" BROAD [] synonym: "band form" BROAD [] synonym: "rod neutrophil" EXACT [] synonym: "stab cell" BROAD [] is_a: CL:0000096 {is_inferred="true"} ! mature neutrophil intersection_of: CL:0000096 ! mature neutrophil intersection_of: has_part CL:0017506 ! banded nucleus intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000007597 ! protein c-Fos intersection_of: lacks_part PR:000009978 ! lactotransferrin intersection_of: lacks_part PR:000010799 ! myb proto-oncogene protein intersection_of: lacks_plasma_membrane_part PR:000009129 ! integrin alpha-4 intersection_of: lacks_plasma_membrane_part PR:000010543 ! myeloperoxidase intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001337 ! has plasma membrane part complement receptor type 1 intersection_of: RO:0002104 PR:000001580 ! has plasma membrane part fMet-Leu-Phe receptor relationship: develops_from CL:0000582 ! neutrophilic metamyelocyte relationship: has_part CL:0017506 ! banded nucleus relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000007597 ! protein c-Fos relationship: lacks_part PR:000009978 ! lactotransferrin relationship: lacks_part PR:000010799 ! myb proto-oncogene protein relationship: lacks_plasma_membrane_part PR:000009129 ! integrin alpha-4 relationship: lacks_plasma_membrane_part PR:000010543 ! myeloperoxidase relationship: RO:0002104 PR:000001337 ! has plasma membrane part complement receptor type 1 relationship: RO:0002104 PR:000001580 ! has plasma membrane part fMet-Leu-Phe receptor [Term] id: CL:0000561 name: amacrine cell def: "Interneuron of the vertebrate retina. They integrate, modulate, and interpose a temporal domain in the visual message presented to the retinal ganglion cells, with which they synapse in the inner plexiform layer. They lack large axons." [GOC:tfm, MESH:D025042, WikipediaVersioned:Amacrine_cell&oldid=1023572246] subset: human_reference_atlas synonym: "amacrine neuron" EXACT [] xref: BTO:0004044 xref: FMA:67766 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000099 ! interneuron is_a: CL:0009004 ! retinal cell relationship: in_taxon NCBITaxon:7742 ! Vertebrata relationship: part_of UBERON:0000966 ! retina relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002120 CL:0000740 ! synapsed to retinal ganglion cell [Term] id: CL:0000562 name: nucleate erythrocyte def: "An erythrocyte having a nucleus." [GOC:add, GOc:tfm] synonym: "RBC" BROAD [] synonym: "red blood cell" BROAD [] is_a: CL:0000232 {is_inferred="true"} ! erythrocyte is_a: CL:0002242 ! nucleate cell intersection_of: CL:0000232 ! erythrocyte intersection_of: bearer_of PATO:0002505 ! nucleated relationship: develops_from CL:0002421 ! nucleated reticulocyte [Term] id: CL:0000563 name: endospore def: "A rounded, inactive form that certain bacteria assume under conditions of extreme temperature, dryness, or lack of food. The bacterium develops a waterproof cell wall that protects it from being dried out or damaged." [GOC:tfm, ISBN:0618947256] synonym: "bacterial spore" EXACT [] xref: BTO:0002779 is_a: CL:0000520 ! prokaryotic cell [Term] id: CL:0000564 name: neutrophilic promyelocyte def: "A promyelocyte committed to the neutrophil lineage. This cell type is GATA-1-positive, C/EBPa-positive, AML-1-positive, MPO-positive, has low expression of PU.1 transcription factor and lacks lactotransferrin expression." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0721601464, PMID:12560239, PMID:15514007] comment: These cells are CD11b-negative, CD15-positive, CD16-negative, CD49d-positive, CD68-positive, CD35-negative, and fMLP receptor-negative. They are found in the Band 3 fraction. synonym: "neutrophilic premyelocyte" EXACT [] synonym: "neutrophilic progranulocyte" EXACT [] xref: FMA:84196 is_a: CL:0000834 ! neutrophil progenitor cell is_a: CL:0000836 {is_inferred="true"} ! promyelocyte intersection_of: CL:0000836 ! promyelocyte intersection_of: capable_of GO:0030223 ! neutrophil differentiation intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000007857 ! erythroid transcription factor intersection_of: has_part PR:000010543 ! myeloperoxidase intersection_of: has_part PR:000014362 ! runt-related transcription factor 1 intersection_of: lacks_part PR:000009978 ! lactotransferrin relationship: develops_from CL:0000042 ! neutrophilic myeloblast relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000007857 ! erythroid transcription factor relationship: has_part PR:000010543 ! myeloperoxidase relationship: has_part PR:000014362 ! runt-related transcription factor 1 relationship: lacks_part PR:000009978 ! lactotransferrin [Term] id: CL:0000565 name: fat body cell def: "A cell found in fat bodies whose primary function is intermediary metabolism." [FB:ma] is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000566 name: angioblastic mesenchymal cell def: "A mesenchymal stem cell capable of developing into blood vessel endothelium." [GOC:dsd, GOC:tfm, PMID:12768659] comment: These cells are reportedly CD31-positive, CD34-positive, CD144-positive, CD309-positive, and TAL1-positive. synonym: "angioblast" EXACT [] synonym: "chondroplast" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000134 {is_inferred="true"} ! mesenchymal stem cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000134 ! mesenchymal stem cell intersection_of: RO:0002104 PR:000001444 ! has plasma membrane part cadherin-5 intersection_of: RO:0002104 PR:000002112 ! has plasma membrane part vascular endothelial growth factor receptor 2 intersection_of: RO:0002104 PR:000016043 ! has plasma membrane part T-cell acute lymphocytic leukemia protein 1 relationship: develops_from CL:0000134 ! mesenchymal stem cell relationship: RO:0002104 PR:000001444 ! has plasma membrane part cadherin-5 relationship: RO:0002104 PR:000002112 ! has plasma membrane part vascular endothelial growth factor receptor 2 relationship: RO:0002104 PR:000016043 ! has plasma membrane part T-cell acute lymphocytic leukemia protein 1 [Term] id: CL:0000567 name: polymodal nocireceptor is_a: CL:0000198 ! pain receptor cell [Term] id: CL:0000568 name: amine precursor uptake and decarboxylation cell def: "A cell that originates in the neural crest, that has certain cytochemical and ultrastructural characteristics and is found scattered throughout the body; types include melanocytes, the cells of the chromaffin system, and cells in the hypothalamus, hypophysis, thyroid, parathyroids, lungs, gastrointestinal tract, and pancreas. This cell type concentrates the amino acid precursors of certain amines and decarboxylate them, forming amines that function as regulators and neurotransmitters. This cell type produces substances such as epinephrine, norepinephrine, dopamine, serotonin, enkephalin, somatostatin, neurotensin, and substance P, the actions of which may affect contiguous cells, nearby groups of cells, or distant cells, thus functioning as local or systemic hormones. The name is an acronym for amine precursor uptake and decarboxylation cell." [GOC:tfm, ISBN:0721662544, MESH:A11.070] synonym: "APUD cell" EXACT [] xref: BTO:0003866 xref: FMA:83114 is_a: CL:0000165 ! neuroendocrine cell [Term] id: CL:0000569 name: cardiac mesenchymal cell def: "A mesenchymal cell found in the developing heart and that develops into some part of the heart. These cells derive from intra- and extra-cardiac sources, including the endocardium, epicardium, neural crest, and second heart field." [PMID:18816864] is_a: CL:0008019 ! mesenchymal cell is_a: CL:2000073 ! migratory cardiac neural crest cell intersection_of: CL:0008019 ! mesenchymal cell intersection_of: RO:0002203 CL:0002494 ! develops into cardiocyte relationship: RO:0002203 CL:0002494 ! develops into cardiocyte [Term] id: CL:0000570 name: parafollicular cell def: "A neuroepithelial cells that occurs singly or in small groups, close to the outer follicular borders but within the follicular basement membrane of the thyroid. Expresses a form of the neural cell adhesion molecule (N-CAM) on their surface. Secretes calcitonin, 5-hydroxytryptamine and dopamine." [GOC:tfm, ISBN:0517223651] synonym: "C cell" EXACT [] synonym: "C cell of thyroid gland" EXACT [FMA:68653] synonym: "clear cell of thyroid gland" EXACT [FMA:68653] synonym: "parafollicular cell of thyroid gland" EXACT [FMA:68653] synonym: "thyroid parafollicular cell" EXACT [FMA:68653] xref: FMA:68653 xref: SCTID:176770005 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000443 {is_inferred="true"} ! calcitonin secreting cell is_a: CL:0000458 ! serotonin secreting cell is_a: CL:0000710 {is_inferred="true"} ! neurecto-epithelial cell intersection_of: CL:0000710 ! neurecto-epithelial cell intersection_of: capable_of GO:0001820 ! serotonin secretion intersection_of: capable_of GO:0014046 ! dopamine secretion intersection_of: capable_of GO:0036161 ! calcitonin secretion intersection_of: RO:0002104 PR:000001024 ! has plasma membrane part neural cell adhesion molecule 1 relationship: capable_of GO:0014046 ! dopamine secretion relationship: develops_from CL:0000333 ! migratory neural crest cell relationship: part_of UBERON:0001747 ! parenchyma of thyroid gland relationship: RO:0002104 PR:000001024 ! has plasma membrane part neural cell adhesion molecule 1 [Term] id: CL:0000571 name: leucophore def: "A pigment cell derived from the neural crest. Contains uric acid or other purine crystals deposited in stacks called leucosomes. The crystals reflect light and this gives a white appearance under white light." [SANBI:mhl] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 ! pigment cell relationship: develops_from CL:0005003 ! leucoblast [Term] id: CL:0000573 name: retinal cone cell def: "One of the two photoreceptor cell types in the vertebrate retina. In cones the photopigment is in invaginations of the cell membrane of the outer segment. Cones are less sensitive to light than rods, but they provide vision with higher spatial and temporal acuity, and the combination of signals from cones with different pigments allows color vision." [MESH:D017949] subset: human_reference_atlas xref: BTO:0001036 xref: CALOHA:TS-0866 xref: FMA:67748 is_a: CL:0010009 ! camera-type eye photoreceptor cell relationship: develops_from CL:0002672 ! retinal progenitor cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000574 name: erythrophore def: "A pigment cell derived from the neural crest. Contains pteridine and/or carotenoid pigments in structures called pterinosomes or erythrosomes. This gives an orange to red appearance." [SANBI:mhl] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 ! pigment cell relationship: develops_from CL:0005004 ! pigment erythroblast [Term] id: CL:0000575 name: corneal epithelial cell alt_id: CL:1000431 def: "An epithelial cell of the cornea." [GOC:tfm] subset: human_reference_atlas synonym: "epithelial cell of cornea" EXACT [FMA:70551] xref: BTO:0004298 xref: CALOHA:TS-0173 xref: FMA:70551 is_a: CL:0000076 ! squamous epithelial cell is_a: CL:0002159 ! general ecto-epithelial cell intersection_of: CL:0000076 ! squamous epithelial cell intersection_of: part_of UBERON:0001772 ! corneal epithelium relationship: part_of UBERON:0001772 ! corneal epithelium relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000576 name: monocyte def: "Myeloid mononuclear recirculating leukocyte that can act as a precursor of tissue macrophages, osteoclasts and some populations of tissue dendritic cells." [GO_REF:0000031, MESH:D009000] comment: Morphology: Mononuclear cell, diameter, 14 to 20 _M, N/C ratio 2:1-1:1. Nucleus may appear in variety of shapes: round, kidney, lobulated, or convoluted. Fine azurophilic granules present; markers: CD11b (shared with other myeloid cells), human: CD14, mouse: F4/80-mid,GR1-low; location: Blood, but can be recruited into tissues; role or process: immune & tissue remodelling; lineage: hematopoietic, myeloid. subset: human_reference_atlas xref: BTO:0000876 xref: CALOHA:TS-0638 xref: FMA:62864 is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte is_a: CL:0000842 ! mononuclear cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: bearer_of PATO:0001407 ! mononucleate intersection_of: capable_of GO:0030225 ! macrophage differentiation intersection_of: capable_of GO:0030316 ! osteoclast differentiation intersection_of: capable_of GO:0043011 ! myeloid dendritic cell differentiation relationship: capable_of GO:0030225 ! macrophage differentiation relationship: capable_of GO:0030316 ! osteoclast differentiation relationship: capable_of GO:0043011 ! myeloid dendritic cell differentiation relationship: develops_from CL:0000559 ! promonocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000577 name: type EC enteroendocrine cell alt_id: CL:0002065 def: "A subtype of enteroendocrine cells found in the gastrointestinal mucosa, particularly in the glands of pyloric antrum; duodenum; and ileum. These cell type secretes serotonin and some neurotransmitters including enkephalins and substance P. Their secretory granules stain readily with silver (argentaffin stain)." [MESH:A03.492.766.440.250, PMID:9505449] subset: human_reference_atlas synonym: "argentaffin cell" EXACT [] synonym: "enterochromaffin cell" EXACT [] synonym: "Kulchitsky cell" EXACT [] xref: FMA:62934 xref: FMA:83132 is_a: CL:0000164 ! enteroendocrine cell is_a: CL:0000166 ! chromaffin cell is_a: CL:0000458 ! serotonin secreting cell is_a: CL:0000506 ! enkephalin secreting cell is_a: CL:0002251 ! epithelial cell of alimentary canal relationship: part_of UBERON:0004786 ! gastrointestinal system mucosa relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000578 name: experimentally modified cell in vitro def: "A cell in vitro that has undergone physical changes as a consequence of a deliberate and specific experimental procedure." [FB:ma, ReO:mhb] comment: This class has been re-labeled to imply reference only to in vitro experimentally modified cells, similarly, the definition has been slightly updated to reflect this. 'experimentally modified cell' refers only to cells in vitro, and not modified in vivo/in environment cells. There is currently no class representing unmodified in vitro cells (other than the parent 'cell in vitro'), or a class representing modified native cells. More granular subclassing of experimentally modified cell can be found in ReO. MHB 1.12.12 is_a: CL:0001034 ! cell in vitro [Term] id: CL:0000579 name: border follicle cell xref: FBbt:00004905 is_a: CL:0000477 ! follicle cell of egg chamber [Term] id: CL:0000580 name: neutrophilic myelocyte def: "A neutrophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte; in this stage, production of primary granules is complete and neutrophil-specific granules has started. No nucleolus is present. This cell type is CD13-positive, CD16-negative, integrin alpha-M-positive, CD15-positive, CD33-positive, CD24-positive, C/EBP-a-positive, C/EBPe-positive, PU.1-positive, lactotransferrin-positive, myeloperoxidase-positive and NGAL-positive." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007] comment: These cells are also CD15-positive, CD35-negative, CD49d-positive, and fMLP receptor-negative. They are found in the Band 2 fraction. xref: BTO:0003455 xref: FMA:83540 is_a: CL:0000776 {is_inferred="true"} ! immature neutrophil is_a: CL:0002087 ! nongranular leukocyte is_a: CL:0002193 ! myelocyte intersection_of: CL:0000776 ! immature neutrophil intersection_of: has_part CL:0017502 ! acidophilic cytoplasm intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon intersection_of: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin intersection_of: has_part PR:000009978 ! lactotransferrin intersection_of: has_part PR:000010543 ! myeloperoxidase intersection_of: lacks_part GO:0070820 ! tertiary granule intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: has_part CL:0017502 ! acidophilic cytoplasm relationship: has_part GO:0042582 ! azurophil granule relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon relationship: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin relationship: has_part PR:000009978 ! lactotransferrin relationship: has_part PR:000010543 ! myeloperoxidase relationship: lacks_part GO:0070820 ! tertiary granule relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000581 name: peritoneal macrophage def: "A macrophage resident in the peritoneum under non-inflammatory conditions. Markers include F4/80-high, CD11b-high, CD68-positive, SIGNR1-positive, CD115-high, MHC-II-negative, and Dectin-1-positive." [MESH:D017737, PMID:15771589, PMID:19201820] comment: Markers: Mouse: F4/80-high, CD11b-high, CD68+, SIGNR1+, Dectin-1+. xref: BTO:0001034 xref: FMA:83025 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: capable_of GO:0042742 ! defense response to bacterium intersection_of: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex intersection_of: located_in UBERON:0001179 ! peritoneal cavity intersection_of: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin intersection_of: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B intersection_of: RO:0015015 PR:000001012 ! has high plasma membrane amount integrin alpha-M intersection_of: RO:0015015 PR:000001813 ! has high plasma membrane amount adhesion G protein-coupled receptor E1 intersection_of: RO:0015015 PR:000002062 ! has high plasma membrane amount macrophage colony-stimulating factor 1 receptor relationship: capable_of GO:0042742 ! defense response to bacterium relationship: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex relationship: located_in UBERON:0001179 ! peritoneal cavity relationship: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B relationship: RO:0015015 PR:000001012 ! has high plasma membrane amount integrin alpha-M relationship: RO:0015015 PR:000001813 ! has high plasma membrane amount adhesion G protein-coupled receptor E1 relationship: RO:0015015 PR:000002062 ! has high plasma membrane amount macrophage colony-stimulating factor 1 receptor [Term] id: CL:0000582 name: neutrophilic metamyelocyte def: "A neutrophil precursor in the granulocytic series, being a cell intermediate in development between a myelocyte and the band form neutrophil. The protein synthesis seen in earlier stages decreases or stops; the nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare; and the cytoplasm becomes amphophilic like that of a mature granulocyte. This cell type is integrin alpha-M-positive, CD13-negative, CD15-positive, CD16-positive, CD33-positive, CD24-positive, fMLP receptor-negative and has expression of C/EBP-a, C/EBP-e, PU.1 transcription factor, lactotransferrin, myeloperoxidase and neutrophil gelatinase associated lipocalin." [GOC:add, GOC:dsd, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:10618520, PMID:12560239, PMID:15514007] comment: These cells are also CD35-negative, CD49d-positive, and fMLP receptor-negative. They are found in the Band 2 fraction. synonym: "juvenile neutrophil" EXACT [] xref: FMA:84197 is_a: CL:0000776 {is_inferred="true"} ! immature neutrophil is_a: CL:0002192 ! metamyelocyte intersection_of: CL:0000776 ! immature neutrophil intersection_of: has_part CL:0017502 ! acidophilic cytoplasm intersection_of: has_part CL:0017507 ! reniform nucleus intersection_of: has_part GO:0000792 ! heterochromatin intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: has_part GO:0070820 ! tertiary granule intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon intersection_of: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin intersection_of: has_part PR:000009978 ! lactotransferrin intersection_of: has_part PR:000010543 ! myeloperoxidase intersection_of: lacks_plasma_membrane_part PR:000001580 ! fMet-Leu-Phe receptor intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: develops_from CL:0000580 ! neutrophilic myelocyte relationship: has_part CL:0017502 ! acidophilic cytoplasm relationship: has_part CL:0017507 ! reniform nucleus relationship: has_part GO:0000792 ! heterochromatin relationship: has_part GO:0042582 ! azurophil granule relationship: has_part GO:0070820 ! tertiary granule relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000005310 ! CCAAT/enhancer-binding protein epsilon relationship: has_part PR:000009725 ! neutrophil gelatinase-associated lipocalin relationship: has_part PR:000009978 ! lactotransferrin relationship: has_part PR:000010543 ! myeloperoxidase relationship: lacks_plasma_membrane_part PR:000001580 ! fMet-Leu-Phe receptor relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000583 name: alveolar macrophage def: "A tissue-resident macrophage found in the alveoli of the lungs. Ingests small inhaled particles resulting in degradation and presentation of the antigen to immunocompetent cells. Markers include F4/80-positive, CD11b-/low, CD11c-positive, CD68-positive, sialoadhesin-positive, dectin-1-positive, MR-positive, CX3CR1-negative." [GO_REF:0000031, GOC:ana, GOC:dsd, GOC:tfm, MESH:D016676] comment: Markers: Mouse: F4/80mid, CD11b-/low, CD11c+, CD68+, sialoadhesin+, dectin-1+, MR+, CX3CR1-. subset: human_reference_atlas synonym: "dust cell" EXACT [] synonym: "MF.Lu" RELATED [] xref: BTO:0000802 xref: CALOHA:TS-0030 xref: FMA:83023 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage is_a: CL:1001603 ! lung macrophage intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: capable_of GO:0019882 ! antigen processing and presentation intersection_of: lacks_plasma_membrane_part PR:000001206 ! CX3C chemokine receptor 1 intersection_of: located_in UBERON:0002299 ! alveolus of lung intersection_of: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X intersection_of: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin intersection_of: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1 intersection_of: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001206 ! CX3C chemokine receptor 1 relationship: located_in UBERON:0002299 ! alveolus of lung relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001013 ! has plasma membrane part integrin alpha-X relationship: RO:0002104 PR:000001807 ! has plasma membrane part C-type lectin domain family 7 member A relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1 relationship: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M [Term] id: CL:0000584 name: enterocyte def: "An epithelial cell that has its apical plasma membrane folded into microvilli to provide ample surface for the absorption of nutrients from the intestinal lumen." [SANBI:mhl] subset: human_reference_atlas synonym: "differentiated enterocyte" NARROW [https://orcid.org/0000-0001-9610-7627, PMID:33290721] synonym: "mature enterocyte" NARROW [https://orcid.org/0000-0001-9610-7627, PMID:33290721] xref: BTO:0000398 xref: FMA:62122 xref: MESH:D020895 is_a: CL:0000239 ! brush border epithelial cell is_a: CL:0000677 ! gut absorptive cell is_a: CL:0002563 ! intestinal epithelial cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000585 name: obsolete null cell def: "OBSOLETE: A class of lymphocytes characterized by the lack of surface markers specific for either T or B cells." [] comment: This term is rather archaic; consider using 'natural killer cell ; CL:0000623', 'pro-B cell ; CL:0000826', 'pro-T cell ; CL:0000827', or other appropriate lymphocyte-related term depending on the context. is_obsolete: true [Term] id: CL:0000586 name: germ cell def: "The reproductive cell in multicellular organisms." [MESH:D005854] xref: BTO:0000535 xref: VHOG:0001534 xref: WBbt:0006796 is_a: CL:0000039 {is_inferred="true"} ! germ line cell relationship: capable_of_part_of GO:0009566 ! fertilization [Term] id: CL:0000587 name: cold sensing thermoreceptor cell def: "A thermoreceptor cell that detects reduced temperatures." [GOC:tfm] is_a: CL:0000205 ! thermoreceptor cell [Term] id: CL:0000588 name: odontoclast def: "A specialized osteoclast associated with the absorption and removal of cementum." [GOC:add, MESH:A11.329.679] xref: BTO:0002516 xref: FMA:83027 is_a: CL:0000092 {is_inferred="true"} ! osteoclast intersection_of: CL:0000092 ! osteoclast intersection_of: capable_of GO:0042483 ! negative regulation of odontogenesis relationship: capable_of GO:0042483 ! negative regulation of odontogenesis [Term] id: CL:0000589 name: cochlear inner hair cell def: "A bulbous cell that is medially placed in one row in the organ of Corti. In contrast to the outer hair cells, the inner hair cells are fewer in number, have fewer sensory hairs, and are less differentiated." [MESH:D006199] synonym: "inner hair cell" BROAD [] xref: BTO:0003667 xref: FMA:62365 is_a: CL:4023120 ! cochlea auditory hair cell [Term] id: CL:0000590 name: small luteal cell def: "A progesterone secreting cell in the corpus luteum that develops from theca cells." [GOC:tfm, MESH:D008184] synonym: "small lutein cell" EXACT [] synonym: "theca lutein cell" EXACT [] xref: BTO:0002850 xref: FMA:18690 is_a: CL:0000175 ! luteal cell relationship: develops_from CL:0000503 ! theca cell [Term] id: CL:0000591 name: warmth sensing thermoreceptor cell def: "A thermoreceptor cell that detects increased temperatures." [GOC:tfm, https://orcid.org/0000-0001-5208-3432] is_a: CL:0000205 ! thermoreceptor cell [Term] id: CL:0000592 name: large luteal cell def: "A large, progesterone secreting cell in the corpus luteum that develops from the granulosa cells." [GOC:tfm, MESH:D008184] synonym: "granulosa lutein cell" EXACT [] synonym: "granulosoluteocytus" RELATED [] xref: FMA:18689 is_a: CL:0000175 ! luteal cell is_a: CL:0000177 ! testosterone secreting cell relationship: develops_from CL:0000501 ! granulosa cell [Term] id: CL:0000593 name: androgen secreting cell def: "A steroid hormone secreting cell that secretes androgen." [GOC:tfm] is_a: CL:0000174 ! steroid hormone secreting cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0035935 ! androgen secretion relationship: capable_of GO:0035935 ! androgen secretion [Term] id: CL:0000594 name: skeletal muscle satellite cell def: "An elongated, spindle-shaped, cell that is located between the basal lamina and the plasmalemma of a muscle fiber. These cells are mostly quiescent, but upon activation they divide to produce cells that generate new muscle fibers." [GOC:tfm, MESH:D032496, PMID:21849021, PMID:23303905] comment: Skeletal muscle satellite cells are not traditionally referred to as myoblasts. They are a heterogeneous population whose division, following activiation, contributes to the formation of skeletal muscle fibers and to maintenance of the skeletal muscle statelite cell population. is_a: CL:0000188 ! cell of skeletal muscle is_a: CL:0000680 ! muscle precursor cell [Term] id: CL:0000595 name: enucleate erythrocyte def: "An erythrocyte lacking a nucleus." [GOC:add, GOC:tfm] synonym: "RBC" BROAD [] synonym: "red blood cell" BROAD [] is_a: CL:0000225 ! anucleate cell is_a: CL:0000232 {is_inferred="true"} ! erythrocyte intersection_of: CL:0000232 ! erythrocyte intersection_of: bearer_of PATO:0001405 ! anucleate relationship: develops_from CL:0002422 ! enucleated reticulocyte [Term] id: CL:0000596 name: sexual spore def: "A spore formed following meiosis. Sometimes following meiosis, prospores may undergo one or more rounds of mitosis before they are fully mature." [FAO:0000017, GOC:tfm, SGD:clt] synonym: "meiotically-derived spore" EXACT [] xref: FAO:0000017 is_a: CL:0002369 ! fungal spore [Term] id: CL:0000597 name: microconidium def: "The smaller of two types of asexual spores formed by some fungi. An ovoid to pear-shaped asexual spore that contains very little cytoplasm and organelles, is uninucleate, and forms in vegetative hypae within a mycelium. Micronidia are extruded from the hyphal cell wall." [GOC:tfm, ISBN:0471940526, PMID:8357339, SGD:clt] xref: FAO:0000028 is_a: CL:0002381 ! uninucleate conidium [Term] id: CL:0000598 name: pyramidal neuron def: "Pyramidal neurons have a pyramid-shaped soma with a single axon, a large apical dendrite and multiple basal dendrites. The apex and an apical dendrite typically point toward the pial surface and other dendrites and an axon emerging from the base. The axons may have local collaterals but also project outside their region. Pyramidal neurons are found in the cerebral cortex, the hippocampus, and the amygdala." [GOC:tfm, MESH:D017966] subset: BDS_subset synonym: "projection neuron" EXACT [] synonym: "pyramidal cell" EXACT [] synonym: "pyramidal neuron" EXACT [] xref: BTO:0003102 xref: FMA:67310 xref: FMA:86775 xref: NIFSTD:sao862606388 is_a: CL:0000104 ! multipolar neuron intersection_of: CL:0000540 ! neuron intersection_of: bearer_of PATO:0070015 ! pyramidal family morphology relationship: bearer_of PATO:0070015 ! pyramidal family morphology [Term] id: CL:0000599 name: conidium def: "An asexual, nonmotile spore formed by higher fungi; conidia are usually made from the side or tip of specialized sporogenous cells and do not form by progressive cleavage of the cytoplasm." [ISBN:08199377X, PMID:2524423, PMID:9529886, SGD:clt] xref: BTO:0000283 xref: FAO:0000024 is_a: CL:0000605 ! fungal asexual spore [Term] id: CL:0000600 name: heterokaryon def: "A fungal cell with two or more genetically distinct nuclei." [ISBN:08199377X] is_a: CL:0000228 ! multinucleate cell is_a: CL:0000521 ! fungal cell [Term] id: CL:0000601 name: cochlear outer hair cell def: "A mechanoreceptor in the organ of Corti. In mammals the outer hair cells are arranged in three rows which are further from the modiolus than the single row of inner hair cells. The motile properties of the outer hair cells may contribute actively to tuning the sensitivity and frequency selectivity of the cochlea." [MESH:D018072] xref: BTO:0003666 xref: FMA:62366 is_a: CL:4023120 ! cochlea auditory hair cell [Term] id: CL:0000602 name: pressoreceptor cell def: "A receptor in the vascular system, particularly the aorta and carotid sinus, which is sensitive to stretch of the vessel walls." [MESH:D011311] is_a: CL:1000082 ! stretch receptor cell [Term] id: CL:0000603 name: dikaryon def: "A fungal cell with two genetically distinct haploid nuclei." [ISBN:08199377X] is_a: CL:0000227 ! binucleate cell is_a: CL:0000600 ! heterokaryon [Term] id: CL:0000604 name: retinal rod cell def: "One of the two photoreceptor cell types of the vertebrate retina. In rods the photopigment is in stacks of membranous disks separate from the outer cell membrane. Rods are more sensitive to light than cones, but rod mediated vision has less spatial and temporal resolution than cone vision." [MESH:D017948] subset: human_reference_atlas xref: BTO:0001024 xref: CALOHA:TS-0870 xref: FMA:67747 is_a: CL:0010009 ! camera-type eye photoreceptor cell relationship: develops_from CL:0002672 ! retinal progenitor cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000605 name: fungal asexual spore def: "A spore formed following mitosis or mitoses." [GOC:tfm, PMID:2524423, PMID:9529886, SGD:clt] xref: FAO:0000023 is_a: CL:0002369 ! fungal spore [Term] id: CL:0000606 name: macroconidium def: "The larger of two types of asexual spores formed by some fungi; usually round or oblong." [GOC:tfm, ISBN:0471940526, SGD:clt] xref: FAO:0000038 is_a: CL:0000599 ! conidium [Term] id: CL:0000607 name: ascospore def: "A thick walled spore that stores and protects one or more nuclei following sexual reproduction in an Ascomycete." [GOC:tfm, ISBN:08199377X, SGD:clt] xref: BTO:0000097 xref: FAO:0000020 is_a: CL:0000596 ! sexual spore [Term] id: CL:0000608 name: zygospore def: "A thick walled, sexual, resting spore formed by Zygomycetes; sometimes refers to the spore and the multi-layered cell wall that encloses the spore, the zygosporangium." [ISBN:0471940526, ISBN:08199377X, SGD:clt] xref: FAO:0000040 is_a: CL:0000596 ! sexual spore [Term] id: CL:0000609 name: vestibular hair cell def: "A mechanoreceptor located in the acoustic maculae and the semicircular canals that mediates the sense of balance, movement, and head position. The vestibular hair cells are connected to accessory structures in such a way that movements of the head displace their stereocilia. This influences the membrane potential of the cells which relay information about movements via the vestibular part of the vestibulocochlear nerve to the brain stem." [GOC:tfm, MESH:D018069] synonym: "vestibular receptor cell" EXACT [] xref: FMA:62351 is_a: CL:0002374 ! ear hair cell [Term] id: CL:0000610 name: obsolete plant cell comment: This term was obsoleted as it is redundant with PO:0009002 in the cell ontology (PO) is_obsolete: true consider: PO:0009002 [Term] id: CL:0000611 name: eosinophil progenitor cell comment: These cells are CD34-positive, CD45RA-negative, CD71-negative, and lineage-negative (CD2, CD3 epsilon, CD4, CD5, CD8a, CD14, CD19, CD20, integrin alpha-M, NCAM-1, SCA-1, Ly6G, Ly76). synonym: "CFU-Eo" RELATED [] synonym: "colony forming unit eosinophil" RELATED [] synonym: "EoP" EXACT [PMCID:PMC2212039, PMCID:PMC2626675] synonym: "eosinophil stem cell" RELATED [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell intersection_of: CL:0002191 ! granulocytopoietic cell intersection_of: capable_of GO:0030222 ! eosinophil differentiation intersection_of: has_part PR:000001944 ! transcription factor PU.1 intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000007857 ! erythroid transcription factor intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule intersection_of: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 intersection_of: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain intersection_of: RO:0002104 PR:000001867 ! has plasma membrane part interleukin-5 receptor subunit alpha intersection_of: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor relationship: capable_of GO:0030222 ! eosinophil differentiation relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell relationship: has_part PR:000001944 ! transcription factor PU.1 relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000007857 ! erythroid transcription factor relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule relationship: RO:0002104 PR:000001408 ! has plasma membrane part ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 relationship: RO:0002104 PR:000001865 ! has plasma membrane part interleukin-3 receptor class 2 alpha chain relationship: RO:0002104 PR:000001867 ! has plasma membrane part interleukin-5 receptor subunit alpha relationship: RO:0002104 PR:000002065 ! has plasma membrane part mast/stem cell growth factor receptor [Term] id: CL:0000612 name: eosinophilic myelocyte def: "A eosinophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte;in this stage, production of primary granules is complete and eosinophil-specific granules has started. No nucleolus is present. These cells are integrin alpha-M-positive, CD13-positive, CD15-positive, CD16-negative, CD24-positive, and CD33-positive." [GOC:add, GOC:dsd, http://www.cap.org, ISBN:0721601464, PMID:19622087] xref: BTO:0003454 xref: FMA:83542 is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil is_a: CL:0002087 ! nongranular leukocyte is_a: CL:0002193 ! myelocyte intersection_of: CL:0000772 ! immature eosinophil intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: lacks_part GO:0070820 ! tertiary granule intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: has_part GO:0042582 ! azurophil granule relationship: lacks_part GO:0070820 ! tertiary granule relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000613 name: basophil progenitor cell def: "A progenitor cell committed to the basophil lineage. This cell lacks hematopoietic lineage markers (lin-negative) and is CD34-positive, T1/ST2-low, CD117-negative, and FceRIa-high. This cell also expresses Gata-1, Gata-2 and C/EBPa." [GOC:add, GOC:dsd, http://www.copewithcytokines.de, PMCID:PMC1312421] comment: BaP are also CD13-low and integrin beta-7-low. They are lin-negative (CD2, CD3e, CD4, CD5, CD8, CD11b, CD14, CD19, CD20, ly6g, ly76, and NCAM-1). They also lack expression of mast cell protease 1 (MCP-1) and microphthalmia-associated transcription factor (mitf). synonym: "BaP" EXACT [] synonym: "basophilic stem cell" RELATED [] synonym: "CFU-Bas" RELATED [] synonym: "colony forming unit basophil" RELATED [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell intersection_of: CL:0002191 ! granulocytopoietic cell intersection_of: capable_of GO:0030221 ! basophil differentiation intersection_of: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: has_part PR:000007857 ! erythroid transcription factor intersection_of: has_part PR:000007858 ! endothelial transcription factor GATA-2 intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) intersection_of: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha intersection_of: RO:0015016 PR:000016401 ! has low plasma membrane amount transmembrane emp24 domain-containing protein 1 relationship: capable_of GO:0030221 ! basophil differentiation relationship: develops_from CL:0002028 ! basophil mast progenitor cell relationship: has_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: has_part PR:000007857 ! erythroid transcription factor relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2 relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha relationship: RO:0015016 PR:000016401 ! has low plasma membrane amount transmembrane emp24 domain-containing protein 1 [Term] id: CL:0000614 name: basophilic myelocyte def: "A basophil precursor in the granulocytic series, being a cell intermediate in development between a promyelocyte and a metamyelocyte; in this stage, production of primary granules is complete and basophil-specific granules has started. No nucleolus is present. Markers are being integrin alpha-M-positive, fucosyltransferase FUT4-positive, CD33-positive, CD24-positive, aminopeptidase N-positive." [GOC:add, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:18466030] xref: BTO:0003456 xref: FMA:83543 is_a: CL:0000768 {is_inferred="true"} ! immature basophil is_a: CL:0002087 ! nongranular leukocyte intersection_of: CL:0000768 ! immature basophil intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: lacks_part GO:0005730 ! nucleolus intersection_of: lacks_part GO:0070820 ! tertiary granule intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: has_part GO:0042582 ! azurophil granule relationship: lacks_part GO:0005730 ! nucleolus relationship: lacks_part GO:0070820 ! tertiary granule relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000615 name: basidiospore def: "A thick walled spore containing one or more haploid nuclei produced by sexual reproduction in an Basidiomycete; formed externally on extrusions of the basidium." [GOC:clt, ISBN:0471940526, ISBN:08199377X] xref: BTO:0002166 xref: FAO:0000021 is_a: CL:0000596 ! sexual spore [Term] id: CL:0000616 name: obsolete sporangiospore def: "OBSOLETE: A walled spore produced in a sporangium." [ISBN:08199377X] is_obsolete: true [Term] id: CL:0000617 name: GABAergic neuron def: "A neuron that uses GABA as a vesicular neurotransmitter" [GOC:tfm] synonym: "GABA-ergic neuron" EXACT [] xref: FMA:84788 xref: MESH:D059330 xref: WBbt:0005190 is_a: CL:0000161 ! acid secreting cell is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission relationship: capable_of GO:0061534 ! gamma-aminobutyric acid secretion, neurotransmission [Term] id: CL:0000618 name: sheath cell is_a: CL:0000075 ! columnar/cuboidal epithelial cell [Term] id: CL:0000619 name: supporting cell (sensu Nematoda) synonym: "support cell (sensu Nematoda)" EXACT [] is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia) [Term] id: CL:0000620 name: obsolete zoospore def: "OBSOLETE: A sporangiospore that is motile, having flagella." [ISBN:08199377X] xref: FAO:0000039 is_obsolete: true [Term] id: CL:0000621 name: fusion competent myoblast def: "A myoblast that is committed to a myotube-specific program of differentiation but not yet fused. It undergoes very limited additional proliferation. After fusion, it will take on a muscle identity specified by a `muscle founder cell` (CL:0008006)." [PMID:22274696] is_a: CL:0008018 ! somatic muscle myoblast [Term] id: CL:0000622 name: acinar cell def: "A secretory cell that is grouped together with other cells of the same type to form grape shaped clusters known as acini (singular acinus)." [GOC:tfm, http://www.copewithcytokines.de] synonym: "acinic cell" EXACT [] synonym: "acinous cell" EXACT [] xref: FMA:83625 xref: MESH:D061354 is_a: CL:0000150 ! glandular epithelial cell is_a: CL:0000154 ! protein secreting cell relationship: part_of UBERON:0009842 ! glandular acinus [Term] id: CL:0000623 name: natural killer cell def: "A lymphocyte that can spontaneously kill a variety of target cells without prior antigenic activation via germline encoded activation receptors and also regulate immune responses via cytokine release and direct contact with other cells." [GOC:add, ISBN:0781735149, PMID:15771571] subset: human_reference_atlas synonym: "large granular lymphocyte" BROAD [] synonym: "NK cell" EXACT [] synonym: "null cell" BROAD [] xref: BTO:0000914 xref: BTO:0004716 xref: CALOHA:TS-0664 xref: FMA:63147 xref: FMA:83601 xref: MESH:D007694 xref: VHOG:0001697 is_a: CL:0001067 ! group 1 innate lymphoid cell intersection_of: CL:0001067 ! group 1 innate lymphoid cell intersection_of: capable_of GO:0002228 ! natural killer cell mediated immunity intersection_of: capable_of GO:0050776 ! regulation of immune response intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: capable_of GO:0002228 ! natural killer cell mediated immunity relationship: capable_of GO:0050776 ! regulation of immune response relationship: develops_from CL:0000825 ! pro-NK cell relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000624 name: CD4-positive, alpha-beta T cell def: "A mature alpha-beta T cell that expresses an alpha-beta T cell receptor and the CD4 coreceptor." [GOC:add, ISBN:0781735149] subset: human_reference_atlas synonym: "CD4-positive, alpha-beta T lymphocyte" EXACT [] synonym: "CD4-positive, alpha-beta T-cell" EXACT [] synonym: "CD4-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell intersection_of: CL:0000791 ! mature alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8 intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule disjoint_from: CL:0000625 ! CD8-positive, alpha-beta T cell relationship: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule [Term] id: CL:0000625 name: CD8-positive, alpha-beta T cell def: "A T cell expressing an alpha-beta T cell receptor and the CD8 coreceptor." [GOC:add, GOC:tfm, ISBN:0781735149] subset: human_reference_atlas synonym: "CD8-positive, alpha-beta T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta T-cell" EXACT [] synonym: "CD8-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell intersection_of: CL:0000791 ! mature alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 [Term] id: CL:0000626 name: olfactory granule cell def: "Granule cell that is part of the olfactory bulb." [GOC:mah] is_a: CL:0000120 ! granule cell is_a: CL:0012001 ! neuron of the forebrain intersection_of: CL:0000120 ! granule cell intersection_of: RO:0002100 UBERON:0002264 ! has soma location olfactory bulb relationship: RO:0002100 UBERON:0002264 ! has soma location olfactory bulb [Term] id: CL:0000627 name: transporting cell def: "A cell involved in transporting nutrients, minerals, water, gases and other chemicals between cells for a variety of purposes including conveying nutrition to other tissues, removing waste products from the tissues, conveying gases for respiration, distributing heat and repelling invasion of foreign substances." [TAIR:sr] is_a: CL:0000003 ! native cell [Term] id: CL:0000628 name: photosynthetic cell def: "A cell that can perform photosynthesis, in which carbohydrates are synthesized from carbon dioxide and water, using light as the energy source." [TAIR:sr] comment: see PMID:21177950, The making of a photosynthetic animal. is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell relationship: capable_of GO:0015979 ! photosynthesis [Term] id: CL:0000629 name: storage cell def: "A cell that is specialized to store a particular substance(s), which is(are) later released from the store for a particular purpose." [FB:ma] is_a: CL:0000325 ! stuff accumulating cell [Term] id: CL:0000630 name: supporting cell def: "A cell whose primary function is to support other cell types." [FB:ma, GOC:tfm] synonym: "supportive cell" EXACT [] xref: BTO:0002315 is_a: CL:0000003 ! native cell [Term] id: CL:0000631 name: labyrinth supporting cell def: "Cells forming a framework supporting the organ of Corti. Specific cells are those of Claudius, Deiters and Hensen." [MESH:D007760] is_a: CL:0000630 ! supporting cell [Term] id: CL:0000632 name: hepatic stellate cell def: "A cell that is found in the perisinusoidal space of the liver that is capable of multiple roles including storage of retinol, presentation of antigen to T cells (including CD1d-restricted NKT cells), and upon activation, production of extracellular matrix components that can contribute to liver fibrosis. This activated state has a myofibroblast-like phenotype, though it's not clear in the literature if this is terminally differentiated. This cell type comprises approximately 8-15% of total cells in the liver." [GOC:dsd, http://en.wikipedia.org/wiki/Hepatic_stellate_cell, MESH:D055166, PMID:12808230, PMID:17239632, PMID:18222966, PMID:9302568] comment: Hepatic stellate cells are CD271-positive, desmin-positive, DDR-2-positive, GFAP-positive, synamin-positive, synaptophysin-positive, vimentin-positive, They are capable of producing angiotensin II, fibronectin, laminin, MMP-1, MMP-2, MMP-3, MMP-9, MMP-11, TGF-beta1, TIMP-1, TIMP-2, type I collagen, type III collagen, type IV collagen, and type VI collagen. subset: human_reference_atlas synonym: "fat-storing cell" RELATED [] synonym: "hepatic perisinusoidal cell" EXACT [] synonym: "Ito cell" EXACT [] synonym: "lipocyte" RELATED [] synonym: "perisinusoidal cell" EXACT [] synonym: "vitamin A-storing cells" RELATED [PMID:12808230] xref: BTO:0002741 xref: CALOHA:TS-0452 xref: FMA:67763 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000057 ! fibroblast is_a: CL:0000327 ! extracellular matrix secreting cell intersection_of: CL:0002320 ! connective tissue cell intersection_of: part_of UBERON:0002107 ! liver intersection_of: RO:0002104 PR:000007939 ! has plasma membrane part glial fibrillary acidic protein relationship: part_of UBERON:0002107 ! liver relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000007939 ! has plasma membrane part glial fibrillary acidic protein [Term] id: CL:0000633 name: Hensen cell def: "A tall supporting cell that is arranged in rows adjacent to the last row of outer phalangeal cells. This cell type constitutes the outer border of the organ of Corti." [GOC:tfm, ISBN:0721662544] synonym: "cell of Hensen" EXACT [] synonym: "external limiting cell of organ of Corti" EXACT [] synonym: "Hensen's cell" EXACT [] xref: FMA:79799 is_a: CL:0002490 ! organ of Corti supporting cell [Term] id: CL:0000634 name: Claudius cell def: "A cuboidal cell which along with Boettcher's cells form the floor of the external spiral sulcus, external to the organ of Corti." [GOC:tfm, ISBN:0721662544] synonym: "cell of Claudius" EXACT [] synonym: "external supporting cell of Claudius" RELATED [] xref: FMA:79802 is_a: CL:0002315 ! supporting cell of cochlea [Term] id: CL:0000635 name: Deiter's cell def: "The outer phalangeal cells of the organ of Corti. This cell holds the base of the hair cell in a cup-shaped depression." [GOC:tfm, http://www.britannica.com/EBchecked/topic/156177/Deiters-cell, ISBN:0721662544] synonym: "Deiters cell" EXACT [] synonym: "outer phalangeal cell" EXACT [] xref: FMA:75725 is_a: CL:0002165 ! phalangeal cell [Term] id: CL:0000636 name: Mueller cell def: "Astrocyte-like radial glial cell that extends vertically throughout the retina, with the nucleus are usually in the middle of the inner nuclear layer." [GOC:NV, PMID:21911394] subset: human_reference_atlas synonym: "Muller glia" EXACT [] synonym: "Müller cell" EXACT [] xref: BTO:0003064 is_a: CL:0000681 ! radial glial cell is_a: CL:0009004 ! retinal cell relationship: part_of UBERON:0000966 ! retina relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000637 name: chromophil cell of anterior pituitary gland def: "A cell that stains readily in the anterior pituitary gland." [GOC:tfm, ISBN:0618947256] xref: FMA:83089 is_a: CL:0000150 ! glandular epithelial cell is_a: CL:0000166 ! chromaffin cell is_a: CL:0000167 ! peptide hormone secreting cell is_a: CL:0002319 ! neural cell is_a: CL:2000004 ! pituitary gland cell intersection_of: CL:0000166 ! chromaffin cell intersection_of: part_of UBERON:0002196 ! adenohypophysis relationship: part_of UBERON:0002196 ! adenohypophysis [Term] id: CL:0000638 name: acidophil cell of pars distalis of adenohypophysis def: "An acidophilic chromophil cell that of the anterior pituitary gland." [GOC:tfm] synonym: "acidophil cell of pars anterior of adenohypophysis" EXACT [] synonym: "acidophil of pars anterior of adenohypophysis" EXACT [] synonym: "acidophil of pars distalis of adenohypophysis" EXACT [] synonym: "pituitary alpha cell" EXACT [] xref: FMA:83093 is_a: CL:0000637 ! chromophil cell of anterior pituitary gland relationship: part_of UBERON:0006964 ! pars distalis of adenohypophysis [Term] id: CL:0000639 name: basophil cell of pars distalis of adenohypophysis def: "A basophilic chromophil cell that of the anterior pituitary gland." [GOC:tfm] synonym: "basophil cell of anterior lobe of hypophysis" EXACT [] synonym: "beta cell" RELATED [] synonym: "pituitary beta cell" RELATED [] xref: FMA:83094 is_a: CL:0000637 ! chromophil cell of anterior pituitary gland [Term] id: CL:0000641 name: chromophobe cell def: "A cell that is resistant to stains." [GOC:tfm] synonym: "chromophobic cell" EXACT [] xref: FMA:83626 is_a: CL:0000163 ! endocrine cell [Term] id: CL:0000642 name: folliculostellate cell def: "A supportive cell of the vertebrate pituitary that provides macromolecular transport and secretes hormones." [JB:jb] is_a: CL:0000163 ! endocrine cell is_a: CL:0000630 ! supporting cell [Term] id: CL:0000644 name: Bergmann glial cell def: "Type of radial astrocyte in the cerebellar cortex that have their cell bodies in the Purkinje cell layer and processes that extend into the molecular layer, terminating with bulbous endfeet at the pial surface. Bergmann glia express high densities of glutamate transporters that limit diffusion of the neurotransmitter glutamate during its release from synaptic terminals. Besides their role in early development of the cerebellum, Bergmann glia are also required for the pruning or addition of synapses." [GOC:tfm, http://www.neurolex.org/wiki/Category\:Bergmann_Glial_Cell] synonym: "Bergmann astrocyte" EXACT [] synonym: "Bergmann glial cell of cerebellum" EXACT [] xref: FMA:54559 is_a: CL:0000127 ! astrocyte [Term] id: CL:0000645 name: pituicyte def: "A glial cell of astrocytic lineage with long processes running parallel to adjacent axons in the proximal infundibulum of the neurohypophysis. These processes form a three-dimensional network among the axons of the hypothalamic neurosecretory cells and are connected by gap junctions which provide for their metabolic coupling. This cell type constitutes most of the nonexcitable tissue in the neurohypophsis; function may include possibly acting as an intermediate in the modulation of oxytocin and vasopressin release. This cell type is highly variable in size and shape and commonly contain lipid droplets and deposits of lipochrome pigment." [http://en.wikipedia.org/wiki/Pituicyte, ISBN:0412046911, ISBN:0517223651, PMID:31915267] xref: BTO:0003793 xref: FMA:83503 is_a: CL:0012000 ! astrocyte of the forebrain is_a: CL:2000004 ! pituitary gland cell relationship: part_of UBERON:0002198 ! neurohypophysis [Term] id: CL:0000646 name: basal cell def: "Undifferentiated; mitotic stem cell for other epithelial cell types; rounded or elliptical with little cytoplasm and few organelles; contain cytokeratin intermediate filament." [GOC:tfm, ISBN:0517223651] subset: human_reference_atlas xref: BTO:0000939 xref: FMA:62516 is_a: CL:0000036 ! epithelial fate stem cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000647 name: multinucleated giant cell def: "A phagocytic cell formed by the fusion of macrophages, occurs in chronic inflammatory responses to persistent microorganism such as M.tuberculosis, component of granulomas. Sometimes used to refer to megakaryocytes." [GOC:add, GOC:tfm, ISBN:0702022918, ISBN:0702024783] comment: Role or process: Chronic infection, granulomatous inflammation. Consider also megakaryocyte (CL:0000556) as sometimes multinucleated giant cell is used to refer to this. synonym: "foreign body giant cell" EXACT [ISBN:0702022918, ISBN:0702024783] synonym: "Langerhans giant cell" EXACT [ISBN:0702022918, ISBN:0702024783] synonym: "macrophage polykaryon" EXACT [ISBN:0702022918, ISBN:0702024783] synonym: "multinucleate giant cell" EXACT [ISBN:0702022918, ISBN:0702024783] synonym: "syncytial giant cell" EXACT [ISBN:0702022918, ISBN:0702024783] xref: BTO:0003107 xref: FMA:83035 xref: MESH:D015726 is_a: CL:0000228 ! multinucleate cell is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: bearer_of PATO:0001908 ! multinucleate intersection_of: participates_in GO:0002432 ! granuloma formation intersection_of: participates_in GO:0002544 ! chronic inflammatory response relationship: develops_from CL:0000235 ! macrophage relationship: participates_in GO:0002432 ! granuloma formation relationship: participates_in GO:0002544 ! chronic inflammatory response [Term] id: CL:0000648 name: kidney granular cell alt_id: CL:0000461 def: "A smooth muscle cell that synthesizes, stores, and secretes the enzyme renin. This cell type are located in the wall of the afferent arteriole at the entrance to the glomerulus. While having a different origin than other kidney smooth muscle cells, this cell type expresses smooth muscle actin upon maturation." [GOC:cvs, GOC:tfm, PMID:11457727] subset: human_reference_atlas synonym: "JG cell" EXACT [] synonym: "juxtaglomerular cell" BROAD [] synonym: "renin secreting cell" EXACT [] xref: FMA:84138 is_a: CL:0000154 ! protein secreting cell is_a: CL:0000192 ! smooth muscle cell is_a: CL:1000618 ! juxtaglomerular complex cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0002001 ! renin secretion into blood stream intersection_of: part_of UBERON:0002113 ! kidney relationship: capable_of GO:0002001 ! renin secretion into blood stream relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000649 name: prickle cell alt_id: CL:0002186 def: "A cell with delicate radiating processes known as desmosomes that form intercellular bridges between other cells of this type. This cell type forms the stratum spinosum (prickle cell layer). A function of this cell is to generate keratin." [GOC:tfm, ISBN:0721662544, ISBN:0815332181] subset: human_reference_atlas synonym: "prickle cell of epidermis" EXACT [] xref: FMA:69059 is_a: CL:0000312 ! keratinocyte relationship: part_of UBERON:0002026 ! stratum spinosum of epidermis relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000650 name: mesangial cell def: "A cell type that encapsulates the capillaries and venules in the kidney. This cell secretes mesangial matrix that provides the structural support for the capillaries." [GOC:tfm, http://www.copewithcytokines.de/cope.cgi?key=mesangial%20cells] comment: Do all of these cells really develop from some mesenchymal stem cell? synonym: "kidney mesangial cell" EXACT [] xref: BTO:0000853 xref: CALOHA:TS-0617 xref: FMA:70972 xref: MESH:D050527 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000669 ! pericyte relationship: develops_from CL:0000134 ! mesenchymal stem cell [Term] id: CL:0000651 name: mucous neck cell def: "A mucus-secreting cell, with numerous apical secretory vesicles containing mucins; nucleus are basally displaced; numerous at the neck of mucus secreting glands" [GOC:tfm] synonym: "neck cell" BROAD [] is_a: CL:0000150 ! glandular epithelial cell is_a: CL:0000319 ! mucus secreting cell [Term] id: CL:0000652 name: pinealocyte def: "This cell type produces and secretes melatonin and forms the pineal parenchyma. Extending from each cell body, which has a spherical, oval or lobulated mucleus, are one or more tortuous basophilic processes, containing parallel microtubules known as synaptic ribbons. These processes end in expanded terminal buds near capillaries or less, frequently, ependymal cells of the pineal recess. The terminal buds contain granular endoplasmic reticulum, mitochondria and electron-dense cored vesicles, which store monoamines and polypeptide hormones, release of which appears to require sympathetic innervation." [GOC:tfm, http://en.wikipedia.org/wiki/Pinealocyte, ISBN:0517223651, PMID:16687276] xref: BTO:0001068 xref: FMA:83417 is_a: CL:0000163 ! endocrine cell is_a: CL:0000710 ! neurecto-epithelial cell is_a: CL:0002319 ! neural cell relationship: capable_of GO:0030187 ! melatonin biosynthetic process relationship: part_of UBERON:0001905 ! pineal body [Term] id: CL:0000653 name: podocyte def: "A specialized kidney epithelial cell, contained within a glomerulus, that contains \"feet\" that interdigitate with the \"feet\" of other podocytes." [GOC:tfm, https://doi.org/10.1101/2021.10.10.463829] subset: human_reference_atlas synonym: "epithelial cell of visceral layer of glomerular capsule" BROAD [FMA:70967] synonym: "glomerular podocyte" EXACT [FMA:70967] synonym: "glomerular visceral epithelial cell" EXACT [] synonym: "kidney podocyte" EXACT [] synonym: "renal podocyte" EXACT [] xref: BTO:0002295 xref: FMA:70967 is_a: CL:0002522 ! renal filtration cell is_a: CL:1000450 ! epithelial cell of glomerular capsule intersection_of: CL:0000066 ! epithelial cell intersection_of: part_of UBERON:0005751 ! glomerular visceral epithelium relationship: dc-contributor https://orcid.org/0000-0002-1773-2692 relationship: part_of UBERON:0005751 ! glomerular visceral epithelium relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens property_value: seeAlso https://github.com/obophenotype/cell-ontology/issues/1460 xsd:string [Term] id: CL:0000654 name: primary oocyte def: "A primary oocyte is an oocyte that has not completed female meosis I." [GOC:tfm, ISBN:0721662544] subset: human_reference_atlas synonym: "primary oogonium" RELATED [] xref: BTO:0000512 xref: FMA:18645 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000023 {is_inferred="true"} ! oocyte intersection_of: CL:0000023 ! oocyte intersection_of: has_not_completed GO:0051321 ! meiotic cell cycle relationship: develops_from CL:0000024 ! oogonial cell relationship: has_not_completed GO:0051321 ! meiotic cell cycle relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000655 name: secondary oocyte def: "A secondary oocyte is an oocyte that has not completed meiosis II." [GOC:tfm, ISBN:0721662544] synonym: "primary oogonium" RELATED [] xref: BTO:0003094 xref: FMA:18646 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000023 {is_inferred="true"} ! oocyte intersection_of: CL:0000023 ! oocyte intersection_of: has_not_completed GO:0007147 ! female meiosis II relationship: develops_from CL:0000654 ! primary oocyte relationship: has_not_completed GO:0007147 ! female meiosis II [Term] id: CL:0000656 name: primary spermatocyte def: "A diploid cell that has derived from a spermatogonium and can subsequently begin meiosis and divide into two haploid secondary spermatocytes." [GOC:tfm, ISBN:0721662544] xref: BTO:0001115 xref: CALOHA:TS-2194 xref: FMA:72292 is_a: CL:0000017 {is_inferred="true"} ! spermatocyte intersection_of: CL:0000017 ! spermatocyte intersection_of: bearer_of PATO:0001394 ! diploid intersection_of: capable_of GO:0007140 ! male meiotic nuclear division relationship: bearer_of PATO:0001394 ! diploid relationship: capable_of GO:0007140 ! male meiotic nuclear division [Term] id: CL:0000657 name: secondary spermatocyte def: "One of the two haploid cells into which a primary spermatocyte divides, and which in turn gives origin to spermatids." [GOC:tfm, ISBN:0721662544] xref: BTO:0000709 xref: CALOHA:TS-2195 xref: FBbt:00004941 xref: FMA:72293 is_a: CL:0000017 {is_inferred="true"} ! spermatocyte is_a: CL:0000413 ! haploid cell intersection_of: CL:0000017 ! spermatocyte intersection_of: bearer_of PATO:0001375 ! haploid intersection_of: capable_of GO:0007142 ! male meiosis II relationship: capable_of GO:0007142 ! male meiosis II relationship: develops_from CL:0000656 ! primary spermatocyte [Term] id: CL:0000658 name: cuticle secreting cell def: "An epithelial cell that secretes cuticle." [GOC:tfm] is_a: CL:0000066 ! epithelial cell is_a: CL:0000327 ! extracellular matrix secreting cell [Term] id: CL:0000659 name: eggshell secreting cell def: "An extracellular matrix secreting cell that secretes eggshell." [GOC:tfm] is_a: CL:0000327 ! extracellular matrix secreting cell is_a: CL:0000500 ! follicular epithelial cell [Term] id: CL:0000660 name: glycocalyx secreting cell def: "An extracellular matrix secreting cell that secretes glycocalyx." [GOC:tfm] is_a: CL:0000327 ! extracellular matrix secreting cell [Term] id: CL:0000661 name: distal tip cell (sensu Nematoda) is_a: CL:0000422 ! mitogenic signaling cell [Term] id: CL:0000662 name: neuroglioblast (sensu Nematoda) is_a: CL:0000468 ! neuroglioblast (sensu Nematoda and Protostomia) [Term] id: CL:0000663 name: valve cell is_a: CL:0000003 ! native cell [Term] id: CL:0000664 name: closable valve cell is_a: CL:0000185 ! myoepithelial cell is_a: CL:0000663 ! valve cell [Term] id: CL:0000665 name: permanently open valve cell is_a: CL:0000663 ! valve cell [Term] id: CL:0000666 name: fenestrated cell synonym: "window cell" EXACT [] is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000667 name: collagen secreting cell def: "An extracellular matrix secreting cell that secretes collagen." [GOC:tfm] is_a: CL:0000327 ! extracellular matrix secreting cell [Term] id: CL:0000668 name: obsolete parenchymal cell def: "OBSOLETE: The cell characteristic of an organ, as distinguished from associated connective or supporting tissues." [ISBN:0471245208] comment: OBSOLETE: Term was made obsolete to avoid confusion with plant parenchymal cell. Cell type has a similar but slightly different meaning in botany (plants): see PO:0000074. xref: BTO:0002174 xref: FMA:84638 is_obsolete: true [Term] id: CL:0000669 name: pericyte alt_id: CL:0000184 def: "An elongated, contractile cell found wrapped about precapillary arterioles outside the basement membrane. Pericytes are present in capillaries where proper adventitia and muscle layer are missing (thus distingushing this cell type from adventitial cells). They are relatively undifferentiated and may become fibroblasts, macrophages, or smooth muscle cells." [GOC:dsd, GOC:tfm, ISBN:0721662544, MESH:D020286, PMID:16807374, PMID:17986482, PMID:20024907] comment: Pericytes are CD10-positive, CD13-positive, CD31-negative, CD45-negative, CD106-positive, CD117-negative, CD140-positive, CD144-negative, CD146-positive, CD271-positive, CD325-positive, NG2-positive, RGS5-positive, SMA-positive, and desmin-positive. A subpopulation is CD248-positive. They are also capable of producing angiopoietin 1, CXCL12, TGF-beta, and VEGF-A. subset: human_reference_atlas synonym: "adventitial cell" RELATED [] synonym: "adventitial reticular cell" EXACT [] synonym: "ARC" EXACT [PMID:17986482] synonym: "cell of Rouget" EXACT [] synonym: "pericyte cell" EXACT [] synonym: "pericyte of Rouget" EXACT [] xref: BTO:0002441 xref: FMA:63174 is_a: CL:0000183 ! contractile cell is_a: CL:0000630 ! supporting cell is_a: CL:0002320 ! connective tissue cell is_a: CL:0008034 ! mural cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000670 name: primordial germ cell def: "A primordial germ cell is a diploid germ cell precursors that transiently exist in the embryo before they enter into close association with the somatic cells of the gonad and become irreversibly committed as germ cells." [GOC:tfm, PMID:1381289] synonym: "gonocyte" EXACT [] synonym: "primitive germ cell" EXACT [] xref: FMA:70567 is_a: CL:0000039 {is_inferred="true"} ! germ line cell is_a: CL:0000219 {is_inferred="true"} ! motile cell intersection_of: CL:0000039 ! germ line cell intersection_of: capable_of GO:0048870 ! cell motility intersection_of: part_of UBERON:0000922 ! embryo relationship: part_of UBERON:0000922 ! embryo [Term] id: CL:0000671 name: centripetally migrating follicle cell xref: FBbt:00004906 is_a: CL:0000477 ! follicle cell of egg chamber [Term] id: CL:0000672 name: obsolete tracheary element def: "Obsolete. Use PO:0000290 from Plant Ontology instead. A water conducting cell, tracheid or vessel member." [ISBN:0471245208] is_obsolete: true replaced_by: PO:0000290 [Term] id: CL:0000673 name: Kenyon cell is_a: CL:0000028 ! CNS neuron (sensu Nematoda and Protostomia) [Term] id: CL:0000674 name: interfollicle cell synonym: "fly stalk cell" EXACT [] xref: FBbt:00004910 is_a: CL:0000075 ! columnar/cuboidal epithelial cell [Term] id: CL:0000675 name: female gamete def: "A mature sexual reproductive cell of the female germline." [GOC:tfm] is_a: CL:0000021 {is_inferred="true"} ! female germ cell is_a: CL:0000300 ! gamete [Term] id: CL:0000676 name: cap cell xref: BTO:0001033 is_a: CL:0000378 ! supporting cell (sensu Nematoda and Protostomia) [Term] id: CL:0000677 name: gut absorptive cell def: "Cell of the intestinal epithelium with a brush border made up of many parallel packed microvilli; associated with absorption, particularly of macromolecules." [JB:jb] is_a: BFO:0000004 ! independent continuant is_a: CL:0000212 ! absorptive cell relationship: part_of UBERON:0001277 ! intestinal epithelium [Term] id: CL:0000678 name: commissural neuron is_a: CL:0000540 ! neuron [Term] id: CL:0000679 name: glutamatergic neuron xref: WBbt:0006829 is_a: CL:0000151 ! secretory cell is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0061535 ! glutamate secretion, neurotransmission relationship: capable_of GO:0061535 ! glutamate secretion, neurotransmission [Term] id: CL:0000680 name: muscle precursor cell def: "A non-terminally differentiated cell that is capable of developing into a muscle cell." [GOC:add] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000055 ! non-terminally differentiated cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0011115 ! precursor cell intersection_of: RO:0002203 CL:0000187 ! develops into muscle cell relationship: develops_from CL:0000222 ! mesodermal cell relationship: RO:0002203 CL:0000187 ! develops into muscle cell [Term] id: CL:0000681 name: radial glial cell def: "A cell present in the developing CNS. Functions as both a precursor cell and as a scaffold to support neuronal migration." [GOC:dph] comment: Unlike that of mammals, the brain of adult teleost fish exhibits an intense and widespread neurogenic activity as a result of the persistence of\nradial glial cells acting as neural progenitors throughout life. synonym: "forebrain radial glial cell" NARROW [] is_a: CL:0000125 ! glial cell relationship: develops_from CL:0000710 ! neurecto-epithelial cell [Term] id: CL:0000682 name: M cell of gut def: "An absorptive cell of the gut epithelium that endocytoses microorganisms and intact macromolecules from the gut lumen and transports them to the subepithelial space where they are presented to antigen-presenting cells and lymphocytes." [GOC:jb, GOC:tfm] comment: Should double check and see if M cells are particular to a specific region. subset: human_reference_atlas synonym: "M cell" BROAD [] synonym: "M-cell" EXACT [] synonym: "microfold cell" EXACT [] xref: BTO:0003600 xref: FMA:62929 is_a: CL:0000473 ! defensive cell is_a: CL:0000627 ! transporting cell is_a: CL:0002251 ! epithelial cell of alimentary canal relationship: part_of UBERON:0003929 ! digestive tract epithelium relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000683 name: ependymoglial cell def: "A cell that transports hormones from neurosecretory cells. This nerve cell is characterized by bipolar shape and endfeet that contact a basal lamina around blood vessels, and/or the pia mater or vitreous body of the eye and additionally contact the ventricular surface or sub-retinal space." [http://neurolex.org/wiki/Category\:Ependymoglial_Cell, JB:jb] synonym: "ependymal astrocyte" EXACT [] xref: MESH:D063928 is_a: CL:0000127 ! astrocyte [Term] id: CL:0000684 name: littoral cell of liver is_a: CL:0000077 ! mesothelial cell relationship: part_of UBERON:0002107 ! liver [Term] id: CL:0000685 name: obsolete meristematic cell def: "Obsolete. Use PO:0004010 from Plant Ontology instead. A cell synthesizing protoplasm and producing new cells by division and with only a primary cell wall." [PO:0004010] is_obsolete: true replaced_by: PO:0004010 [Term] id: CL:0000686 name: cerebrospinal fluid secreting cell def: "A columnar/cuboidal epithelial cell that secretes cerebrospinal fluid." [GOC:tfm] is_a: CL:0000151 {is_inferred="true"} ! secretory cell is_a: CL:0000710 ! neurecto-epithelial cell intersection_of: CL:0000151 ! secretory cell intersection_of: capable_of GO:0033326 ! cerebrospinal fluid secretion relationship: capable_of GO:0033326 ! cerebrospinal fluid secretion relationship: develops_from CL:0000333 ! migratory neural crest cell [Term] id: CL:0000687 name: R1 photoreceptor cell synonym: "R1 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000688 name: perijunctional fibroblast def: "A fibroblast-like cell that provides support at neuromuscular junctions in vertebrates and are localized outside the synaptic basal lamina." [JB:jb] is_a: CL:0000057 ! fibroblast is_a: CL:0000630 ! supporting cell [Term] id: CL:0000689 name: myoendocrine cell def: "A cell with both myofibrils and secretory granules." [JB:jb] is_a: CL:0000163 ! endocrine cell [Term] id: CL:0000690 name: R2 photoreceptor cell synonym: "R2 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000691 name: stellate interneuron subset: BDS_subset is_a: CL:0000099 ! interneuron is_a: CL:0000104 ! multipolar neuron intersection_of: CL:0000099 ! interneuron intersection_of: bearer_of PATO:0070010 ! stellate morphology relationship: bearer_of PATO:0070010 ! stellate morphology [Term] id: CL:0000692 name: terminal Schwann cell def: "A neuroglial cell of the peripheral nervous system inside the basal lamina of the neuromuscular junction providing chemical and physical support to the synapse." [JB:jb, PMID:16136171] synonym: "Schwann cell" BROAD [] is_a: CL:0000630 ! supporting cell is_a: CL:0002376 ! non-myelinating Schwann cell [Term] id: CL:0000693 name: neurogliaform cell def: "An interneuron that has spider-like appearance with a small round soma, a large number (7-10) of short, smooth, or slightly beaded primary dendrites that give rise to only a few secondary branches, and a branched axon that establishes a dense axonal mesh with thin shafts." [JB:jb, PMID:17122314] subset: BDS_subset synonym: "neuroglioform cell" EXACT [PMID:3235828] synonym: "NGF cell" EXACT [PMID:18568015] synonym: "spiderweb cell" EXACT [] is_a: CL:0000099 ! interneuron is_a: CL:0000104 ! multipolar neuron intersection_of: CL:0000099 ! interneuron intersection_of: bearer_of PATO:0070001 ! neurogliaform morphology relationship: bearer_of PATO:0070001 ! neurogliaform morphology [Term] id: CL:0000694 name: R3 photoreceptor cell synonym: "R3 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000695 name: Cajal-Retzius cell def: "A neuron of the human embryonic marginal zone which display, as a salient feature, radial ascending processes that contact the pial surface, and a horizontal axon plexus located in the deep marginal zone. One feature of these cells in mammals is that they express the Reelin gene." [PMID:10600995, PMID:9728912] comment: While previously called 'pioneer neurons' of the marginal zone, Cajal-Retzius cells are differentiated from pioneer neurons (which are Reln-negative) by their Reln-immunoreactivity. {xref="PMID:10600995"} synonym: "CR cells" EXACT [WikipediaVersioned:Cajal–Retzius_cell&oldid=1032081753] synonym: "Horizontal cells of Cajal" EXACT [WikipediaVersioned:Cajal–Retzius_cell&oldid=1032081753] is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) is_a: CL:2000029 ! central nervous system neuron relationship: bearer_of PATO:0070006 ! cortical bipolar morphology relationship: dc-contributor https://orcid.org/0000-0001-7258-9596 relationship: RO:0002100 UBERON:0010403 ! has soma location brain marginal zone [Term] id: CL:0000696 name: PP cell def: "A cell that stores and secretes pancreatic polypeptide hormone." [GOC:tfm, JB:jb, PMID:15153415] synonym: "type F enteroendocrine cell" EXACT [] xref: FMA:62938 xref: FMA:83409 is_a: CL:0000164 ! enteroendocrine cell is_a: CL:0000167 ! peptide hormone secreting cell [Term] id: CL:0000697 name: R4 photoreceptor cell synonym: "R4 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000698 name: obsolete paraganglial cell is_obsolete: true [Term] id: CL:0000699 name: paraganglial type 1 cell def: "A type of glomus or chief cell, is sensitive to hypoxia and produce catecholamines." [GOC:tfm] is_a: CL:0000165 ! neuroendocrine cell [Term] id: CL:0000700 name: dopaminergic neuron def: "A neuron that releases dopamine as a neurotransmitter." [GOC:dhill] synonym: "dopaminergic cell" EXACT [] xref: BTO:0004032 xref: FMA:84787 xref: MESH:D059290 xref: WBbt:0006746 is_a: CL:0000151 ! secretory cell is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0061527 ! dopamine secretion, neurotransmission relationship: capable_of GO:0061527 ! dopamine secretion, neurotransmission [Term] id: CL:0000701 name: paraganglia type 2 cell def: "Supports paraganglial type 1 cell." [JB:jb] is_a: CL:0000630 ! supporting cell [Term] id: CL:0000702 name: R5 photoreceptor cell synonym: "R5 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000703 name: sustentacular cell def: "Cell that provides some or all mechanical, nutritional and phagocytic support to their neighbors." [JB:jb] xref: BTO:0002315 is_a: CL:0000630 ! supporting cell [Term] id: CL:0000704 name: endothelial tip cell def: "A specialized endothelial cell that senses extracellular signals and guides the directed growth of blood vessels." [PMID:15376331] is_a: CL:0000071 ! blood vessel endothelial cell [Term] id: CL:0000705 name: R6 photoreceptor cell synonym: "R6 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000706 name: choroid plexus epithelial cell alt_id: CL:1000430 def: "Specialized ependymal cell that produces the cerebrospinal fluid from the blood and secretes it into the lumen of the brain and spinal chord." [GOC:add, GOC:tfm, JB:jb, PMID:9550134] synonym: "epithelial cell of choroid plexus" EXACT [] xref: FMA:70549 is_a: CL:0000065 ! ependymal cell is_a: CL:0000627 ! transporting cell is_a: CL:0002319 ! neural cell intersection_of: CL:0000065 ! ependymal cell intersection_of: part_of UBERON:0001886 ! choroid plexus relationship: part_of UBERON:0001886 ! choroid plexus [Term] id: CL:0000707 name: R7 photoreceptor cell synonym: "R7 cell" EXACT [] is_a: CL:0000287 ! eye photoreceptor cell is_a: CL:0000494 ! UV sensitive photoreceptor cell [Term] id: CL:0000708 name: leptomeningeal cell def: "Stromal cell that forms the internal covering of the vertebrate brain and produces ECM for this and the choroid plexus." [JB:jb] synonym: "leptomemingeal cell" RELATED [] is_a: CL:0000327 {is_inferred="true"} ! extracellular matrix secreting cell is_a: CL:0002319 ! neural cell intersection_of: CL:0000327 ! extracellular matrix secreting cell intersection_of: part_of UBERON:0003210 ! blood-cerebrospinal fluid barrier relationship: part_of UBERON:0003210 ! blood-cerebrospinal fluid barrier [Term] id: CL:0000709 name: R8 photoreceptor cell synonym: "R8 cell" EXACT [] is_a: CL:0000488 ! visible light photoreceptor cell is_a: CL:2000019 ! compound eye photoreceptor cell relationship: part_of UBERON:0000971 ! ommatidium [Term] id: CL:0000710 name: neurecto-epithelial cell def: "Epithelial cells derived from neural plate and neural crest." [GOC:tfm] comment: The term "neuroepithelial cell" is used to describe both this cell type and sensory epithelial cell (CL:0000098). synonym: "neuroepithelial cell" BROAD [] xref: BTO:0004301 xref: FMA:70557 is_a: CL:0000075 ! columnar/cuboidal epithelial cell is_a: CL:0002077 ! ecto-epithelial cell intersection_of: CL:0002077 ! ecto-epithelial cell intersection_of: develops_from CL:0000133 ! neurectodermal cell relationship: develops_from CL:0000133 ! neurectodermal cell [Term] id: CL:0000711 name: cumulus cell def: "Cumulus cell is a specialized granulosa cell that surrounds and nourishes the oocyte. This cell-type surrounds the fully-grown oocyte to form a cumulus-oocyte complex (abbr. COC). The terms cumulus oophorus cells, cumulus granulosa cells, cumulus oophorous granulosa cells, granulosa-cumulus cells are used to make a distinction between this cell and the other functionally different subpopulation of granulosa cells at the wall of the Graafian follicle." [GOC:tfm, http://www.copewithcytokines.org/cope.cgi?key=cumulus%20cells] subset: human_reference_atlas xref: BTO:0002236 xref: MESH:D054885 is_a: CL:0000154 ! protein secreting cell is_a: CL:0002174 ! follicular cell of ovary relationship: develops_from CL:0000501 ! granulosa cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000712 name: stratum granulosum cell is_a: CL:0000362 ! epidermal cell intersection_of: CL:0000362 ! epidermal cell intersection_of: part_of UBERON:0002069 ! stratum granulosum of epidermis relationship: part_of UBERON:0002069 ! stratum granulosum of epidermis [Term] id: CL:0000713 name: corona radiata cell is_a: CL:0000711 ! cumulus cell [Term] id: CL:0000715 name: embryonic crystal cell xref: FBbt:00001690 is_a: CL:0000392 ! crystal cell is_a: CL:0000736 ! embryonic gland hemocyte [Term] id: CL:0000716 name: lymph gland crystal cell is_a: CL:0000392 ! crystal cell is_a: CL:0000735 ! lymph gland hemocyte [Term] id: CL:0000717 name: obsolete fusimotor neuron def: "OBSOLETE. A subset of motor neurons that innervates intrafusal muscle fibers and has small diameter axons." [PMID:15582775] comment: Term merged into CL:0008037. Refer to https://github.com/obophenotype/cell-ontology/issues/1364 is_obsolete: true replaced_by: CL:0008037 [Term] id: CL:0000718 name: compound eye cone cell synonym: "cone cell (sensu Endopterygota)" RELATED [] xref: FBbt:00004193 is_a: BFO:0000004 ! independent continuant is_a: CL:0000306 ! crystallin accumulating cell relationship: part_of UBERON:0000018 ! compound eye [Term] id: CL:0000719 name: posterior cone cell (sensu Endopterygota) is_a: CL:0000718 ! compound eye cone cell [Term] id: CL:0000720 name: anterior cone cell (sensu Endopterygota) is_a: CL:0000718 ! compound eye cone cell [Term] id: CL:0000721 name: equatorial cone cell (sensu Endopterygota) is_a: CL:0000718 ! compound eye cone cell [Term] id: CL:0000722 name: cystoblast is_a: CL:0000548 ! animal cell is_a: CL:0000586 ! germ cell relationship: only_in_taxon NCBITaxon:6656 ! Arthropoda [Term] id: CL:0000723 name: somatic stem cell def: "A stem cell that can give rise to cell types of the body other than those of the germ-line." [GO:0048103] xref: CALOHA:TS-2086 xref: FMA:63368 xref: MESH:D053687 is_a: CL:0000034 {is_inferred="true"} ! stem cell is_a: CL:0002371 ! somatic cell intersection_of: CL:0000034 ! stem cell intersection_of: capable_of GO:0048103 ! somatic stem cell division relationship: capable_of GO:0048103 ! somatic stem cell division [Term] id: CL:0000724 name: heterocyst def: "A differentiated cell that functions as a site of nitrogen fixation under aerobic conditions." [MA:ma] xref: BTO:0000600 is_a: CL:0000520 ! prokaryotic cell is_a: CL:0000725 ! nitrogen fixing cell [Term] id: CL:0000725 name: nitrogen fixing cell is_a: BFO:0000040 ! material entity is_a: CL:0000003 ! native cell intersection_of: CL:0000003 ! native cell intersection_of: capable_of GO:0009399 ! nitrogen fixation relationship: capable_of GO:0009399 ! nitrogen fixation [Term] id: CL:0000726 name: chlamydospore def: "An asexual 1-celled spore (primarily for perennation, not dissemination). Originates endogenously and singly within part of a pre-existing cell by the contraction of the protoplast. Possesses an inner secondary and often thickened hyaline or brown wall, usually impregnated with hydrophobic material." [GOC:tfm, ISBN:085199377X] comment: Considering obsoleting as sometimes used to refer to protozoans too. But reference indicates term was intended for fungus. is_a: CL:0000605 ! fungal asexual spore [Term] id: CL:0000727 name: primary pigment cell is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia) [Term] id: CL:0000728 name: secondary pigment cell is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia) [Term] id: CL:0000729 name: tertiary pigment cell is_a: CL:0001658 ! visual pigment cell (sensu Nematoda and Protostomia) [Term] id: CL:0000730 name: leading edge cell def: "A cell at the front of a migrating epithelial sheet." [MA:ma] is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000731 name: urothelial cell def: "A cell of a layer of transitional epithelium in the wall of the bladder, ureter, and renal pelvis, external to the lamina propria." [GOC:tfm, MA:ma] synonym: "bladder transitional cell" NARROW [] synonym: "transitional epithelial cell of urinary bladder" NARROW [] synonym: "urinary tract transitional epithelial cell" NARROW [] xref: FMA:84127 is_a: CL:0000244 {is_inferred="true"} ! transitional epithelial cell intersection_of: CL:0000244 ! transitional epithelial cell intersection_of: part_of UBERON:0000365 ! urothelium relationship: part_of UBERON:0000365 ! urothelium [Term] id: CL:0000732 name: amoeboid cell is_a: CL:0000219 ! motile cell [Term] id: CL:0000733 name: lymph gland plasmatocyte is_a: CL:0000394 ! plasmatocyte is_a: CL:0000735 ! lymph gland hemocyte [Term] id: CL:0000734 name: embryonic gland plasmatocyte is_a: CL:0000394 ! plasmatocyte is_a: CL:0000736 ! embryonic gland hemocyte [Term] id: CL:0000735 name: lymph gland hemocyte xref: FBbt:00005917 is_a: CL:0000387 ! hemocyte (sensu Arthropoda) [Term] id: CL:0000736 name: embryonic gland hemocyte is_a: CL:0000387 ! hemocyte (sensu Arthropoda) [Term] id: CL:0000737 name: striated muscle cell def: "Muscle cell which has as its direct parts myofilaments organized into sarcomeres." [GOC:tfm, ISBN:0721662544] xref: BTO:0002916 xref: CALOHA:TS-2157 xref: FMA:86936 is_a: CL:0000187 ! muscle cell intersection_of: CL:0000187 ! muscle cell intersection_of: bearer_of PATO:0001410 ! striated intersection_of: has_part GO:0030017 ! sarcomere disjoint_from: CL:0008000 ! non-striated muscle cell relationship: bearer_of PATO:0001410 ! striated relationship: has_part GO:0030017 ! sarcomere [Term] id: CL:0000738 name: leukocyte def: "An achromatic cell of the myeloid or lymphoid lineages capable of ameboid movement, found in blood or other tissue." [GOC:add, GOC:tfm, ISBN:978-0-323-05290-0] synonym: "immune cell" RELATED [] synonym: "leucocyte" EXACT [] synonym: "white blood cell" EXACT [] xref: BTO:0000751 xref: CALOHA:TS-0549 xref: FMA:62852 xref: MESH:D007962 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000219 ! motile cell is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell is_a: CL:0002242 ! nucleate cell intersection_of: CL:0000988 ! hematopoietic cell intersection_of: bearer_of PATO:0002505 ! nucleated intersection_of: capable_of GO:0001667 ! ameboidal-type cell migration relationship: capable_of GO:0001667 ! ameboidal-type cell migration relationship: develops_from CL:0000037 ! hematopoietic stem cell relationship: only_in_taxon NCBITaxon:7742 ! Vertebrata relationship: part_of UBERON:0002405 ! immune system [Term] id: CL:0000740 name: retinal ganglion cell def: "The set of neurons that receives neural inputs via bipolar, horizontal and amacrine cells. The axons of these cells make up the optic nerve." [GOC:dph] subset: human_reference_atlas synonym: "gangliocyte" EXACT [] synonym: "ganglion cell of retina" EXACT [] synonym: "RGC" EXACT [] xref: BTO:0001800 xref: FMA:67765 xref: MESH:D012165 is_a: CL:0000117 ! CNS neuron (sensu Vertebrata) relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002100 UBERON:0000966 ! has soma location retina [Term] id: CL:0000741 name: spinal accessory motor neuron def: "A motor neuron that is located in the cervical region of the spinal cord and selectively innervates the sternocleidmastoid or trapezius muscle. Unlike other motor neurons, they extend axons dorsally along lateral margins of the spinal cord." [PMID:16267219] synonym: "SACMN" EXACT [] is_a: CL:0008039 ! lower motor neuron [Term] id: CL:0000742 name: periarticular chondrocyte def: "A round chondrocyte that first differentiates in the late embryonic growth plate of bone." [PMID:15951842] is_a: CL:1001607 ! articular chondrocyte [Term] id: CL:0000743 name: hypertrophic chondrocyte def: "Chondrocyte that is terminally differentiated, produces type X collagen, is large in size, and often associated with the replacement of cartilage by bone (endochondral ossification)." [GO_REF:0000034, PMID:15951842] comment: is hypertrophic pathological or normal? and can it be described using a pato term? subset: human_reference_atlas is_a: CL:0000138 ! chondrocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000744 name: columnar chondrocyte def: "A columnar chondrocyte that differentiates in the late embryonic growth plate of bone. Columnar chondrocytes vigorously proliferate and form columns in the growth plate." [PMID:15951842] subset: human_reference_atlas is_a: CL:0000138 ! chondrocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000745 name: retina horizontal cell def: "A neuron that laterally connects other neurons in the inner nuclear layer of the retina." [ISBN:0195088433] subset: human_reference_atlas synonym: "horizontal cell" EXACT [] xref: BTO:0004120 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000099 ! interneuron is_a: CL:0009004 ! retinal cell relationship: part_of UBERON:0003902 ! retinal neural layer relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000746 name: cardiac muscle cell alt_id: FMA:83808 def: "Cardiac muscle cells are striated muscle cells that are responsible for heart contraction. In mammals, the contractile fiber resembles those of skeletal muscle but are only one third as large in diameter, are richer in sarcoplasm, and contain centrally located instead of peripheral nuclei." [GOC:mtg_cardiacconduct_nov11, GOC:tfm, ISBN:0323052908, PMID:22426062, PMID:4711263] comment: This class encompasses the muscle cells responsible for heart* contraction in both vertebrates and arthropods. The ultrastucture of a wide range of arthropod heart cells has been examined including spiders, horseshoe crabs, crustaceans (see Sherman, 1973 and refs therein) and insects (see Lehmacher et al (2012) and refs therein). According to these refs, the cells participating in heart contraction in all cases are transversely striated. Insects hearts additionally contain ostial cells, also transversely striated muscle cells, but which do not participate in heart contraction. subset: human_reference_atlas synonym: "cardiac muscle fiber" EXACT [GO:0048739] synonym: "cardiac myocyte" EXACT [] synonym: "cardiocyte" BROAD [] synonym: "cardiomyocyte" EXACT [] synonym: "heart muscle cell" EXACT [] xref: BTO:0001539 xref: CALOHA:TS-0115 xref: FMA:14067 xref: MESH:D032383 is_a: CL:0000737 ! striated muscle cell is_a: CL:0002494 ! cardiocyte intersection_of: CL:0000187 ! muscle cell intersection_of: bearer_of PATO:0002478 ! transversely striated intersection_of: has_part GO:0030017 ! sarcomere intersection_of: part_of UBERON:0007100 ! primary circulatory organ intersection_of: participates_in GO:0060047 ! heart contraction relationship: bearer_of PATO:0002478 ! transversely striated relationship: develops_from CL:0000513 ! cardiac muscle myoblast relationship: participates_in GO:0060047 ! heart contraction relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000747 name: cyanophore def: "A pigment cell derived from the neural crest. Contains blue pigment of unknown chemical composition in fibrous organelles termed cyanosomes. This gives a blue appearance." [SANBI:mhl] synonym: "blue chromatophore" RELATED [] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000147 ! pigment cell relationship: develops_from CL:0005005 ! cyanoblast [Term] id: CL:0000748 name: retinal bipolar neuron def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the inner plexiform layer." [PMID:14689473] subset: human_reference_atlas is_a: CARO:0000000 ! anatomical entity is_a: CL:0000103 ! bipolar neuron is_a: CL:0000679 ! glutamatergic neuron is_a: CL:0008028 ! visual system neuron is_a: CL:0009004 ! retinal cell intersection_of: CL:0000103 ! bipolar neuron intersection_of: RO:0002100 UBERON:0000966 ! has soma location retina relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002100 UBERON:0000966 ! has soma location retina [Term] id: CL:0000749 name: ON-bipolar cell def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the inner half of the inner plexiform layer. These cells depolarize in response to light stimulation of their corresponding photoreceptors." [PMID:14689473] subset: human_reference_atlas is_a: CL:0000748 ! retinal bipolar neuron relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000750 name: OFF-bipolar cell def: "A bipolar neuron found in the retina and having connections with photoreceptors cells and neurons in the outer half of the inner plexiform layer. These cells depolarize in response to light to dark transition." [PMID:14689473] subset: human_reference_atlas is_a: CL:0000748 ! retinal bipolar neuron relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000751 name: rod bipolar cell def: "A bipolar neuron found in the retina that is synapsed by rod photoreceptor cells but not by cone photoreceptor cells. These neurons depolarize in response to light." [GOC:tfm, PMID:14689473] subset: human_reference_atlas xref: FMA:67750 is_a: CL:0000748 ! retinal bipolar neuron relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4 relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5 relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell [Term] id: CL:0000752 name: cone retinal bipolar cell def: "A bipolar neuron found in the retina and having connections with cone photoreceptor cells and neurons in the inner plexiform layer." [PMID:14689473] is_a: CL:0000748 ! retinal bipolar neuron intersection_of: CL:0000748 ! retinal bipolar neuron intersection_of: RO:0002103 CL:0000573 ! synapsed by retinal cone cell relationship: RO:0002103 CL:0000573 ! synapsed by retinal cone cell [Term] id: CL:0000753 name: type 1 cone bipolar cell (sensu Mus) def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The cell body of these cells is in the middle of the inner plexiform layer. The dendritic tree is stout and the axon terminates in sublamina 1. The axonal terminal is wide and has only a few varicosities." [PMID:14689473] synonym: "DB1 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008922 ! axon synapses in sublaminar layer S1 [Term] id: CL:0000754 name: type 2 cone bipolar cell (sensu Mus) def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The dendritic tree is not well filled and the dendrites are more delicate than in type 1 cells. The axon terminal is bushier and exhibits a dense plexus of varicosities in the inner part of sublamina 1 (Ghosh et al., 2004). It can be differentiated from other retinal bipolar neurons by its expression of marker genes: Neto1, Lhx3 and Irx-6 (Shekhar, 2016)." [PMID:14689473, PMID:27565351] synonym: "FMB cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell intersection_of: CL:0000748 {xref="PMID:27565351"} ! retinal bipolar neuron intersection_of: RO:0002292 PR:P50481 {xref="PMID:27565351"} ! expresses LIM/homeobox protein Lhx3 (mouse) intersection_of: RO:0002292 PR:Q8R4I7 {xref="PMID:27565351"} ! expresses neuropilin and tolloid-like protein 1 (mouse) intersection_of: RO:0002292 PR:Q9ER75 {xref="PMID:27565351"} ! expresses iroquois-class homeodomain protein IRX-6 (mouse) relationship: RO:0002102 UBERON:0008922 ! axon synapses in sublaminar layer S1 relationship: RO:0002292 PR:P50481 ! expresses LIM/homeobox protein Lhx3 (mouse) relationship: RO:0002292 PR:Q8R4I7 ! expresses neuropilin and tolloid-like protein 1 (mouse) relationship: RO:0002292 PR:Q9ER75 ! expresses iroquois-class homeodomain protein IRX-6 (mouse) [Term] id: CL:0000755 name: type 3 cone bipolar cell (sensu Mus) def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The dendritic tree is delicate and the dendritic tips appear small when compared with type 1 cells. The axon terminal is stratified and restricted to sublamina 2 of the inner plexiform layer." [PMID:14689473] synonym: "DB2 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008923 ! axon synapses in sublaminar layer S2 relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell [Term] id: CL:0000756 name: type 4 cone bipolar cell (sensu Mus) def: "An OFF-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the outer half of the inner plexiform layer. The cell has a diffuse axon terminal with varicosities in sublaminae 1 and 2 of the inner plexiform layer." [PMID:14689473] synonym: "DB3 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008923 ! axon synapses in sublaminar layer S2 relationship: RO:0002102 UBERON:0008924 ! axon synapses in sublaminar layer S3 relationship: RO:0002103 CL:0000604 ! synapsed by retinal rod cell [Term] id: CL:0000757 name: type 5 cone bipolar cell (sensu Mus) def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The axon terminal is restricted to sublamina 3 of the inner plexiform layer. It is narrowly stratified and branched. The dendritic tree has many delicate branches." [PMID:14689473] synonym: "DB4 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008924 ! axon synapses in sublaminar layer S3 [Term] id: CL:0000758 name: type 6 cone bipolar cell (sensu Mus) def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The cell has a loose, delicate axon terminal that opens in sublamina 3 of the inner plexiform layer and descends into sublamina 4." [PMID:14689473] synonym: "DB5 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4 [Term] id: CL:0000759 name: type 7 cone bipolar cell (sensu Mus) def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The axon terminal is narrowly stratified and are found just below a calretinin-expressing band in sublamina 4 of the inner plexiform layer." [PMID:14689473] synonym: "IMB cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4 [Term] id: CL:0000760 name: type 8 cone bipolar cell (sensu Mus) def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. This cell has the widest dendritic field and the widest axon terminal of all retinal bipolar cells. The axon terminal is delicate and stratified through sublaminae 4 and 5 of the inner plexiform layer." [PMID:14689473] synonym: "DB6 cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008925 ! axon synapses in sublaminar layer S4 relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5 [Term] id: CL:0000761 name: type 9 cone bipolar cell (sensu Mus) def: "An ON-bipolar neuron found in the retina and having connections with cone photoreceptors cells and neurons in the inner half of the inner plexiform layer. The dendritic tree is wide and the dendritic convergence indicates cone selectivity. The axon terminal is sparsely branched and terminates in sublamina 5 of the inner plexiform layer." [PMID:14689473] synonym: "BB cone bipolar cell" EXACT [] is_a: CL:0000752 ! cone retinal bipolar cell relationship: RO:0002102 UBERON:0008926 ! axon synapses in sublaminar layer S5 [Term] id: CL:0000762 name: nucleated thrombocyte def: "A nucleated blood cell involved in coagulation, typically seen in birds and other non-mammalian vertebrates." [GOC:add, GOC:tfm, PMID:16360205] comment: Note that this is a non-mammalian cell type. Use platelet ; CL:0000233 for thrombocytes (platelets) in mammals. is_a: BFO:0000040 ! material entity is_a: CL:0000226 ! single nucleate cell is_a: CL:0000763 {is_inferred="true"} ! myeloid cell intersection_of: CL:0000763 ! myeloid cell intersection_of: bearer_of PATO:0001407 ! mononucleate intersection_of: capable_of GO:0007596 ! blood coagulation relationship: capable_of GO:0007596 ! blood coagulation relationship: develops_from CL:0000828 ! thromboblast [Term] id: CL:0000763 name: myeloid cell def: "A cell of the monocyte, granulocyte, mast cell, megakaryocyte, or erythroid lineage." [GOC:add] subset: human_reference_atlas xref: BTO:0001441 xref: CALOHA:TS-0647 xref: MESH:D022423 is_a: CARO:0000000 ! anatomical entity is_a: CL:0000988 {is_inferred="true"} ! hematopoietic cell intersection_of: CL:0000988 ! hematopoietic cell intersection_of: develops_from CL:0000049 ! common myeloid progenitor relationship: develops_from CL:0000049 ! common myeloid progenitor relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000764 name: erythroid lineage cell alt_id: CL:0002156 def: "A immature or mature cell in the lineage leading to and including erythrocytes." [GOC:add, GOC:tfm] comment: Note that in FMA erythropoietic cells are types of nucleated erythrocytes and thus don't include erythrocytes. subset: human_reference_atlas synonym: "erythropoietic cell" EXACT [] xref: CALOHA:TS-0290 xref: FMA:62845 xref: FMA:83516 is_a: CL:0000763 ! myeloid cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000765 name: erythroblast def: "A nucleated precursor of an erythrocyte that lacks hematopoietic lineage markers." [GOC:add, ISBN:0721601464, PMID:18174176] synonym: "normoblast" EXACT [] xref: BTO:0001571 xref: CALOHA:TS-0289 xref: FMA:83504 xref: MESH:D004900 is_a: CL:0000764 {is_inferred="true"} ! erythroid lineage cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0000764 ! erythroid lineage cell intersection_of: capable_of GO:0030218 ! erythrocyte differentiation intersection_of: has_part GO:0005634 ! nucleus intersection_of: lacks_part GO:0005730 ! nucleolus intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: capable_of GO:0030218 ! erythrocyte differentiation relationship: develops_from CL:0000547 ! proerythroblast relationship: has_part GO:0005634 ! nucleus relationship: lacks_part GO:0005730 ! nucleolus relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G [Term] id: CL:0000766 name: myeloid leukocyte def: "A cell of the monocyte, granulocyte, or mast cell lineage." [GOC:add] is_a: CL:0000738 {is_inferred="true"} ! leukocyte is_a: CL:0000763 ! myeloid cell intersection_of: CL:0000738 ! leukocyte intersection_of: develops_from CL:0000049 ! common myeloid progenitor [Term] id: CL:0000767 name: basophil def: "Any of the immature or mature forms of a granular leukocyte that in its mature form has an irregularly shaped, pale-staining nucleus that is partially constricted into two lobes, and with cytoplasm that contains coarse, bluish-black granules of variable size. Basophils contain vasoactive amines such as histamine and serotonin, which are released on appropriate stimulation. A basophil is CD123-positive, CD193-positive, CD203c-positive, and FceRIa-positive." [GOC:add, GOC:amm, GOC:dsd, GOC:tfm, ISBN:0721601464, MESH:D001491, PMCID:PMC2626675, PMID:11927641, PMID:19741522, PMID:21236338, PMID:9933081] comment: Matures in the bone marrow and account for <1% of leukocytes in the peripheral blood, spleen, and bone marrow. Basophils are described as being CD11a-positive, CD11b-positive, CD13-positive, CD15-positive, CD18-positive, CD21-positive, CD25-positive, CD29-positive, CD35-positive, CD40-positive, CD40L-positive, CD44-positive, CD45R-negative, CD46-positive, CD49a-positive, CD49b-positive, CD49d-positive, CD55-positive, CD59-positive, CD62L-positive, CD63-positive, CD69-positive, CD90-negative, CD116-positive, CD117-negative, CD124-positive, CD125-positive, CD131-positive, CD161-positive, CD184-positive, CD191-positive, CD192-positive, CD197-positive, CD200R3-positive, CD218-positive, CD282-positive, CD284-positive, CD289-positive, CD290-positive, CD294-positive, natural killer cell receptor 2B4-positive, smad1-positive, CD3-negative, CD4-negative, CD7-negative, CD8-negative, CD14-negative, CD15-negative, CD16-negative, CD19-negative, CD20-negative, CD34-negative, CD36-negative, CD45R-negative, CD56-negative, CD57-negative, CD235a-negative, and GR1-negative. Transcription factors- GATA1-positive, PU.1-positive. subset: human_reference_atlas synonym: "basophilic leucocyte" EXACT [] synonym: "basophilic leukocyte" EXACT [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] xref: BTO:0000129 xref: CALOHA:TS-0073 xref: FMA:62862 is_a: CL:0000094 {is_inferred="true"} ! granulocyte intersection_of: CL:0000094 ! granulocyte intersection_of: RO:0002104 PR:000001344 ! has plasma membrane part ectonucleotide pyrophosphatase/phosphodiesterase family member 3 intersection_of: RO:0002104 PR:000001950 ! has plasma membrane part tumor necrosis factor ligand superfamily member 5 intersection_of: RO:0015015 PR:000001255 ! has high plasma membrane amount C-C chemokine receptor type 3 intersection_of: RO:0015015 PR:000001865 ! has high plasma membrane amount interleukin-3 receptor class 2 alpha chain intersection_of: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001344 ! has plasma membrane part ectonucleotide pyrophosphatase/phosphodiesterase family member 3 relationship: RO:0002104 PR:000001950 ! has plasma membrane part tumor necrosis factor ligand superfamily member 5 relationship: RO:0015015 PR:000001255 ! has high plasma membrane amount C-C chemokine receptor type 3 relationship: RO:0015015 PR:000001865 ! has high plasma membrane amount interleukin-3 receptor class 2 alpha chain relationship: RO:0015015 PR:000007431 ! has high plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha [Term] id: CL:0000768 name: immature basophil def: "Any of the immature forms of a basophil, in which basophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464] synonym: "immature basophilic leucocyte" EXACT [] synonym: "immature basophilic leukocyte" EXACT [] is_a: CL:0000767 {is_inferred="true"} ! basophil intersection_of: CL:0000767 ! basophil intersection_of: has_part CL:0017509 ! alobate nucleus relationship: develops_from CL:0000830 ! basophilic promyelocyte relationship: has_part CL:0017509 ! alobate nucleus [Term] id: CL:0000769 name: basophilic metamyelocyte def: "A basophil precursor in the granulocytic series, being a cell intermediate in development between a basophilic myelocyte and a band form basophil. The nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare. Markers are CD11b-positive, CD15-positive, CD16-positive, CD24-positive, CD33-positive, and CD13-positive." [GOC:tfm, ISBN:0721601464, PMID:18466030] xref: FMA:84198 is_a: CL:0000768 {is_inferred="true"} ! immature basophil is_a: CL:0002192 ! metamyelocyte intersection_of: CL:0000768 ! immature basophil intersection_of: has_part CL:0017507 ! reniform nucleus intersection_of: has_part GO:0000792 ! heterochromatin intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: has_part GO:0070820 ! tertiary granule intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: develops_from CL:0000614 ! basophilic myelocyte relationship: has_part CL:0017507 ! reniform nucleus relationship: has_part GO:0000792 ! heterochromatin relationship: has_part GO:0042582 ! azurophil granule relationship: has_part GO:0070820 ! tertiary granule relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000770 name: band form basophil def: "A late basophilic metamyelocyte in which the nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature basophil." [GOC:add, http://www.cap.org, ISBN:0721601464, PMID:18466030] is_a: CL:0000768 {is_inferred="true"} ! immature basophil intersection_of: CL:0000768 ! immature basophil intersection_of: has_part CL:0017506 ! banded nucleus relationship: develops_from CL:0000769 ! basophilic metamyelocyte relationship: has_part CL:0017506 ! banded nucleus [Term] id: CL:0000771 name: eosinophil def: "Any of the immature or mature forms of a granular leukocyte with a nucleus that usually has two lobes connected by one or more slender threads of chromatin, and cytoplasm containing coarse, round granules that are uniform in size and which can be stained by the dye eosin. Eosinophils are CD9-positive, CD191-positive, and CD193-positive." [GOC:add, GOC:amm, GOC:dsd, GOC:tfm, ISBN:0721601464, PMCID:PMC2626675, PMID:10914487, PMID:1662676] comment: Eosinophils are also CD14-negative, CD32-positive, CD44-positive, CD48-positive, CD69-positive, CD192-negative, MBP1-positive, MBP2-positive, TLR2-negative, TLR4-negative, and lineage-negative (B220, CD2, CD14, CD19, CD56, CD71, CD117, CD123, CD235a (glycophorin A), and TER119). The cytokines IL-3, IL-5, and GM-CSF are involved in their development and differentiation. Usually considered CD16-negative, CD16 is observed on eosinophilic metamyelocyte. subset: human_reference_atlas synonym: "eosinocyte" EXACT [] synonym: "eosinophilic granulocyte" EXACT [] synonym: "eosinophilic leucocyte" EXACT [] synonym: "eosinophilic leukocyte" EXACT [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] xref: BTO:0000399 xref: CALOHA:TS-0279 xref: FMA:62861 xref: MESH:D004804 is_a: CL:0000094 {is_inferred="true"} ! granulocyte intersection_of: CL:0000094 ! granulocyte intersection_of: RO:0002104 PR:000001254 ! has plasma membrane part C-C chemokine receptor type 1 intersection_of: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3 intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule intersection_of: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001254 ! has plasma membrane part C-C chemokine receptor type 1 relationship: RO:0002104 PR:000001255 ! has plasma membrane part C-C chemokine receptor type 3 relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule [Term] id: CL:0000772 name: immature eosinophil def: "Any of the immature forms of an eosinophil, in which eosinophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464] synonym: "immature eosinocyte" EXACT [] synonym: "immature eosinophilic leucocyte" EXACT [] synonym: "immature eosinophilic leukocyte" EXACT [] is_a: CL:0000771 {is_inferred="true"} ! eosinophil intersection_of: CL:0000771 ! eosinophil intersection_of: has_part CL:0017509 ! alobate nucleus relationship: develops_from CL:0000833 ! eosinophilic promyelocyte relationship: has_part CL:0017509 ! alobate nucleus [Term] id: CL:0000773 name: eosinophilic metamyelocyte def: "A eosinophil precursor in the granulocytic series, being a cell intermediate in development between a eosinophilic myelocyte and a band form eosinophil. The nucleus becomes indented where the indentation is smaller than half the distance to the farthest nuclear margin; chromatin becomes coarse and clumped; specific granules predominate while primary granules are rare. Markers are integrin alpha-M-positive, fucosyltransferase FUT4-positive, low affinity immunoglobulin gamma Fc region receptor III-positive, CD33-positive, CD24-positive and aminopeptidase N-negative." [GOC:add, GOC:tfm, ISBN:0721601464, PMID:19622087] is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil is_a: CL:0002192 ! metamyelocyte intersection_of: CL:0000772 ! immature eosinophil intersection_of: has_part CL:0017502 ! acidophilic cytoplasm intersection_of: has_part CL:0017507 ! reniform nucleus intersection_of: has_part GO:0000792 ! heterochromatin intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: has_part GO:0070820 ! tertiary granule intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule intersection_of: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 intersection_of: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N relationship: develops_from CL:0000612 ! eosinophilic myelocyte relationship: has_part CL:0017502 ! acidophilic cytoplasm relationship: has_part CL:0017507 ! reniform nucleus relationship: has_part GO:0000792 ! heterochromatin relationship: has_part GO:0042582 ! azurophil granule relationship: has_part GO:0070820 ! tertiary granule relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: RO:0002104 PR:000001932 ! has plasma membrane part signal transducer CD24 relationship: RO:0002104 PR:000002031 ! has plasma membrane part aminopeptidase N [Term] id: CL:0000774 name: band form eosinophil def: "A late eosinophilic metamyelocyte in which the nucleus is in the form of a curved or coiled band, not having acquired the typical multilobar shape of the mature eosinophil." [GOC:add, GOC:tfm, http://www.cap.org, ISBN:0721601464, PMID:19622087] is_a: CL:0000772 {is_inferred="true"} ! immature eosinophil intersection_of: CL:0000772 ! immature eosinophil intersection_of: has_part CL:0017506 ! banded nucleus relationship: develops_from CL:0000773 ! eosinophilic metamyelocyte relationship: has_part CL:0017506 ! banded nucleus [Term] id: CL:0000775 name: neutrophil def: "Any of the immature or mature forms of a granular leukocyte that in its mature form has a nucleus with three to five lobes connected by slender threads of chromatin, and cytoplasm containing fine inconspicuous granules and stainable by neutral dyes." [GOC:add, GOC:amm, GOC:tfm, ISBN:0721601464] subset: human_reference_atlas synonym: "neutrocyte" EXACT [] synonym: "neutrophil leucocyte" EXACT [] synonym: "neutrophil leukocyte" EXACT [] synonym: "neutrophilic leucocyte" EXACT [] synonym: "neutrophilic leukocyte" EXACT [] synonym: "PMN" BROAD [] synonym: "poly" BROAD [] synonym: "polymorphonuclear leucocyte" BROAD [] synonym: "polymorphonuclear leukocyte" BROAD [] synonym: "polymorphonuclear neutrophil" BROAD [] synonym: "polynuclear neutrophilic leucocyte" BROAD [] synonym: "polynuclear neutrophilic leukocyte" BROAD [] xref: BTO:0000130 xref: CALOHA:TS-0688 xref: FMA:62860 xref: MESH:D009504 is_a: CL:0000094 {is_inferred="true"} ! granulocyte intersection_of: CL:0000094 ! granulocyte intersection_of: RO:0002104 PR:000001479 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor II intersection_of: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001479 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor II relationship: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin [Term] id: CL:0000776 name: immature neutrophil def: "Any of the immature forms of a neutrophil in which neutrophilic specific granules are present but other phenotypic features of the mature form may be lacking." [GOC:add, ISBN:0721601464] synonym: "immatuer neutrophilic leukocyte" EXACT [] synonym: "immature neutrocyte" EXACT [] synonym: "immature neutrophil leucocyte" EXACT [] synonym: "immature neutrophil leukocyte" EXACT [] synonym: "immature neutrophilic leucocyte" EXACT [] is_a: CL:0000775 {is_inferred="true"} ! neutrophil intersection_of: CL:0000775 ! neutrophil intersection_of: has_part CL:0017509 ! alobate nucleus relationship: develops_from CL:0000564 ! neutrophilic promyelocyte relationship: has_part CL:0017509 ! alobate nucleus [Term] id: CL:0000777 name: mesangial phagocyte def: "A tissue-resident macrophage of the renal glomerular mesangium involved in the disposal and degradation of filtration residues, presentation of antigen to T cells and in tissue remodeling." [GOC:add, GOC:tfm, ISBN:0702022918, ISBN:3540536663, PMID:1600140, PMID:16146841] synonym: "mesangial cell" BROAD [] is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: capable_of GO:0019882 ! antigen processing and presentation intersection_of: capable_of GO:0048771 ! tissue remodeling intersection_of: located_in UBERON:0002320 ! glomerular mesangium relationship: capable_of GO:0048771 ! tissue remodeling relationship: located_in UBERON:0002320 ! glomerular mesangium [Term] id: CL:0000778 name: mononuclear osteoclast def: "A specialized mononuclear osteoclast associated with the absorption and removal of bone, precursor of multinuclear osteoclasts." [GOC:add, GOC:tfm, PMID:12713016, PMID:15055519, PMID:17380158, PMID:9415452] comment: Morphology: mononuclear, highly vesicular. subset: human_reference_atlas is_a: CL:0000092 {is_inferred="true"} ! osteoclast is_a: CL:0000842 ! mononuclear cell intersection_of: CL:0000092 ! osteoclast intersection_of: bearer_of PATO:0001407 ! mononucleate relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000779 name: multinuclear osteoclast def: "A specialized multinuclear osteoclast associated with the absorption and removal of bone." [GOC:add, PMID:12713016, PMID:9415452] comment: Morphology: multinucleated, highly vesicular. subset: human_reference_atlas synonym: "multinucleated osteoclast" EXACT [] is_a: CL:0000092 {is_inferred="true"} ! osteoclast is_a: CL:0000228 ! multinucleate cell intersection_of: CL:0000092 ! osteoclast intersection_of: bearer_of PATO:0001908 ! multinucleate relationship: develops_from CL:0000778 ! mononuclear osteoclast relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000780 name: multinuclear odontoclast def: "A specialized multinuclear osteoclast associated with the absorption and removal of cementum." [GOC:add, PMID:9415452] comment: Morphology: multinucleated, highly vesicular; location: roots of deciduous (milk) teeth. synonym: "multinucleated odontoclast" EXACT [] is_a: CL:0000588 {is_inferred="true"} ! odontoclast is_a: CL:0000779 ! multinuclear osteoclast intersection_of: CL:0000588 ! odontoclast intersection_of: bearer_of PATO:0001908 ! multinucleate relationship: develops_from CL:0000781 ! mononuclear odontoclast [Term] id: CL:0000781 name: mononuclear odontoclast def: "A specialized mononuclear osteoclast associated with the absorption and removal of cementum." [GOC:add, PMID:9415452] comment: Morphology: Mononuclear, highly vesicular; location: roots of deciduous (milk) teeth. is_a: CL:0000588 {is_inferred="true"} ! odontoclast is_a: CL:0000778 {is_inferred="true"} ! mononuclear osteoclast intersection_of: CL:0000588 ! odontoclast intersection_of: bearer_of PATO:0001407 ! mononucleate [Term] id: CL:0000782 name: myeloid dendritic cell def: "A dendritic cell of the myeloid lineage." [GOC:add, PMID:10449155, PMID:17332250, PMID:9521319] comment: These cells are CD1a-negative, CD1b-positive, CD11a-positive, CD11c-positive, CD13-positive, CD14-negative, CD20-negative, CD21-negative, CD33-positive, CD40-negative, CD50-positive, CD54-positive, CD58-positive, CD68-negative, CD80-negative, CD83-negative, CD85j-positive, CD86-positive, CD89-negative, CD95-positive, CD120a-negative, CD120b-positive, CD123-negative, CD178-negative, CD206-negative, CD207-negative, CD209-negative, and TNF-alpha-negative. Upon TLR stimulation, they are capable of producing high levels of TNF-alpha, IL-6, CXCL8 (IL-8). synonym: "CD11c+CD123- DC" EXACT [] synonym: "interdigitating cell" BROAD [] synonym: "mDC" EXACT [] synonym: "veiled cell" BROAD [] xref: BTO:0004721 is_a: CL:0000766 ! myeloid leukocyte is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell intersection_of: CL:0000990 ! conventional dendritic cell intersection_of: develops_from CL:0000763 ! myeloid cell intersection_of: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain relationship: develops_from CL:0000763 ! myeloid cell relationship: lacks_plasma_membrane_part PR:000001865 ! interleukin-3 receptor class 2 alpha chain [Term] id: CL:0000783 name: multinucleated phagocyte def: "A phagocyte formed by the fusion of mononuclear phagocytes." [GOC:add, GOC:tfm] is_a: CL:0000228 ! multinucleate cell is_a: CL:0000518 {is_inferred="true"} ! phagocyte (sensu Vertebrata) intersection_of: CL:0000518 ! phagocyte (sensu Vertebrata) intersection_of: bearer_of PATO:0001908 ! multinucleate [Term] id: CL:0000784 name: plasmacytoid dendritic cell def: "A dendritic cell type of distinct morphology, localization, and surface marker expression (CD123-positive) from other dendritic cell types and associated with early stage immune responses, particularly the release of physiologically abundant amounts of type I interferons in response to infection." [GOC:add, GOC:dsd, PMCID:PMC2118448, PMCID:PMC538703, PMID:15549123, PMID:17332250, PMID:17850486, PMID:20304825] subset: human_reference_atlas synonym: "DC2" EXACT [] synonym: "interferon-producing cell" EXACT [] synonym: "IPC" EXACT [] synonym: "lymphoid dendritic cell" EXACT [] synonym: "pDC" EXACT [] synonym: "plasmacytoid monocyte" EXACT [] synonym: "plasmacytoid T cell" EXACT [] synonym: "T-associated plasma cell" EXACT [] synonym: "type 2 DC" EXACT [] xref: BTO:0004625 is_a: CL:0000451 {is_inferred="true"} ! dendritic cell intersection_of: CL:0000451 ! dendritic cell intersection_of: capable_of GO:0032606 ! type I interferon production relationship: capable_of GO:0032606 ! type I interferon production relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000785 name: mature B cell def: "A B cell that is mature, having left the bone marrow. Initially, these cells are IgM-positive and IgD-positive, and they can be activated by antigen." [GOC:add, GOC:dsd, ISBN:0781735149] comment: Mature B cells are also reportedly CD10-negative, CD19-positive, CD22-positive, CD34-negative, CD48-positive, CD79a-positive, CD84-positive, CD127-negative, CD352-positive, RAG-negative, TdT-negative, Vpre-B-negative, and pre-BCR-negative. Transcription factors expressed: Pax5-positive. synonym: "mature B lymphocyte" EXACT [] synonym: "mature B-cell" EXACT [] synonym: "mature B-lymphocyte" EXACT [] is_a: CL:0000145 ! professional antigen presenting cell is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive intersection_of: CL:0001201 ! B cell, CD19-positive intersection_of: capable_of GO:0002504 ! antigen processing and presentation of peptide or polysaccharide antigen via MHC class II intersection_of: capable_of GO:0042113 ! B cell activation intersection_of: has_completed GO:0002335 ! mature B cell differentiation disjoint_from: CL:0000816 ! immature B cell disjoint_from: CL:0000817 ! precursor B cell disjoint_from: CL:0000818 ! transitional stage B cell relationship: capable_of GO:0042113 ! B cell activation relationship: develops_from CL:0000818 ! transitional stage B cell relationship: has_completed GO:0002335 ! mature B cell differentiation [Term] id: CL:0000786 name: plasma cell def: "A terminally differentiated, post-mitotic, antibody secreting cell of the B cell lineage with the phenotype CD138-positive, surface immunonoglobulin-negative, and MHC Class II-negative. Plasma cells are oval or round with extensive rough endoplasmic reticulum, a well-developed Golgi apparatus, and a round nucleus having a characteristic cartwheel heterochromatin pattern and are devoted to producing large amounts of immunoglobulin." [GO_REF:0000031, GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Plasma_cell, ISBN:0721601464, ISBN:0781735149, PMID:19447676, PMID:20081059, PMID:20839338, PMID:20951740] comment: Plasma cells develop in the spleen and migrate to the bone marrow. Plasma cells are also reportedly CD5-negative, CD10-negative, CD19-positive, CD20-negative, CD21-negative, CD22-negative, CD23-negative, CD24-negative, CD25-negative, CD27-positive, CD34-negative, CD38-positive, CD40-positive, CD43-positive, CD45-positive, CD48-positive, CD53-low, CD80-negative, CD81-positive, CD86-positive, CD95-positive, CD196-negative, CD229-positive, CD270-positive, CD352-positive, CD361-positive, and IgD-negative. Transcription factors: BLIMP1-positive, IRF4-positive, PAX5-negative, SpiB-negative, Ets1-negative, and XBP1-positive. subset: human_reference_atlas synonym: "effector B cell" RELATED [] synonym: "effector B-cell" RELATED [] synonym: "plasma B cell" EXACT [] synonym: "plasma B-cell" EXACT [] synonym: "plasmacyte" EXACT [] synonym: "plasmocyte" EXACT [] xref: BTO:0000392 xref: FMA:70574 xref: MESH:D010950 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000946 {is_inferred="true"} ! antibody secreting cell intersection_of: CL:0000946 ! antibody secreting cell intersection_of: has_part CL:0017508 ! cartwheel heterochromatin intersection_of: has_part GO:0005794 ! Golgi apparatus intersection_of: lacks_plasma_membrane_part GO:0019814 ! immunoglobulin complex intersection_of: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0002104 PR:000001935 ! has plasma membrane part syndecan-1 relationship: develops_from CL:0000980 ! plasmablast relationship: has_part CL:0017508 ! cartwheel heterochromatin relationship: has_part GO:0005794 ! Golgi apparatus relationship: lacks_plasma_membrane_part GO:0019814 ! immunoglobulin complex relationship: lacks_plasma_membrane_part GO:0042613 ! MHC class II protein complex relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001935 ! has plasma membrane part syndecan-1 [Term] id: CL:0000787 name: memory B cell def: "A memory B cell is a mature B cell that is long-lived, readily activated upon re-encounter of its antigenic determinant, and has been selected for expression of higher affinity immunoglobulin. This cell type has the phenotype CD19-positive, CD20-positive, MHC Class II-positive, and CD138-negative." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, http://en.wikipedia.org/wiki/Memory_B_cell, ISBN:0781735149, PMID:20081059, PMID:20839338] comment: Memory B-cells are also reportedly CD5-negative, CD10-negative, CD21-positive, CD22-positive, CD23-negative, CD24-positive, CD25-positive, CD27-positive, CD34-negative, CD38-negative, CD40-positive, CD43-negative, CD44-positive, CD45-positive, CD53-positive, CD80-negative, CD81-negative, CD86-positive, and CD196/CCR6-positive. subset: human_reference_atlas synonym: "memory B lymphocyte" EXACT [] synonym: "memory B-cell" EXACT [] synonym: "memory B-lymphocyte" EXACT [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell intersection_of: CL:0000785 ! mature B cell intersection_of: has_completed GO:0002344 ! B cell affinity maturation intersection_of: lacks_plasma_membrane_part PR:000001935 ! syndecan-1 intersection_of: RO:0002104 GO:0042613 ! has plasma membrane part MHC class II protein complex intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: has_completed GO:0002344 ! B cell affinity maturation relationship: lacks_plasma_membrane_part PR:000001935 ! syndecan-1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0042613 ! has plasma membrane part MHC class II protein complex relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 [Term] id: CL:0000788 name: naive B cell def: "A naive B cell is a mature B cell that has the phenotype surface IgD-positive, surface IgM-positive, CD20-positive, CD27-negative and that has not yet been activated by antigen in the periphery." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, ISBN:0781765196, PMID:19447676, PMID:20081059, PMID:20839338, PMID:20933013, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'naive B cell'. Per DSD: Naive B cells are also reportedly CD10-negative, CD19-positive, CD20-positive, CD21-positive, CD22-positive, CD25-negative, CD27-negative, CD34-negative, CD40-positive, CD43-negative, CD45-positive, CD48-positive, CD53-positive, CD80-negative, CD81-positive, CD84-positive, CD86-negative, CD95-negative, CD138-negative, CD150-positive, CD184/CXCR4-positive, CD185/CXCR5-positive, CD196/CCR6-positive, CD200-positive, CD229-positive, CD243-positive, CD289-positive, CD290-positive, CD352-positive, MHCII/HLA-DR-positive, cadherin 9-positive, and sIgH-positive, Transcription factors: Pax5-positive, ETS1-positive, FOXO1A-positive, KLF4-positive, KLF9-positive, MiTF-positive, OBF1-positive, PLZF-positive, and SpiB-positive. subset: human_reference_atlas synonym: "naive B lymphocyte" EXACT [] synonym: "naive B-cell" EXACT [] synonym: "naive B-lymphocyte" EXACT [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell intersection_of: CL:0000785 ! mature B cell intersection_of: has_not_completed GO:0002344 ! B cell affinity maturation intersection_of: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: has_not_completed GO:0002344 ! B cell affinity maturation relationship: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 [Term] id: CL:0000789 name: alpha-beta T cell def: "A T cell that expresses an alpha-beta T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "alpha-beta T lymphocyte" EXACT [] synonym: "alpha-beta T-cell" EXACT [] synonym: "alpha-beta T-lymphocyte" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000084 {is_inferred="true"} ! T cell intersection_of: CL:0000084 ! T cell intersection_of: RO:0002104 GO:0042105 ! has plasma membrane part alpha-beta T cell receptor complex disjoint_from: CL:0000798 ! gamma-delta T cell relationship: RO:0002104 GO:0042105 ! has plasma membrane part alpha-beta T cell receptor complex [Term] id: CL:0000790 name: immature alpha-beta T cell def: "An alpha-beta T cell that has an immature phenotype and has not completed T cell selection." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "immature alpha-beta T lymphocyte" EXACT [] synonym: "immature alpha-beta T-cell" EXACT [] synonym: "immature alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000789 {is_inferred="true"} ! alpha-beta T cell is_a: CL:0002420 ! immature T cell intersection_of: CL:0000789 ! alpha-beta T cell intersection_of: has_not_completed GO:0045058 ! T cell selection [Term] id: CL:0000791 name: mature alpha-beta T cell def: "A alpha-beta T cell that has a mature phenotype." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "mature alpha-beta T lymphocyte" EXACT [] synonym: "mature alpha-beta T-cell" EXACT [] synonym: "mature alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000789 {is_inferred="true"} ! alpha-beta T cell is_a: CL:0002419 ! mature T cell intersection_of: CL:0000789 ! alpha-beta T cell intersection_of: has_completed GO:0045058 ! T cell selection relationship: develops_from CL:0000790 ! immature alpha-beta T cell [Term] id: CL:0000792 name: CD4-positive, CD25-positive, alpha-beta regulatory T cell def: "A CD4-positive, CD25-positive, alpha-beta T cell that regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GOC:add, GOC:tfm, ISBN:0781735149, PMID:19464985, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'Treg'. The inclusion of CD127lo in the logical definition is compatible with both human and mouse T cells of this subtype. synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T lymphocyte" EXACT [] synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T-cell" EXACT [] synonym: "CD4-positive, CD25-positive, alpha-beta regulatory T-lymphocyte" EXACT [] synonym: "suppressor T cell" BROAD [] synonym: "suppressor T lymphocyte" BROAD [] synonym: "suppressor T-cell" BROAD [] synonym: "suppressor T-lymphocyte" BROAD [] synonym: "Treg" BROAD [PMID:22343568] is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell is_a: CL:0000815 ! regulatory T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: capable_of GO:0050777 ! negative regulation of immune response intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha intersection_of: RO:0015016 PR:000001869 ! has low plasma membrane amount interleukin-7 receptor subunit alpha relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: RO:0015016 PR:000001869 ! has low plasma membrane amount interleukin-7 receptor subunit alpha [Term] id: CL:0000793 name: CD4-positive, alpha-beta intraepithelial T cell def: "A CD4-positive, alpha-beta T cell that is found in the columnar epithelium of the gastrointestinal tract." [GOC:add, GOC:tfm, ISBN:0781735149] subset: human_reference_atlas synonym: "CD4-positive, alpha-beta intraepithelial T lymphocyte" EXACT [] synonym: "CD4-positive, alpha-beta intraepithelial T-cell" EXACT [] synonym: "CD4-positive, alpha-beta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell is_a: CL:0000797 ! alpha-beta intraepithelial T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: capable_of GO:0002385 ! mucosal immune response intersection_of: located_in UBERON:0001277 ! intestinal epithelium relationship: develops_from CL:0000810 ! CD4-positive, alpha-beta thymocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000794 name: CD8-positive, alpha-beta cytotoxic T cell def: "A CD8-positive, alpha-beta T cell that is capable of killing target cells in an antigen specific manner with the phenotype perforin-positive and granzyme B-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149] comment: Note that while T cells of this subset are loosely referred to 'cytotoxic T cells,' as many other T cell types, including CD4-positive, alpha-beta T cells and gamma-delta T cells exhibit cytotoxicity in vitro and in vivo. subset: human_reference_atlas synonym: "CD8-positive, alpha-beta cytotoxic T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta cytotoxic T-cell" EXACT [] synonym: "CD8-positive, alpha-beta cytotoxic T-lymphocyte" EXACT [] synonym: "cytotoxic T cell" BROAD [] synonym: "cytotoxic T lymphocyte" BROAD [] synonym: "cytotoxic T-cell" BROAD [] synonym: "cytotoxic T-lymphocyte" BROAD [] synonym: "killer T cell" BROAD [] synonym: "killer T lymphocyte" BROAD [] synonym: "killer T-cell" BROAD [] synonym: "killer T-lymphocyte" BROAD [] xref: CALOHA:TS-0190 xref: FMA:70573 is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: capable_of GO:0001913 ! T cell mediated cytotoxicity intersection_of: capable_of GO:0033380 ! granzyme B localization to T cell secretory granule intersection_of: has_completed GO:0030217 ! T cell differentiation intersection_of: has_part PR:000003466 ! perforin-1 intersection_of: has_part PR:000003499 ! granzyme B relationship: capable_of GO:0001913 ! T cell mediated cytotoxicity relationship: capable_of GO:0033380 ! granzyme B localization to T cell secretory granule relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell relationship: has_completed GO:0030217 ! T cell differentiation relationship: has_part PR:000003466 ! perforin-1 relationship: has_part PR:000003499 ! granzyme B relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000795 name: CD8-positive, alpha-beta regulatory T cell def: "A CD8-positive, alpha-beta T cell that regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "CD8+ regulatory T cell" EXACT [] synonym: "CD8+ T(reg)" EXACT [] synonym: "CD8+ Treg" EXACT [] synonym: "CD8-positive T(reg)" EXACT [] synonym: "CD8-positive Treg" EXACT [] synonym: "CD8-positive, alpha-beta regulatory T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta regulatory T-cell" EXACT [] synonym: "CD8-positive, alpha-beta regulatory T-lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta Treg" EXACT [] synonym: "suppressor T cell" BROAD [] synonym: "suppressor T lymphocyte" BROAD [] synonym: "suppressor T-cell" BROAD [] synonym: "suppressor T-lymphocyte" BROAD [] is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell is_a: CL:0000815 ! regulatory T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: capable_of GO:0050777 ! negative regulation of immune response [Term] id: CL:0000796 name: CD8-alpha-beta-positive, alpha-beta intraepithelial T cell def: "A alpha-beta intraepithelial T cell found in the columnar epithelium of the gastrointestinal tract. Intraepithelial T cells often have distinct developmental pathways and activation requirements." [GOC:add, ISBN:0781735149] subset: human_reference_atlas synonym: "CD8-positive, alpha-beta intraepithelial T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta intraepithelial T-cell" EXACT [] synonym: "CD8-positive, alpha-beta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000797 {is_inferred="true"} ! alpha-beta intraepithelial T cell intersection_of: CL:0000797 ! alpha-beta intraepithelial T cell intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 [Term] id: CL:0000797 name: alpha-beta intraepithelial T cell def: "A mature alpha-beta T cell of the columnar epithelium of the gastrointestinal tract. Intraepithelial T cells often have distinct developmental pathways and activation requirements." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "alpha-beta intraepithelial T lymphocyte" EXACT [] synonym: "alpha-beta intraepithelial T-cell" EXACT [] synonym: "alpha-beta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell is_a: CL:0002496 ! intraepithelial lymphocyte intersection_of: CL:0000791 ! mature alpha-beta T cell intersection_of: capable_of GO:0002385 ! mucosal immune response intersection_of: located_in UBERON:0001277 ! intestinal epithelium [Term] id: CL:0000798 name: gamma-delta T cell def: "A T cell that expresses a gamma-delta T cell receptor complex." [GOC:add, GOC:tfm, ISBN:0781735149] comment: Note that gamma-delta T cells have both thymic and extrathymic differentiation pathways. subset: human_reference_atlas synonym: "gamma-delta T lymphocyte" EXACT [] synonym: "gamma-delta T-cell" EXACT [] synonym: "gamma-delta T-lymphocyte" EXACT [] synonym: "gammadelta T cell" EXACT [] synonym: "gd T cell" RELATED [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000084 {is_inferred="true"} ! T cell intersection_of: CL:0000084 ! T cell intersection_of: RO:0002104 GO:0042106 ! has plasma membrane part gamma-delta T cell receptor complex relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0042106 ! has plasma membrane part gamma-delta T cell receptor complex [Term] id: CL:0000799 name: immature gamma-delta T cell def: "A gamma-delta T cell that has an immature phenotype." [GOC:add, ISBN:0781735149] comment: Note that gamma-delta T cells have both thymic and extrathymic differentiation pathways. synonym: "immature gamma-delta T lymphocyte" EXACT [] synonym: "immature gamma-delta T-cell" EXACT [] synonym: "immature gamma-delta T-lymphocyte" EXACT [] is_a: CL:0000798 {is_inferred="true"} ! gamma-delta T cell is_a: CL:0002420 ! immature T cell intersection_of: CL:0000798 ! gamma-delta T cell intersection_of: has_not_completed GO:0042492 ! gamma-delta T cell differentiation intersection_of: has_not_completed GO:0045058 ! T cell selection relationship: develops_from CL:0000807 ! DN3 thymocyte relationship: has_not_completed GO:0042492 ! gamma-delta T cell differentiation [Term] id: CL:0000800 name: mature gamma-delta T cell def: "A gamma-delta T cell that has a mature phenotype. These cells can be found in tissues and circulation where they express unique TCR repertoire depending on their location." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "mature gamma-delta T lymphocyte" EXACT [] synonym: "mature gamma-delta T-cell" EXACT [] synonym: "mature gamma-delta T-lymphocyte" EXACT [] is_a: CL:0000798 {is_inferred="true"} ! gamma-delta T cell is_a: CL:0002419 ! mature T cell intersection_of: CL:0000798 ! gamma-delta T cell intersection_of: has_completed GO:0045058 ! T cell selection relationship: develops_from CL:0000799 ! immature gamma-delta T cell [Term] id: CL:0000801 name: gamma-delta intraepithelial T cell def: "A mature gamma-delta T cell that is found in the columnar epithelium of the gastrointestinal tract. These cells participate in mucosal immune responses." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "gamma-delta intraepithelial T lymphocyte" EXACT [] synonym: "gamma-delta intraepithelial T-cell" EXACT [] synonym: "gamma-delta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000800 {is_inferred="true"} ! mature gamma-delta T cell is_a: CL:0002496 ! intraepithelial lymphocyte intersection_of: CL:0000800 ! mature gamma-delta T cell intersection_of: capable_of GO:0002385 ! mucosal immune response intersection_of: located_in UBERON:0001277 ! intestinal epithelium [Term] id: CL:0000802 name: CD8-alpha alpha positive, gamma-delta intraepithelial T cell def: "A gamma-delta intraepithelial T cell that has the phenotype CD8-alpha alpha-positive." [GOC:add, GOC:tfm, ISBN:0781735149] subset: human_reference_atlas synonym: "CD8-positive, gamma-delta intraepithelial T lymphocyte" EXACT [] synonym: "CD8-positive, gamma-delta intraepithelial T-cell" EXACT [] synonym: "CD8-positive, gamma-delta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000801 {is_inferred="true"} ! gamma-delta intraepithelial T cell intersection_of: CL:0000801 ! gamma-delta intraepithelial T cell intersection_of: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain [Term] id: CL:0000803 name: CD4-negative CD8-negative gamma-delta intraepithelial T cell def: "A gamma-delta intraepithelial T cell that has the phenotype CD4-negative and CD8-negative." [GOC:add, GOC:tfm, ISBN:0781735149] synonym: "CD4-positive, gamma-delta intraepithelial T lymphocyte" EXACT [] synonym: "CD4-positive, gamma-delta intraepithelial T-cell" EXACT [] synonym: "CD4-positive, gamma-delta intraepithelial T-lymphocyte" EXACT [] synonym: "IEL" BROAD [] synonym: "intraepithelial lymphocyte" BROAD [] is_a: CL:0000801 {is_inferred="true"} ! gamma-delta intraepithelial T cell intersection_of: CL:0000801 ! gamma-delta intraepithelial T cell intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain [Term] id: CL:0000805 name: immature single positive thymocyte def: "A thymocyte that has the phenotype CD4-negative, CD8-positive, CD44-negative, CD25-negative, and pre-TCR-positive." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, ISBN:0781735149] comment: Note that this type of thymocyte has passed the beta-selection checkpoint and is rapidly proliferating and rearranging the T cell receptor alpha chain and expressing the CD8 coreceptor. This stage comes between the DN4 and DP stages. synonym: "immature single positive T cell" EXACT [] synonym: "immature single positive T lymphocyte" EXACT [] synonym: "immature single positive T-lymphocyte" EXACT [] synonym: "ISP" EXACT [] synonym: "T.ISP.th" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000893 {is_inferred="true"} ! thymocyte intersection_of: CL:0000893 ! thymocyte intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 intersection_of: RO:0015015 PR:000001932 ! has high plasma membrane amount signal transducer CD24 relationship: develops_from CL:0000808 ! DN4 thymocyte relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 relationship: RO:0015015 PR:000001932 ! has high plasma membrane amount signal transducer CD24 [Term] id: CL:0000806 name: DN2 thymocyte def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-positive, and CD25-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] comment: Note that this type of thymocyte is at the earliest stage of T cell receptor rearrangement of the beta, gamma, and delta T cell receptor chains. Also, there is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'. synonym: "DN2 alpha-beta immature T lymphocyte" EXACT [] synonym: "DN2 alpha-beta immature T-cell" EXACT [] synonym: "DN2 alpha-beta immature T-lymphocyte" EXACT [] synonym: "DN2 cell" EXACT [] synonym: "DN2 immature T cell" EXACT [] synonym: "double negative 2" EXACT [] synonym: "preT.DN2.Th" EXACT [] synonym: "TN2 cell" EXACT [] synonym: "TN2 thymocyte" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0002489 ! double negative thymocyte intersection_of: CL:0000893 ! thymocyte intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8 intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: develops_from CL:0000894 ! DN1 thymic pro-T cell relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000807 name: DN3 thymocyte def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-negative, and CD25-positive and expressing the T cell receptor beta-chain in complex with the pre-T cell receptor alpha chain." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] comment: There is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'. synonym: "DN3 alpha-beta immature T lymphocyte" EXACT [] synonym: "DN3 alpha-beta immature T-cell" EXACT [] synonym: "DN3 alpha-beta immature T-lymphocyte" EXACT [] synonym: "DN3 cell" EXACT [] synonym: "DN3 immature T cell" EXACT [] synonym: "double negative 3" EXACT [] synonym: "early cortical thymocyte" BROAD [] synonym: "preT.DN3.Th" EXACT [] synonym: "TN3 cell" EXACT [] synonym: "TN3 thymocyte" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0002489 ! double negative thymocyte intersection_of: CL:0000893 ! thymocyte intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8 intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: develops_from CL:0000806 ! DN2 thymocyte relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000808 name: DN4 thymocyte def: "A thymocyte that has the phenotype CD4-negative, CD8-negative, CD44-negative, CD25-negative, and pre-TCR-positive." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] comment: Note that this type of thymocyte has passed the beta-selection checkpoint and is rapidly proliferating and beginning to rearrange the T cell receptor alpha chain. There is growing evidence that molecular markers characterizing double negative thymocytes are different across species, especially in mouse versus human thymus. If in doubt, please consider using CL:0002489 'double negative thymocyte'. synonym: "DN4 alpha-beta immature T lymphocyte" EXACT [] synonym: "DN4 alpha-beta immature T-lymphocyte" EXACT [] synonym: "DN4 cell" EXACT [] synonym: "DN4 immature T cell" EXACT [] synonym: "DN4 immature T-cell" EXACT [] synonym: "double negative 4" EXACT [] synonym: "early cortical thymocyte" BROAD [] synonym: "T.DN4.th" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0002489 ! double negative thymocyte intersection_of: CL:0000893 ! thymocyte intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: lacks_plasma_membrane_part PR:000025402 ! T cell receptor co-receptor CD8 intersection_of: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex relationship: develops_from CL:0000807 ! DN3 thymocyte relationship: lacks_plasma_membrane_part PR:000001307 ! CD44 molecule relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: RO:0002104 GO:0043384 ! has plasma membrane part pre-T cell receptor complex [Term] id: CL:0000809 name: double-positive, alpha-beta thymocyte def: "A thymocyte expressing the alpha-beta T cell receptor complex as well as both the CD4 and CD8 coreceptors." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] comment: Thymocytes of this stage are undergoing positive and negative selection. subset: human_reference_atlas synonym: "double-positive, alpha-beta immature T lymphocyte" EXACT [] synonym: "DP cell" EXACT [] synonym: "DP thymocyte" EXACT [] synonym: "late cortical thymocyte" BROAD [] is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell is_a: CL:0000893 ! thymocyte intersection_of: CL:0000790 ! immature alpha-beta T cell intersection_of: part_of UBERON:0002370 ! thymus intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 relationship: develops_from CL:0000805 ! immature single positive thymocyte relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 [Term] id: CL:0000810 name: CD4-positive, alpha-beta thymocyte def: "An immature alpha-beta T cell that is located in the thymus and is CD4-positive and CD8-negative." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] synonym: "CD4-positive, alpha-beta immature T lymphocyte" EXACT [] synonym: "CD4-positive, alpha-beta immature T-cell" EXACT [] synonym: "CD4-positive, alpha-beta immature T-lymphocyte" EXACT [] synonym: "SP CD4 cell" EXACT [] is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell is_a: CL:0000893 ! thymocyte intersection_of: CL:0000790 ! immature alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: part_of UBERON:0002370 ! thymus intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule [Term] id: CL:0000811 name: CD8-positive, alpha-beta thymocyte def: "An immature alpha-beta T cell that is located in the thymus and is CD8-positive and CD4-negative." [GO_REF:0000031, GOC:add, GOC:tfm, ISBN:0781735149] synonym: "CD8-positive, alpha-beta immature T cell" RELATED [] synonym: "CD8-positive, alpha-beta immature T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta immature T-cell" EXACT [] synonym: "CD8-positive, alpha-beta immature T-lymphocyte" EXACT [] synonym: "SP CD8 cell" EXACT [] is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell is_a: CL:0000893 ! thymocyte intersection_of: CL:0000790 ! immature alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: part_of UBERON:0002370 ! thymus intersection_of: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: RO:0002104 PR:000025402 ! has plasma membrane part T cell receptor co-receptor CD8 [Term] id: CL:0000813 name: memory T cell def: "A long-lived, antigen-experienced T cell that has acquired a memory phenotype including distinct surface markers and the ability to differentiate into an effector T cell upon antigen reexposure." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, ISBN:0781735149] synonym: "memory T lymphocyte" EXACT [] synonym: "memory T-cell" EXACT [] synonym: "memory T-lymphocyte" EXACT [] xref: BTO:0003435 is_a: CL:0002419 {is_inferred="true"} ! mature T cell intersection_of: CL:0002419 ! mature T cell intersection_of: bearer_of PATO:0001603 ! increased life span intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response intersection_of: has_completed GO:0043379 ! memory T cell differentiation disjoint_from: CL:0000898 ! naive T cell relationship: bearer_of PATO:0001603 ! increased life span relationship: has_completed GO:0043379 ! memory T cell differentiation [Term] id: CL:0000814 name: mature NK T cell def: "A mature alpha-beta T cell of a distinct lineage that bears natural killer markers and a T cell receptor specific for a limited set of ligands. NK T cells have activation and regulatory roles particularly early in an immune response." [GOC:add, ISBN:0781735149] subset: human_reference_atlas synonym: "mature natural killer T cell" EXACT [] synonym: "mature natural killer T lymphocyte" EXACT [] synonym: "mature natural killer T-cell" EXACT [] synonym: "mature natural killer T-lymphocyte" EXACT [] synonym: "mature NK T lymphocyte" EXACT [] synonym: "mature NK T-cell" EXACT [] synonym: "mature NK T-lymphocyte" EXACT [] synonym: "mature NKT cell" EXACT [] is_a: CL:0000791 {is_inferred="true"} ! mature alpha-beta T cell intersection_of: CL:0000791 ! mature alpha-beta T cell intersection_of: capable_of GO:0032394 ! MHC class Ib receptor activity intersection_of: capable_of GO:0045087 ! innate immune response intersection_of: has_completed GO:0030217 ! T cell differentiation intersection_of: RO:0002104 PR:000001874 ! has plasma membrane part KLRB1-like protein relationship: capable_of GO:0032394 ! MHC class Ib receptor activity relationship: capable_of GO:0045087 ! innate immune response relationship: develops_from CL:0002042 ! immature NK T cell stage IV relationship: has_completed GO:0030217 ! T cell differentiation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001874 ! has plasma membrane part KLRB1-like protein [Term] id: CL:0000815 name: regulatory T cell def: "A T cell which regulates overall immune responses as well as the responses of other T cell subsets through direct cell-cell contact and cytokine release." [GO_REF:0000031, GOC:add] comment: This cell type may express FoxP3 and CD25 and secretes IL-10 and TGF-beta. subset: human_reference_atlas synonym: "regulatory T lymphocyte" EXACT [] synonym: "regulatory T-cell" EXACT [] synonym: "regulatory T-lymphocyte" EXACT [] synonym: "suppressor T cell" BROAD [] synonym: "suppressor T lymphocyte" BROAD [] synonym: "suppressor T-cell" BROAD [] synonym: "suppressor T-lymphocyte" BROAD [] synonym: "Treg" EXACT [] xref: BTO:0004520 xref: FMA:84070 xref: MESH:D050378 is_a: CL:0002419 {is_inferred="true"} ! mature T cell intersection_of: CL:0002419 ! mature T cell intersection_of: capable_of GO:0050777 ! negative regulation of immune response relationship: capable_of GO:0050777 ! negative regulation of immune response relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000816 name: immature B cell def: "An immature B cell is a B cell that has the phenotype surface IgM-positive and surface IgD-negative, and have not undergone class immunoglobulin class switching or peripheral encounter with antigen and activation." [GO_REF:0000031, GOC:add, GOC:dsd, GOC:rhs, GOC:tfm, ISBN:0781735149, PMID:20081059, PMID:20839338] comment: Immature B cells are also reportedly CD5-positive, CD10-positive, CD19-positive, CD20-positive, CD21-positive, CD22-positive, CD24-positive, CD25-negative, CD27-negative, CD34-negative, CD38-positive, CD40-positive, CD43-negative, CD45-positive, CD48-positive, CD53-positive, CD79a-positive, CD80-negative, CD81-positive, CD86-negative, CD95-negative, CD127-negative, CD138-negative, CD185-positive, CD196-positive, MHCII/HLA-DR-positive, RAG-positive, TdT-negative, Vpre-B-negative, and preBCR-negative. Transcription factors expressed: Pax5-positive. subset: human_reference_atlas synonym: "immature B lymphocyte" EXACT [] synonym: "immature B-cell" EXACT [] synonym: "immature B-lymphocyte" EXACT [] synonym: "newly formed B cell" EXACT [ISBN:781735149] is_a: CL:0001201 ! B cell, CD19-positive intersection_of: CL:0001201 ! B cell, CD19-positive intersection_of: has_not_completed GO:0045190 ! isotype switching intersection_of: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: develops_from CL:0000954 ! small pre-B-II cell relationship: has_not_completed GO:0045190 ! isotype switching relationship: lacks_plasma_membrane_part GO:0071738 ! IgD immunoglobulin complex relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 [Term] id: CL:0000817 name: precursor B cell def: "A precursor B cell is a B cell with the phenotype CD10-positive." [GO_REF:0000031, GOC:rhs, GOC:tfm] subset: human_reference_atlas synonym: "pre-B cell" RELATED [] xref: BTO:0001133 xref: CALOHA:TS-0819 is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive intersection_of: CL:0001201 ! B cell, CD19-positive intersection_of: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex intersection_of: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin disjoint_from: CL:0000826 ! pro-B cell relationship: lacks_plasma_membrane_part GO:0071753 ! IgM immunoglobulin complex relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin [Term] id: CL:0000818 name: transitional stage B cell def: "An immature B cell of an intermediate stage between the pre-B cell stage and the mature naive stage with the phenotype surface IgM-positive and CD19-positive, and are subject to the process of B cell selection. A transitional B cell migrates from the bone marrow into the peripheral circulation, and then to the spleen." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:12810111, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'transitional B cell'. subset: human_reference_atlas synonym: "T1 B cell" NARROW [] synonym: "T2 B cell" NARROW [] synonym: "T3 B cell" NARROW [] synonym: "transitional B cell" EXACT [PMID:22343568] synonym: "transitional stage B lymphocyte" EXACT [] synonym: "transitional stage B-cell" EXACT [] synonym: "transitional stage B-lymphocyte" EXACT [] is_a: CL:0001201 {is_inferred="true"} ! B cell, CD19-positive intersection_of: CL:0001201 ! B cell, CD19-positive intersection_of: has_not_completed GO:0002335 ! mature B cell differentiation intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0015015 PR:000001408 ! has high plasma membrane amount ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 intersection_of: RO:0015015 PR:000001932 ! has high plasma membrane amount signal transducer CD24 relationship: develops_from CL:0000816 ! immature B cell relationship: has_not_completed GO:0002335 ! mature B cell differentiation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: RO:0015015 PR:000001408 ! has high plasma membrane amount ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 relationship: RO:0015015 PR:000001932 ! has high plasma membrane amount signal transducer CD24 [Term] id: CL:0000819 name: B-1 B cell def: "A B cell of distinct lineage and surface marker expression. B-1 B cells are thought to be the primary source of natural IgM immunoglobulin, that is, IgM produced in large quantities without prior antigenic stimulation and generally reactive against various microorganisms, as well as the source of T-independent IgA immunoglobulin in the mucosal areas. These cells are CD43-positive." [GO_REF:0000031, GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/B-1_cell, PMID:11861604, PMID:20933013, PMID:21220451] comment: There are small numbers of B-1 cells found in the lymph nodes and spleen, while larger numbers can be found in the peritoneal and pleural cavities. B-1 B cells are reportedly CD11b-positive, CD20-positive, CD21-positive, CD27-positive, CD44-positive, CD45RB-positive, CD48-positive, CD70-negative, CD150-positive, CD244-negative, CD352-positive, sIgM-positive, and sIgD-low. synonym: "B-1 B lymphocyte" EXACT [] synonym: "B-1 B-cell" EXACT [] synonym: "B-1 B-lymphocyte" EXACT [] synonym: "B-1 cell" EXACT [] synonym: "B1 B cell" EXACT [] synonym: "B1 B lymphocyte" EXACT [] synonym: "B1 B-cell" EXACT [] synonym: "B1 B-lymphocyte" EXACT [] synonym: "B1 cell" EXACT [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell intersection_of: CL:0000785 ! mature B cell intersection_of: capable_of GO:0045087 ! innate immune response intersection_of: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin intersection_of: RO:0015015 GO:0071753 ! has high plasma membrane amount IgM immunoglobulin complex relationship: capable_of GO:0045087 ! innate immune response relationship: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: RO:0002104 PR:000001879 ! has plasma membrane part leukosialin relationship: RO:0015015 GO:0071753 ! has high plasma membrane amount IgM immunoglobulin complex [Term] id: CL:0000820 name: B-1a B cell def: "A B-1 B cell that has the phenotype CD5-positive." [GOC:add, PMID:11861604] synonym: "B-1a B lymphocyte" EXACT [] synonym: "B-1a B-cell" EXACT [] synonym: "B-1a B-lymphocyte" EXACT [] synonym: "B1a B cell" EXACT [] synonym: "B1a B lymphocyte" EXACT [] synonym: "B1a B-cell" EXACT [] synonym: "B1a B-lymphocyte" EXACT [] synonym: "B1a cell" EXACT [] synonym: "CD5(+) B1 cell" EXACT [] synonym: "CD5+ B1 cell" EXACT [] synonym: "CD5-positive B1 cell" EXACT [] is_a: CL:0000819 {is_inferred="true"} ! B-1 B cell intersection_of: CL:0000819 ! B-1 B cell intersection_of: RO:0002104 PR:000001839 ! has plasma membrane part T-cell surface glycoprotein CD5 relationship: RO:0002104 PR:000001839 ! has plasma membrane part T-cell surface glycoprotein CD5 [Term] id: CL:0000821 name: B-1b B cell def: "A B-1 B cell that has the phenotype CD5-negative, but having other phenotypic attributes of a B-1 B cell." [GOC:add, PMID:11861604] synonym: "B-1b B lymphocyte" EXACT [] synonym: "B-1b B-cell" EXACT [] synonym: "B-1b B-lymphocyte" EXACT [] synonym: "B1b B cell" EXACT [] synonym: "B1b B lymphocyte" EXACT [] synonym: "B1b B-cell" EXACT [] synonym: "B1b B-lymphocyte" EXACT [] synonym: "B1b cell" EXACT [] is_a: CL:0000819 {is_inferred="true"} ! B-1 B cell intersection_of: CL:0000819 ! B-1 B cell intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 [Term] id: CL:0000822 name: B-2 B cell def: "A conventional B cell subject to antigenic stimulation and dependent on T cell help and with a distinct surface marker expression pattern from B-1 B cells. These cells are CD43-negative." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0781735149, PMID:11861604, PMID:20933013] comment: B-2 B cells are reportedly CD48-positive, CD244-negative, and CD352-positive. synonym: "B-0 B cell" RELATED [] synonym: "B-2 B lymphocyte" EXACT [] synonym: "B-2 B-cell" EXACT [] synonym: "B-2 B-lymphocyte" EXACT [] synonym: "B2 B cell" EXACT [] synonym: "B2 B lymphocyte" EXACT [] synonym: "B2 B-cell" EXACT [] synonym: "B2 B-lymphocyte" EXACT [] synonym: "B2 cell" EXACT [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell intersection_of: CL:0000785 ! mature B cell intersection_of: lacks_plasma_membrane_part PR:000001879 ! leukosialin intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001879 ! leukosialin relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 [Term] id: CL:0000823 name: immature natural killer cell def: "A natural killer cell that is developmentally immature and expresses natural killer cell receptors (NKR)." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:12457618] comment: In mouse the NKR are Ly49 molecules and in human these cells express KIR molecules. synonym: "immature NK cell" EXACT [] synonym: "p-NK" RELATED [PMID:12457618] is_a: CL:0000623 ! natural killer cell is_a: CL:0001082 ! immature innate lymphoid cell intersection_of: CL:0000623 ! natural killer cell intersection_of: bearer_of PATO:0001501 ! immature disjoint_from: CL:0000824 ! mature natural killer cell disjoint_from: CL:0000937 ! pre-natural killer cell relationship: develops_from CL:0000937 ! pre-natural killer cell [Term] id: CL:0000824 name: mature natural killer cell def: "A natural killer cell that is developmentally mature and expresses a variety of inhibitory and activating receptors that recognize MHC class I and other stress related molecules." [GO_REF:0000031, GOC:add, ISBN:0781735149, PMID:14685782] subset: human_reference_atlas synonym: "LAK cell" BROAD [PMID:14685782] synonym: "lymphokine activated killer cell" BROAD [PMID:14685782] synonym: "mature NK cell" EXACT [] is_a: CL:0000623 ! natural killer cell relationship: develops_from CL:0000823 ! immature natural killer cell relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000825 name: pro-NK cell def: "A lymphoid progenitor cell that is committed to the natural killer cell lineage, expressing CD122 (IL-15) receptor, but lacking many of the phenotypic characteristics of later stages of natural killer cell development such as expression of NK activating and inhibitory molecules. In human this cell has the phenotype CD34-positive, CD45RA-positive, CD10-positive, CD117-negative, and CD161 negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:11532393, PMID:12457618, PMID:15032583, PMID:15766674] comment: Most markers only described for human pro NK cells. synonym: "natural killer cell progenitor" EXACT [] synonym: "NKP" EXACT [PMID:12457618, PMID:15032583, PMID:15766674] synonym: "null cell" RELATED [PMID:11532393] synonym: "preNK cell" RELATED [PMID:11532393] synonym: "pro-natural killer cell" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell intersection_of: lacks_plasma_membrane_part PR:000001874 ! KLRB1-like protein intersection_of: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta intersection_of: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin relationship: develops_from CL:0000051 ! common lymphoid progenitor relationship: lacks_plasma_membrane_part PR:000001874 ! KLRB1-like protein relationship: lacks_plasma_membrane_part PR:000002065 ! mast/stem cell growth factor receptor relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule relationship: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: RO:0002104 PR:000001381 ! has plasma membrane part interleukin-2 receptor subunit beta relationship: RO:0002104 PR:000001898 ! has plasma membrane part neprilysin [Term] id: CL:0000826 name: pro-B cell def: "A progenitor cell of the B cell lineage, with some lineage specific activity such as early stages of recombination of B cell receptor genes, but not yet fully committed to the B cell lineage until the expression of PAX5 occurs." [GOC:add, GOC:dsd, ISBN:0781735149, PMID:12633665, PMID:16551251, PMID:18432934] comment: Human pro-B cells are reportedly CD10-positive, CD22-positive, CD34-positive, CD38-positive, CD45-low, CD48-positive, CD79a-positive, CD127-positive, CD184-positive, RAG-positive, TdT-positive, Vpre-B-positive, pre-BCR-negative, IgD-negative, and IgM-negative. Transcription factors expressed: Pax5-positive, EBF-positive, E2A-negative, Ikaros-negative, and PU.1-negative. subset: human_reference_atlas synonym: "pre-B cell (Philadelphia nomenclature)" RELATED [PMID:11244048] synonym: "pre-pro B cell" BROAD [PMID:17582343] synonym: "pro-B lymphocyte" EXACT [] synonym: "pro-B-cell" EXACT [] synonym: "pro-B-lymphocyte" EXACT [] synonym: "progenitor B cell" EXACT [] synonym: "progenitor B lymphocyte" EXACT [] synonym: "progenitor B-cell" EXACT [] synonym: "progenitor B-lymphocyte" EXACT [] xref: BTO:0003104 is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell intersection_of: has_part PR:000001903 ! paired box protein PAX-5 intersection_of: has_part PR:000006611 ! DNA nucleotidylexotransferase intersection_of: participates_in GO:0033152 ! immunoglobulin V(D)J recombination relationship: develops_from CL:0000051 ! common lymphoid progenitor relationship: has_part PR:000001903 ! paired box protein PAX-5 relationship: has_part PR:000006611 ! DNA nucleotidylexotransferase relationship: participates_in GO:0033152 ! immunoglobulin V(D)J recombination relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000827 name: pro-T cell def: "A lymphoid progenitor cell of the T cell lineage, with some lineage specific marker expression, but not yet fully committed to the T cell lineage." [GOC:add, ISBN:0781735149] synonym: "DN1 cell" NARROW [] synonym: "DN1 thymocyte" NARROW [] synonym: "pro-T lymphocyte" EXACT [] synonym: "progenitor T cell" EXACT [] synonym: "TN1 cell" NARROW [] is_a: CL:0000838 {is_inferred="true"} ! lymphoid lineage restricted progenitor cell intersection_of: CL:0000838 ! lymphoid lineage restricted progenitor cell intersection_of: capable_of GO:0030217 ! T cell differentiation relationship: capable_of GO:0030217 ! T cell differentiation relationship: develops_from CL:0000051 ! common lymphoid progenitor [Term] id: CL:0000828 name: thromboblast def: "A progenitor cell of the thrombocyte, a nucleated blood cell involved in coagulation typically seen in birds and other non-mammalian vertebrates." [GOC:add, GOC:tfm, PMID:7758949] comment: Note that this is a non-mammalian cell type. is_a: CL:0000226 ! single nucleate cell is_a: CL:0000763 ! myeloid cell is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell intersection_of: bearer_of PATO:0001407 ! mononucleate intersection_of: capable_of GO:0002574 ! thrombocyte differentiation relationship: capable_of GO:0002574 ! thrombocyte differentiation relationship: develops_from CL:0000050 ! megakaryocyte-erythroid progenitor cell [Term] id: CL:0000829 name: basophilic myeloblast def: "A myeloblast committed to the basophil lineage." [GOC:add, ISBN:0721601464] is_a: CL:0000835 {is_inferred="true"} ! myeloblast intersection_of: CL:0000835 ! myeloblast intersection_of: capable_of GO:0030221 ! basophil differentiation relationship: capable_of GO:0030221 ! basophil differentiation relationship: develops_from CL:0000613 ! basophil progenitor cell [Term] id: CL:0000830 name: basophilic promyelocyte def: "A promyelocyte committed to the basophil lineage." [GOC:add, ISBN:0721601464] xref: FMA:84208 is_a: CL:0000836 {is_inferred="true"} ! promyelocyte intersection_of: CL:0000836 ! promyelocyte intersection_of: capable_of GO:0030221 ! basophil differentiation relationship: capable_of GO:0030221 ! basophil differentiation relationship: develops_from CL:0000829 ! basophilic myeloblast [Term] id: CL:0000831 name: mast cell progenitor def: "A progenitor cell of the mast cell lineage. Markers for this cell are FceRIa-low, CD117-positive, CD9-positive, T1/ST2-positive, SCA1-negative, and lineage-negative." [GOC:add, GOC:dsd, http://www.copewithcytokines.de, PMCID:PMC1183570, PMCID:PMC1312421, PMID:8629001, PMID:9354811] comment: MCP are CD16-positive, CD32-positive, CD34-positive, CD45-positive, integrin beta-7-positive, and lin-negative (CD2, CD3e, CD4, CD5, CD8a, CD14, CD19, CD20, CD27, integrin alpha-M, ly6c, ly6g, NCAM-1, and ter119). These cells also express the transcription factors GATA-1, GATA-2, and MITF, but not C/EBPa. synonym: "CFU-Mast" RELATED [] synonym: "CFU-MC" RELATED [] synonym: "colony forming unit mast cell" RELATED [] synonym: "MCP" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0000839 {is_inferred="true"} ! myeloid lineage restricted progenitor cell intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell intersection_of: capable_of GO:0060374 ! mast cell differentiation intersection_of: has_part PR:000007857 ! erythroid transcription factor intersection_of: has_part PR:000007858 ! endothelial transcription factor GATA-2 intersection_of: lacks_part PR:000005307 ! CCAAT/enhancer-binding protein alpha intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002979 ! lymphocyte antigen 6A-2/6E-1 intersection_of: lacks_plasma_membrane_part PR:000002980 ! lymphocyte antigen 6C2 intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) intersection_of: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule intersection_of: RO:0002104 PR:000016401 ! has plasma membrane part transmembrane emp24 domain-containing protein 1 intersection_of: RO:0015015 PR:000009143 ! has high plasma membrane amount integrin beta-7 intersection_of: RO:0015016 PR:000002065 ! has low plasma membrane amount mast/stem cell growth factor receptor intersection_of: RO:0015016 PR:000007431 ! has low plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha relationship: capable_of GO:0060374 ! mast cell differentiation relationship: develops_from CL:0002028 ! basophil mast progenitor cell relationship: has_part PR:000007857 ! erythroid transcription factor relationship: has_part PR:000007858 ! endothelial transcription factor GATA-2 relationship: lacks_part PR:000005307 ! CCAAT/enhancer-binding protein alpha relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000001963 ! CD27 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002979 ! lymphocyte antigen 6A-2/6E-1 relationship: lacks_plasma_membrane_part PR:000002980 ! lymphocyte antigen 6C2 relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: RO:0002104 PR:000005178 ! has plasma membrane part CD9 molecule relationship: RO:0002104 PR:000016401 ! has plasma membrane part transmembrane emp24 domain-containing protein 1 relationship: RO:0015015 PR:000009143 ! has high plasma membrane amount integrin beta-7 relationship: RO:0015016 PR:000002065 ! has low plasma membrane amount mast/stem cell growth factor receptor relationship: RO:0015016 PR:000007431 ! has low plasma membrane amount high affinity immunoglobulin epsilon receptor subunit alpha [Term] id: CL:0000832 name: eosinophilic myeloblast def: "A myeloblast committed to the eosinophil lineage." [GOC:add, ISBN:0721601464] is_a: CL:0000835 {is_inferred="true"} ! myeloblast intersection_of: CL:0000835 ! myeloblast intersection_of: capable_of GO:0030222 ! eosinophil differentiation relationship: capable_of GO:0030222 ! eosinophil differentiation relationship: develops_from CL:0000611 ! eosinophil progenitor cell [Term] id: CL:0000833 name: eosinophilic promyelocyte def: "A promyelocyte committed to the eosinophil lineage." [GOC:add, ISBN:0721601464] xref: FMA:84199 is_a: CL:0000836 {is_inferred="true"} ! promyelocyte intersection_of: CL:0000836 ! promyelocyte intersection_of: capable_of GO:0030222 ! eosinophil differentiation relationship: capable_of GO:0030222 ! eosinophil differentiation relationship: develops_from CL:0000832 ! eosinophilic myeloblast [Term] id: CL:0000834 name: neutrophil progenitor cell def: "A progenitor cell of the neutrophil lineage." [GOC:add, GOC:tfm, ISBN:0721601464] synonym: "neutrophil stem cell" RELATED [] is_a: CL:0000763 ! myeloid cell is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell intersection_of: CL:0002191 ! granulocytopoietic cell intersection_of: capable_of GO:0030223 ! neutrophil differentiation relationship: capable_of GO:0030223 ! neutrophil differentiation relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell [Term] id: CL:0000835 name: myeloblast def: "The most primitive precursor in the granulocytic series, having fine, evenly distributed chromatin, several nucleoli, a high nuclear-to-cytoplasmic ration (5:1-7:1), and a nongranular basophilic cytoplasm. They reside in the bone marrow." [GOC:add, http://en.wikipedia.org/wiki/Myeloblast, http://www.cap.org, ISBN:0721601464] xref: BTO:0000187 xref: FMA:83524 is_a: CL:0000763 ! myeloid cell is_a: CL:0002191 {is_inferred="true"} ! granulocytopoietic cell intersection_of: CL:0002191 ! granulocytopoietic cell intersection_of: has_part CL:0017503 ! basophilic cytoplasm intersection_of: has_part CL:0017505 ! increased nucleus size intersection_of: has_part GO:0000791 ! euchromatin intersection_of: lacks_part GO:0042582 ! azurophil granule relationship: develops_from CL:0000557 ! granulocyte monocyte progenitor cell relationship: has_part CL:0017503 ! basophilic cytoplasm relationship: has_part CL:0017505 ! increased nucleus size relationship: has_part GO:0000791 ! euchromatin relationship: lacks_part GO:0042582 ! azurophil granule [Term] id: CL:0000836 name: promyelocyte def: "A precursor in the granulocytic series, being a cell intermediate in development between a myeloblast and myelocyte, that has distinct nucleoli, a nuclear-to-cytoplasmic ratio of 5:1 to 3:1, and containing a few primary cytoplasmic granules. Markers for this cell are fucosyltransferase FUT4-positive, CD33-positive, integrin alpha-M-negative, low affinity immunoglobulin gamma Fc region receptor III-negative, and CD24-negative." [GOC:add, GOC:amm, GOC:tfm, http://www.cap.org, ISBN:0721601464] subset: human_reference_atlas xref: CALOHA:TS-0825 xref: FMA:83530 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000763 ! myeloid cell is_a: CL:0002191 ! granulocytopoietic cell intersection_of: CL:0000839 ! myeloid lineage restricted progenitor cell intersection_of: has_part CL:0017503 ! basophilic cytoplasm intersection_of: has_part CL:0017505 ! increased nucleus size intersection_of: has_part GO:0005730 ! nucleolus intersection_of: has_part GO:0042582 ! azurophil granule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III intersection_of: lacks_plasma_membrane_part PR:000001932 ! signal transducer CD24 intersection_of: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 intersection_of: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule relationship: develops_from CL:0000835 ! myeloblast relationship: has_part CL:0017503 ! basophilic cytoplasm relationship: has_part CL:0017505 ! increased nucleus size relationship: has_part GO:0005730 ! nucleolus relationship: has_part GO:0042582 ! azurophil granule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001483 ! low affinity immunoglobulin gamma Fc region receptor III relationship: lacks_plasma_membrane_part PR:000001932 ! signal transducer CD24 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001456 ! has plasma membrane part alpha-(1,3)-fucosyltransferase 4 relationship: RO:0002104 PR:000001892 ! has plasma membrane part CD33 molecule [Term] id: CL:0000837 name: hematopoietic multipotent progenitor cell def: "A hematopoietic multipotent progenitor cell is multipotent, but not capable of long-term self-renewal. These cells are characterized as lacking lineage cell surface markers and being CD34-positive in both mice and humans." [GOC:add, GOC:tfm, PMID:19022770] comment: Markers differ between mouse and human. subset: human_reference_atlas synonym: "hemopoietic progenitor cell" EXACT [] synonym: "MPP" EXACT [] xref: BTO:0000725 xref: CALOHA:TS-0448 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0008001 ! hematopoietic precursor cell intersection_of: CL:0000988 ! hematopoietic cell intersection_of: bearer_of PATO:0001402 ! multipotent intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha intersection_of: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule intersection_of: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G intersection_of: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) intersection_of: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule disjoint_from: CL:0002032 ! hematopoietic oligopotent progenitor cell relationship: bearer_of PATO:0001402 ! multipotent relationship: develops_from CL:0000037 ! hematopoietic stem cell relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001024 ! neural cell adhesion molecule 1 relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha relationship: lacks_plasma_membrane_part PR:000001889 ! CD14 molecule relationship: lacks_plasma_membrane_part PR:000002978 ! lymphocyte antigen 6G relationship: lacks_plasma_membrane_part PR:000002981 ! lymphocyte antigen 76 (mouse) relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001003 ! has plasma membrane part CD34 molecule [Term] id: CL:0000838 name: lymphoid lineage restricted progenitor cell def: "A progenitor cell restricted to the lymphoid lineage." [GOC:add, GOC:tfm] comment: Note that this is a class of cell types, not an identified single cell type. synonym: "lymphoid progenitor cell" BROAD [] xref: BTO:0004731 xref: CALOHA:TS-2025 xref: FMA:70338 is_a: CL:0002031 {is_inferred="true"} ! hematopoietic lineage restricted progenitor cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0002031 ! hematopoietic lineage restricted progenitor cell intersection_of: capable_of GO:0030098 ! lymphocyte differentiation disjoint_from: CL:0000839 ! myeloid lineage restricted progenitor cell relationship: capable_of GO:0030098 ! lymphocyte differentiation [Term] id: CL:0000839 name: myeloid lineage restricted progenitor cell def: "A progenitor cell restricted to the myeloid lineage." [GOC:add, GOC:tfm, PMID:19022770] comment: Note that this is a class of cell types, not an identified single cell type. synonym: "myeloid progenitor cell" BROAD [] xref: BTO:0004730 xref: CALOHA:TS-2099 xref: FMA:70339 is_a: CL:0002031 {is_inferred="true"} ! hematopoietic lineage restricted progenitor cell is_a: CL:0011026 ! progenitor cell intersection_of: CL:0002031 ! hematopoietic lineage restricted progenitor cell intersection_of: capable_of GO:0030099 ! myeloid cell differentiation relationship: capable_of GO:0030099 ! myeloid cell differentiation [Term] id: CL:0000840 name: immature conventional dendritic cell def: "An immature cell of the conventional dendritic cell lineage, characterized by high levels of antigen uptake via endocytosis, macropinocytosis, and phagocytosis, and typically found resident in the tissues. Markers for this cell are CD80-low, CD86-low, and MHC-II-low." [GOC:add, GOC:tfm, PMID:9521319] subset: human_reference_atlas synonym: "immature myeloid dendritic cell" NARROW [] is_a: CL:0000766 ! myeloid leukocyte is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell intersection_of: CL:0000990 ! conventional dendritic cell intersection_of: RO:0015016 GO:0042613 ! has low plasma membrane amount MHC class II protein complex intersection_of: RO:0015016 PR:000001412 ! has low plasma membrane amount CD86 molecule intersection_of: RO:0015016 PR:000001438 ! has low plasma membrane amount CD80 molecule relationship: develops_from CL:0001029 ! common dendritic progenitor relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0015016 GO:0042613 ! has low plasma membrane amount MHC class II protein complex relationship: RO:0015016 PR:000001412 ! has low plasma membrane amount CD86 molecule relationship: RO:0015016 PR:000001438 ! has low plasma membrane amount CD80 molecule [Term] id: CL:0000841 name: mature conventional dendritic cell def: "A mature cell of the conventional dendritic cell lineage, characterized by a high capacity for antigen presentation and typically found in a lymph node." [GOC:add, GOC:tfm, PMID:9521319] synonym: "mature dendritic cell" BROAD [GOC:add] synonym: "mature myeloid dendritic cell" NARROW [] xref: FMA:83038 is_a: CL:0000766 ! myeloid leukocyte is_a: CL:0000990 {is_inferred="true"} ! conventional dendritic cell intersection_of: CL:0000990 ! conventional dendritic cell intersection_of: RO:0002104 PR:000001310 ! has plasma membrane part CD83 molecule intersection_of: RO:0015015 GO:0042613 ! has high plasma membrane amount MHC class II protein complex intersection_of: RO:0015015 PR:000001412 ! has high plasma membrane amount CD86 molecule intersection_of: RO:0015015 PR:000001438 ! has high plasma membrane amount CD80 molecule relationship: develops_from CL:0000840 ! immature conventional dendritic cell relationship: RO:0002104 PR:000001310 ! has plasma membrane part CD83 molecule relationship: RO:0015015 GO:0042613 ! has high plasma membrane amount MHC class II protein complex relationship: RO:0015015 PR:000001412 ! has high plasma membrane amount CD86 molecule relationship: RO:0015015 PR:000001438 ! has high plasma membrane amount CD80 molecule [Term] id: CL:0000842 name: mononuclear cell def: "A leukocyte with a single non-segmented nucleus in the mature form." [GOC:add] synonym: "mononuclear leukocyte" EXACT [] synonym: "peripheral blood mononuclear cell" NARROW [] xref: BTO:0000878 xref: CALOHA:TS-0768 xref: FMA:86713 is_a: CL:0000226 ! single nucleate cell is_a: CL:0000738 {is_inferred="true"} ! leukocyte intersection_of: CL:0000738 ! leukocyte intersection_of: bearer_of PATO:0001407 ! mononucleate [Term] id: CL:0000843 name: follicular B cell def: "A resting mature B cell that has the phenotype IgM-positive, IgD-positive, CD23-positive and CD21-positive, and found in the B cell follicles of the white pulp of the spleen or the corticol areas of the peripheral lymph nodes. This cell type is also described as being CD19-positive, B220-positive, AA4-negative, CD43-negative, and CD5-negative." [GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Follicular_B_Cells, ISBN:0781735149, PMCID:PMC2193793, PMID:20933013] comment: Follicular B cells are also reportedly CD48-positive, CD84-positive, CD229-positive, and CD352-positive. synonym: "Fo B cell" EXACT [] synonym: "Fo B-cell" EXACT [] synonym: "follicular B lymphocyte" EXACT [] synonym: "follicular B-cell" EXACT [] synonym: "follicular B-lymphocyte" EXACT [] is_a: CL:0000822 ! B-2 B cell intersection_of: CL:0000785 ! mature B cell intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: lacks_plasma_membrane_part PR:000001879 ! leukosialin intersection_of: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor intersection_of: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex intersection_of: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex intersection_of: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2 relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor relationship: RO:0002104 GO:0071738 ! has plasma membrane part IgD immunoglobulin complex relationship: RO:0002104 GO:0071753 ! has plasma membrane part IgM immunoglobulin complex relationship: RO:0002104 PR:000001014 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RABC relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2 [Term] id: CL:0000844 name: germinal center B cell def: "A rapidly cycling mature B cell that has distinct phenotypic characteristics and is involved in T-dependent immune responses and located typically in the germinal centers of lymph nodes. This cell type expresses Ly77 after activation." [GOC:add, GOC:dsd, GOC:tfm, ISBN:0781735149, PMID:19447676, PMID:20933013] comment: Germinal center B cells are also reportedly CD10-positive, CD19-positive, CD20-positive, CD38-positive, CD44-low, CD45-positive, CD48-positive, CD95-positive, CD352-positive, and HLA-DR-positive. Transcription factors: BCL6-positive, Ets1-positive, IRF8-positive, MTA3-positive, OBF1-positive, PAX5-positive, SpiB-positive, and STAT3-positive. subset: human_reference_atlas synonym: "GC B cell" EXACT [] synonym: "GC B lymphocyte" EXACT [] synonym: "GC B-cell" EXACT [] synonym: "GC B-lymphocyte" EXACT [] synonym: "germinal center B lymphocyte" EXACT [] synonym: "germinal center B-cell" EXACT [] synonym: "germinal center B-lymphocyte" EXACT [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell intersection_of: CL:0000785 ! mature B cell intersection_of: part_of UBERON:0001745 ! secondary nodular lymphoid tissue intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: develops_from CL:0000843 ! follicular B cell relationship: part_of UBERON:0001745 ! secondary nodular lymphoid tissue relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 [Term] id: CL:0000845 name: marginal zone B cell of spleen def: "A mature B cell that is located in the marginal zone of the spleen with the phenotype CD23-negative and CD21-positive and expressing a B cell receptor usually reactive to bacterial cell wall components or senescent self components such as oxidized-LDL. This cell type is also described as being CD19-positive, B220-positive, IgM-high, AA4-negative, CD35-high." [GOC:add, GOC:dsd, http://en.wikipedia.org/wiki/Marginal-zone_B_cell, ISBN:0781735149, PMID:10933592, PMID:20933013] comment: MZ B cells are reportedly CD1-positive (mice), CD20-positive, CD48-positive, CD84-positive, CD150-positive, CD229-positive, and CD352-positive. subset: human_reference_atlas synonym: "B cell of marginal zone of spleen" EXACT [] synonym: "marginal zone B cell" BROAD [] synonym: "marginal zone B lymphocyte" BROAD [] synonym: "marginal zone B-cell" BROAD [] synonym: "marginal zone B-lymphocyte" BROAD [] synonym: "marginal zone of spleen B cell" EXACT [] synonym: "MZ B cell" BROAD [] synonym: "MZ B lymphocyte" BROAD [] synonym: "MZ B-cell" BROAD [] synonym: "MZ B-lymphocyte" BROAD [] is_a: CL:0000785 {is_inferred="true"} ! mature B cell is_a: CL:2000074 ! splenocyte intersection_of: CL:0000785 ! mature B cell intersection_of: capable_of GO:0042742 ! defense response to bacterium intersection_of: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor intersection_of: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor intersection_of: part_of UBERON:0001251 ! marginal zone of spleen intersection_of: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2 intersection_of: RO:0015015 GO:0071753 ! has high plasma membrane amount IgM immunoglobulin complex relationship: capable_of GO:0042742 ! defense response to bacterium relationship: lacks_plasma_membrane_part PR:000001880 ! low affinity immunoglobulin epsilon Fc receptor relationship: lacks_plasma_membrane_part PR:000002037 ! complement component C1q receptor relationship: part_of UBERON:0001251 ! marginal zone of spleen relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001289 ! has plasma membrane part membrane-spanning 4-domains subfamily A member 1 relationship: RO:0002104 PR:000001338 ! has plasma membrane part complement receptor type 2 relationship: RO:0015015 GO:0071753 ! has high plasma membrane amount IgM immunoglobulin complex [Term] id: CL:0000846 name: vestibular dark cell def: "An epithelial cell of the vestibular sensory organ that is characterized by intense enzymatic activities and numerous basal membrane infoldings." [PMID:11223304] is_a: CL:0000066 ! epithelial cell is_a: CL:0002371 ! somatic cell [Term] id: CL:0000847 name: ciliated olfactory receptor neuron def: "An olfactory receptor cell in which the apical ending of the dendrite is a pronounced ciliated olfactory knob." [PMID:16841163] synonym: "ciliated olfactory sensory neuron" EXACT [] synonym: "ciliated sensory neuron" EXACT [] is_a: CL:0000064 ! ciliated cell is_a: CL:0000207 ! olfactory receptor cell intersection_of: CL:0000207 ! olfactory receptor cell intersection_of: has_part GO:0005929 ! cilium [Term] id: CL:0000848 name: microvillous olfactory receptor neuron def: "An olfactory receptor cell in which the apical ending of the dendrite is a knob that bears numerous microvilli." [PMID:16841163] synonym: "microvillous olfactory sensory neuron" EXACT [] synonym: "microvillous sensory neuron" RELATED [] is_a: CL:0000207 ! olfactory receptor cell [Term] id: CL:0000849 name: crypt olfactory receptor neuron def: "An olfactory receptor cell with short cilia growing in an invagination bordered by microvilli." [PMID:16841163] synonym: "crypt cell" EXACT [] synonym: "crypt olfactory sensory neuron" EXACT [] synonym: "crypt sensory neuron" EXACT [] is_a: CL:0000207 ! olfactory receptor cell [Term] id: CL:0000850 name: serotonergic neuron alt_id: CL:0000403 def: "A neuron that releases serotonin as a neurotransmitter." [SANBI:mhl] synonym: "5-HT neuron" EXACT [] synonym: "5-hydroxytryptamine neuron" EXACT [] synonym: "serotinergic neuron" RELATED [] xref: FBbt:00005133 xref: MESH:D059326 xref: WBbt:0006837 is_a: CL:0000458 ! serotonin secreting cell is_a: CL:0000540 ! neuron intersection_of: CL:0000540 ! neuron intersection_of: capable_of GO:0060096 ! serotonin secretion, neurotransmission relationship: capable_of GO:0060096 ! serotonin secretion, neurotransmission [Term] id: CL:0000851 name: neuromast mantle cell def: "Neuromast mantle cell is a non-sensory cell. Neuromast mantle cells surround the neuromast support cells and neuromast hair cells, separating the neuromast from the epidermis, and secrete cupula in which the ciliary bundles of all the hair cells are embedded." [ISBN:0125296509] is_a: CL:0000151 ! secretory cell disjoint_from: CL:0000855 ! sensory hair cell relationship: part_of UBERON:0008904 ! neuromast [Term] id: CL:0000852 name: neuromast supporting cell def: "Neuromast support cell is a non-sensory cell of the neuromast that extend between the sensory hair cells from the basement membrane to the apical surface; neuromast support cells are surrounded by neuromast mantle cells." [ISBN:0125296509] synonym: "neuromast support cell" EXACT [] is_a: BFO:0000004 ! independent continuant is_a: CL:0000630 ! supporting cell disjoint_from: CL:0000855 ! sensory hair cell relationship: part_of UBERON:0008904 ! neuromast [Term] id: CL:0000853 name: olfactory epithelial supporting cell def: "Olfactory epithelial support cell is a columnar cell that extends from the epithelial free margin to the basement membrane of the olfactory epithelium. This cell type has a large, vertically, elongate, euchromatic nucleus, along with other nuclei, forms a layer superficial to the cell body of the receptor cell; sends long somewhat irregular microvilli into the mucus layer; at the base, with expanded end-feet containing numerous lamellated dense bodies resembling lipofuscin of neurons." [GOC:tfm, ISBN:0517223651, SANBI:mhl] synonym: "olfactory epithelial support cell" EXACT [] synonym: "olfactory sustentacular cell" EXACT [] synonym: "supporting cell of olfactory epithelium" EXACT [] synonym: "sustentaculocyte of olfactory epithelium" EXACT [] xref: FMA:62302 is_a: CL:0000630 ! supporting cell is_a: CL:0002169 ! basal cell of olfactory epithelium intersection_of: CL:0000630 ! supporting cell intersection_of: part_of UBERON:0001997 ! olfactory epithelium [Term] id: CL:0000854 name: interneuromast cell def: "Interneuromast cell is a neuroectodermal cell deposited by the migrating lateral line primordium between the neuromasts. Interneuromast cells proliferate and migrate to form additional neuromasts." [SANBI:mhl] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000133 ! neurectodermal cell relationship: develops_from CL:0000032 ! neuroplacodal cell [Term] id: CL:0000855 name: sensory hair cell def: "Hair cell is a mechanoreceptor cell that is sensitive to movement of the hair-like projections (stereocilia and kinocilia) which relay the information centrally in the nervous system." [SANBI:mhl] synonym: "hair cell" BROAD [] xref: BTO:0004744 is_a: CL:0000199 ! mechanoreceptor cell [Term] id: CL:0000856 name: neuromast hair cell def: "Neuromast hair cell is a hair cell that acts as a sensory receptor of the neuromast; it is morphologically polarized as a result of the relative position of the single kinocilium and the clusters of stereocilia on its apical surface." [SANBI:mhl] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000006 ! neuronal receptor cell is_a: CL:0000855 ! sensory hair cell intersection_of: CL:0000855 ! sensory hair cell intersection_of: part_of UBERON:0008904 ! neuromast relationship: part_of UBERON:0008904 ! neuromast [Term] id: CL:0000857 name: slow muscle myoblast def: "A skeletal muscle myoblast that differentiates into slow muscle fibers." [SANBI:mhl] is_a: CL:0000515 ! skeletal muscle myoblast intersection_of: CL:0000056 ! myoblast intersection_of: RO:0002203 CL:0000189 ! develops into slow muscle cell relationship: RO:0002203 CL:0000189 ! develops into slow muscle cell [Term] id: CL:0000858 name: fast muscle myoblast def: "A skeletal muscle myoblast that differentiates into fast muscle fibers." [SANBI:mhl] is_a: CL:0000515 ! skeletal muscle myoblast intersection_of: CL:0000056 ! myoblast intersection_of: RO:0002203 CL:0000190 ! develops into fast muscle cell relationship: RO:0002203 CL:0000190 ! develops into fast muscle cell [Term] id: CL:0000860 name: classical monocyte def: "A monocyte that responds rapidly to microbial stimuli by secreting cytokines and antimicrobial factors and which is characterized by high expression of CCR2 in both rodents and humans, negative for the lineage markers CD3, CD19, and CD20, and of larger size than non-classical monocytes." [GO_REF:0000031, GOC:add, PMID:16322748, PMID:18303997, PMID:20628149, PMID:20870168] comment: Markers: CCR2+CXCCR1 (human, mouse, rat). subset: human_reference_atlas synonym: "inflammatory monocyte" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000234 ! phagocyte is_a: CL:0000576 {is_inferred="true"} ! monocyte intersection_of: CL:0000576 ! monocyte intersection_of: capable_of GO:0002548 ! monocyte chemotaxis intersection_of: capable_of GO:0006909 ! phagocytosis intersection_of: capable_of GO:0006954 ! inflammatory response intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0015015 PR:000001199 ! has high plasma membrane amount C-C chemokine receptor type 2 relationship: capable_of GO:0002548 ! monocyte chemotaxis relationship: capable_of GO:0006954 ! inflammatory response relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0015015 PR:000001199 ! has high plasma membrane amount C-C chemokine receptor type 2 [Term] id: CL:0000861 name: elicited macrophage def: "A macrophage which develops from an inflammatory monocyte and is recruited into the tissues in response to injury and infection as part of an inflammatory response. Markers include CD11b-positive, CD68-positive, and F4/80-positive." [GO_REF:0000031, GOC:add, GOC:ana, GOC:tfm, PMID:15771589] comment: Markers: CD11b+, CD68+; Mouse: F4/80+; role or process: immune, inflammation (inflammatory response). synonym: "free macrophage" EXACT [] synonym: "wandering histiocyte" EXACT [] xref: FMA:84643 xref: FMA:84645 is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000235 {is_inferred="true"} ! macrophage intersection_of: CL:0000235 ! macrophage intersection_of: participates_in GO:0006954 ! inflammatory response intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: develops_from CL:0000860 ! classical monocyte relationship: participates_in GO:0006954 ! inflammatory response relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin [Term] id: CL:0000862 name: suppressor macrophage def: "A macrophage that suppresses immune responses." [GOC:add, GOC:tfm, PMID:20402419] comment: Markers: May express: IL10, TGFbeta. is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage intersection_of: CL:0000861 ! elicited macrophage intersection_of: capable_of GO:0050777 ! negative regulation of immune response relationship: capable_of GO:0050777 ! negative regulation of immune response [Term] id: CL:0000863 name: inflammatory macrophage def: "An elicited macrophage that is recruited into the tissues in response to injury and infection as part of an inflammatory response, expresses high levels of pro-inflammatory cytokines, ROS and NO, and shows potent microbicidal activity." [GO_REF:0000031, GOC:ana, PMID:19132917] comment: Markers: Express: TNFa, IL1b, IL6, iNOS, NADPH-oxidase; produce: reactive oxygen species, nitric oxide; role or process: immune, inflammation (inflammatory response). synonym: "classically activated macrophage" EXACT [] synonym: "M1 macrophage" RELATED [PMID:28923980] is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage intersection_of: CL:0000861 ! elicited macrophage intersection_of: capable_of GO:0032611 ! interleukin-1 beta production intersection_of: capable_of GO:0032635 ! interleukin-6 production intersection_of: capable_of GO:0032640 ! tumor necrosis factor production intersection_of: capable_of GO:0042554 ! superoxide anion generation intersection_of: capable_of GO:0042742 ! defense response to bacterium intersection_of: capable_of GO:0051767 ! nitric-oxide synthase biosynthetic process relationship: capable_of GO:0032611 ! interleukin-1 beta production relationship: capable_of GO:0032635 ! interleukin-6 production relationship: capable_of GO:0032640 ! tumor necrosis factor production relationship: capable_of GO:0042554 ! superoxide anion generation relationship: capable_of GO:0042742 ! defense response to bacterium relationship: capable_of GO:0051767 ! nitric-oxide synthase biosynthetic process [Term] id: CL:0000864 name: tissue-resident macrophage def: "A macrophage constitutively resident in a particular tissue under non-inflammatory conditions, and capable of phagocytosing a variety of extracellular particulate material, including immune complexes, microorganisms, and dead cells." [GO_REF:0000031, GOC:ana, PMID:19770654] synonym: "fixed macrophage" EXACT [] synonym: "resting histiocyte" EXACT [] xref: FMA:84642 xref: FMA:84644 is_a: CL:0000235 {is_inferred="true"} ! macrophage intersection_of: CL:0000235 ! macrophage intersection_of: part_of UBERON:0000479 ! tissue relationship: part_of UBERON:0000479 ! tissue [Term] id: CL:0000865 name: gastrointestinal tract (lamina propria) macrophage def: "A gut-associated lymphoid tissue macrophage found in lamina propria of the gut." [GO_REF:0000031, GOC:ana, GOC:tfm, https://orcid.org/0000-0002-2825-0621] synonym: "gastrointestinal system (lamina propria) macrophage" EXACT [] synonym: "macrophage of gastrointestinal system (lamina propria)" EXACT [] synonym: "macrophage of gastrointestinal tract (lamina propria)" EXACT [] is_a: CL:0000885 ! gut-associated lymphoid tissue macrophage intersection_of: CL:0000885 ! gut-associated lymphoid tissue macrophage intersection_of: part_of UBERON:0004780 ! gastrointestinal system lamina propria relationship: part_of UBERON:0004780 ! gastrointestinal system lamina propria [Term] id: CL:0000866 name: thymic macrophage def: "A tissue-resident macrophage resident found in the thymus, involved in the clearance of apoptotic thymocytes." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:9048205] comment: Role or process: immune, clearance of apoptotic thymocytes, antigen-presentation. subset: human_reference_atlas is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: capable_of GO:0043277 ! apoptotic cell clearance intersection_of: part_of UBERON:0002370 ! thymus relationship: capable_of GO:0043277 ! apoptotic cell clearance relationship: part_of UBERON:0002370 ! thymus relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000867 name: secondary lymphoid organ macrophage def: "A tissue-resident macrophage found in a secondary lymphoid organ." [GO_REF:0000031, GOC:ana, GOC:tfm] is_a: CL:0000864 ! tissue-resident macrophage [Term] id: CL:0000868 name: lymph node macrophage def: "A secondary lymphoid organ macrophage found in a lymph node. This cell is CD169-high." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:11971865] comment: Marker was observed on rat cells. synonym: "MF.LN" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage intersection_of: CL:0000867 ! secondary lymphoid organ macrophage intersection_of: part_of UBERON:0000029 ! lymph node intersection_of: RO:0015015 PR:000001931 ! has high plasma membrane amount sialoadhesin intersection_of: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M intersection_of: RO:0015016 PR:000001813 ! has low plasma membrane amount adhesion G protein-coupled receptor E1 relationship: part_of UBERON:0000029 ! lymph node relationship: RO:0015015 PR:000001931 ! has high plasma membrane amount sialoadhesin relationship: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M relationship: RO:0015016 PR:000001813 ! has low plasma membrane amount adhesion G protein-coupled receptor E1 [Term] id: CL:0000869 name: tonsillar macrophage def: "A gut-associated lymphoid tissue macrophage found in tonsils." [GO_REF:0000031, GOC:ana, PMID:16048540] is_a: CL:0000885 ! gut-associated lymphoid tissue macrophage intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage intersection_of: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue intersection_of: part_of UBERON:0002372 ! tonsil relationship: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue relationship: part_of UBERON:0002372 ! tonsil [Term] id: CL:0000870 name: Peyer's patch macrophage def: "A gut-associated lymphoid tissue macrophage found in the Peyer's patches." [GO_REF:0000031, GOC:ana, GOC:tfm] is_a: CL:0000885 {is_inferred="true"} ! gut-associated lymphoid tissue macrophage intersection_of: CL:0000885 ! gut-associated lymphoid tissue macrophage intersection_of: part_of UBERON:0001211 ! Peyer's patch relationship: part_of UBERON:0001211 ! Peyer's patch [Term] id: CL:0000871 name: splenic macrophage def: "A secondary lymphoid organ macrophage found in the spleen." [GO_REF:0000031, PMID:15771589, PMID:16322748] comment: Role or process: immune, clearance of apoptotic and senescent cells. xref: FMA:83026 is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage is_a: CL:2000074 ! splenocyte intersection_of: CL:0000867 ! secondary lymphoid organ macrophage intersection_of: capable_of GO:0034102 ! erythrocyte clearance intersection_of: part_of UBERON:0002106 ! spleen relationship: capable_of GO:0034102 ! erythrocyte clearance [Term] id: CL:0000872 name: splenic marginal zone macrophage def: "A splenic macrophage found in the marginal zone of the spleen, involved in recognition and clearance of particulate material from the splenic circulation. Markers include F4/80-negative, MARCO-positive, SR-A-positive, SIGN-R1-positive, and Dectin2-positive." [GO_REF:0000031, GOC:ana, PMID:16861066] comment: Markers: Mouse: F4/80-, MARCO+, SR-A+, SIGN-R1+, Dectin2+. subset: human_reference_atlas is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage intersection_of: CL:0000871 ! splenic macrophage intersection_of: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M intersection_of: part_of UBERON:0001251 ! marginal zone of spleen intersection_of: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A intersection_of: RO:0002104 PR:000001884 ! has plasma membrane part macrophage receptor MARCO intersection_of: RO:0002104 PR:000001885 ! has plasma membrane part macrophage scavenger receptor types I and II intersection_of: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B relationship: lacks_plasma_membrane_part PR:000001012 ! integrin alpha-M relationship: part_of UBERON:0001251 ! marginal zone of spleen relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A relationship: RO:0002104 PR:000001884 ! has plasma membrane part macrophage receptor MARCO relationship: RO:0002104 PR:000001885 ! has plasma membrane part macrophage scavenger receptor types I and II relationship: RO:0002104 PR:000006172 ! has plasma membrane part CD209 molecule-like protein B [Term] id: CL:0000873 name: splenic metallophillic macrophage def: "A splenic macrophage found in the areas surrounding the white pulp of the spleen, adjacent to the marginal sinus. Markers include F4/80-negative, Dectin2-low, sialoadhesin-positive." [GO_REF:0000031, GOC:ana, PMID:20018690] comment: Markers: Mouse: F4/80-, Dectin2-low, sialoadhesin+. is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage intersection_of: CL:0000871 ! splenic macrophage intersection_of: adjacent_to UBERON:0001959 ! white pulp of spleen intersection_of: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1 intersection_of: part_of UBERON:0001251 ! marginal zone of spleen intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin intersection_of: RO:0015016 PR:000001806 ! has low plasma membrane amount C-type lectin domain family 6 member A relationship: adjacent_to UBERON:0001959 ! white pulp of spleen relationship: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1 relationship: part_of UBERON:0001251 ! marginal zone of spleen relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin relationship: RO:0015016 PR:000001806 ! has low plasma membrane amount C-type lectin domain family 6 member A [Term] id: CL:0000874 name: splenic red pulp macrophage def: "A splenic macrophage found in the red-pulp of the spleen, and involved in immune responses to blood-borne pathogens and in the clearance of senescent erythrocytes. Markers include F4/80-positive, CD68-positive, MR-positive, Dectin2-positive, macrosialin-positive, and sialoadhesin-low." [GO_REF:0000031, GOC:ana, PMID:19644016] comment: Markers: Mouse: F4/80+, CD68+, MR+, Dectin2+, macrosialin+, sialoadhesin-low; role or process: immune, clearance of senescent erythrocytes. subset: human_reference_atlas is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage intersection_of: CL:0000871 ! splenic macrophage intersection_of: capable_of GO:0006955 ! immune response intersection_of: capable_of GO:0034102 ! erythrocyte clearance intersection_of: lacks_plasma_membrane_part PR:000001013 ! integrin alpha-X intersection_of: part_of UBERON:0001250 ! red pulp of spleen intersection_of: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A intersection_of: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin intersection_of: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1 intersection_of: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M intersection_of: RO:0015016 PR:000001931 ! has low plasma membrane amount sialoadhesin relationship: capable_of GO:0006955 ! immune response relationship: lacks_plasma_membrane_part PR:000001013 ! integrin alpha-X relationship: part_of UBERON:0001250 ! red pulp of spleen relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001806 ! has plasma membrane part C-type lectin domain family 6 member A relationship: RO:0002104 PR:000001813 ! has plasma membrane part adhesion G protein-coupled receptor E1 relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: RO:0002104 PR:000002972 ! has plasma membrane part macrophage mannose receptor 1 relationship: RO:0015016 PR:000001012 ! has low plasma membrane amount integrin alpha-M relationship: RO:0015016 PR:000001931 ! has low plasma membrane amount sialoadhesin [Term] id: CL:0000875 name: non-classical monocyte def: "A type of monocyte characterized by low expression of CCR2, low responsiveness to monocyte chemoattractant CCL2/MCP1, low phagocytic activity, and decrease size relative to classical monocytes, but increased co-stimulatory activity. May also play a role in tissue repair." [GO_REF:0000031, GOC:add, PMID:16322748, PMID:18303997, PMID:20628149, PMID:20870168] comment: Markers: CCR2-CX3CCR1+ (human, mouse, rat); human: CD16+, CCR5+, CD32/FcgRII-high, MHCII+, CD86+; mouse: CD62L-Ly6C-. subset: human_reference_atlas synonym: "patrolling monocyte" EXACT [] synonym: "resident monocyte" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000576 {is_inferred="true"} ! monocyte intersection_of: CL:0000576 ! monocyte intersection_of: bearer_of PATO:0000587 ! decreased size intersection_of: capable_of GO:0031294 ! lymphocyte costimulation intersection_of: has_completed GO:0030224 ! monocyte differentiation intersection_of: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule intersection_of: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon intersection_of: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 intersection_of: RO:0015015 PR:000001206 ! has high plasma membrane amount CX3C chemokine receptor 1 relationship: bearer_of PATO:0000587 ! decreased size relationship: capable_of GO:0031294 ! lymphocyte costimulation relationship: develops_from CL:0002393 ! intermediate monocyte relationship: has_completed GO:0030224 ! monocyte differentiation relationship: lacks_plasma_membrane_part PR:000001002 ! CD19 molecule relationship: lacks_plasma_membrane_part PR:000001020 ! CD3 epsilon relationship: lacks_plasma_membrane_part PR:000001289 ! membrane-spanning 4-domains subfamily A member 1 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0015015 PR:000001206 ! has high plasma membrane amount CX3C chemokine receptor 1 [Term] id: CL:0000876 name: splenic white pulp macrophage def: "A splenic macrophage found in the white pulp of the spleen. Markers include F4/80-negative, CD68-positive, and macrosialin-positive." [GO_REF:0000031, GOC:ana, PMID:11207597] comment: Markers: Mouse: F4/80-, CD68+, macrosialin+. subset: human_reference_atlas is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000871 {is_inferred="true"} ! splenic macrophage intersection_of: CL:0000871 ! splenic macrophage intersection_of: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1 intersection_of: part_of UBERON:0001959 ! white pulp of spleen intersection_of: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin relationship: lacks_plasma_membrane_part PR:000001813 ! adhesion G protein-coupled receptor E1 relationship: part_of UBERON:0001959 ! white pulp of spleen relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000002064 ! has plasma membrane part macrosialin [Term] id: CL:0000877 name: splenic tingible body macrophage def: "A splenic white pulp macrophage found in and around the germinal centers of the white pulp of the spleen that participates in phagocytosis of apoptotic B cells from the germinal centers. A marker for a cell of this type is Mertk-positive." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19631584] subset: human_reference_atlas is_a: CL:0000876 {is_inferred="true"} ! splenic white pulp macrophage intersection_of: CL:0000876 ! splenic white pulp macrophage intersection_of: capable_of GO:0043277 ! apoptotic cell clearance intersection_of: part_of UBERON:0001249 ! spleen lymphoid follicle intersection_of: RO:0002104 PR:000010329 ! has plasma membrane part tyrosine-protein kinase Mer relationship: capable_of GO:0043277 ! apoptotic cell clearance relationship: part_of UBERON:0001249 ! spleen lymphoid follicle relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000010329 ! has plasma membrane part tyrosine-protein kinase Mer [Term] id: CL:0000878 name: central nervous system macrophage def: "A tissue-resident macrophage found in the central nervous system." [GO_REF:0000031, PMID:16322748] synonym: "CNS macrophage" EXACT [] is_a: CL:0000864 {is_inferred="true"} ! tissue-resident macrophage is_a: CL:0002319 ! neural cell intersection_of: CL:0000864 ! tissue-resident macrophage intersection_of: part_of UBERON:0001017 ! central nervous system relationship: part_of UBERON:0001017 ! central nervous system [Term] id: CL:0000879 name: meningeal macrophage def: "A central nervous system macrophage found in the meninges (the three membranes that surround the brain). This macrophage types is highly phagocytic and expresses scavenger receptors." [GO_REF:0000031, GOC:ana, PMID:11591794] is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage intersection_of: CL:0000878 ! central nervous system macrophage intersection_of: capable_of GO:0005044 ! scavenger receptor activity intersection_of: part_of UBERON:0002360 ! meninx relationship: capable_of GO:0005044 ! scavenger receptor activity relationship: part_of UBERON:0002360 ! meninx [Term] id: CL:0000880 name: choroid-plexus macrophage def: "A central nervous system macrophage found at the interface between the blood and the cerebrospinal fluid in the brain. This cell expresses scavenger receptors." [GO_REF:0000031, GOC:ana, PMID:9550136] is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage intersection_of: CL:0000878 ! central nervous system macrophage intersection_of: capable_of GO:0005044 ! scavenger receptor activity intersection_of: located_in UBERON:0001886 ! choroid plexus relationship: capable_of GO:0005044 ! scavenger receptor activity relationship: located_in UBERON:0001886 ! choroid plexus [Term] id: CL:0000881 name: perivascular macrophage def: "A central nervous system macrophage found in small blood vessels in the brain. Markers include CD14+CD16+CD163+." [GO_REF:0000031, GOC:tfm, PMID:16507898] comment: Markers: Human/monkey, mice: CD163. Human: CD14+CD16+CD163+. is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000878 {is_inferred="true"} ! central nervous system macrophage intersection_of: CL:0000878 ! central nervous system macrophage intersection_of: part_of UBERON:0001981 ! blood vessel intersection_of: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III intersection_of: RO:0002104 PR:000001889 ! has plasma membrane part CD14 molecule intersection_of: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130 relationship: part_of UBERON:0001981 ! blood vessel relationship: RO:0002104 PR:000001483 ! has plasma membrane part low affinity immunoglobulin gamma Fc region receptor III relationship: RO:0002104 PR:000001889 ! has plasma membrane part CD14 molecule relationship: RO:0002104 PR:000001925 ! has plasma membrane part scavenger receptor cysteine-rich type 1 protein M130 [Term] id: CL:0000882 name: thymic medullary macrophage def: "A thymic macrophage found in the thymic medulla." [GO_REF:0000031, GOC:ana, PMID:9048205] subset: human_reference_atlas is_a: CL:0000866 {is_inferred="true"} ! thymic macrophage intersection_of: CL:0000866 ! thymic macrophage intersection_of: part_of UBERON:0002124 ! medulla of thymus relationship: part_of UBERON:0002124 ! medulla of thymus relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000883 name: thymic cortical macrophage def: "A thymic macrophage found in the thymic cortex." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:9048205] subset: human_reference_atlas is_a: CL:0000866 {is_inferred="true"} ! thymic macrophage intersection_of: CL:0000866 ! thymic macrophage intersection_of: part_of UBERON:0002123 ! cortex of thymus relationship: part_of UBERON:0002123 ! cortex of thymus relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000884 name: mucosa-associated lymphoid tissue macrophage def: "A tissue-resident macrophage found in the mucosa associated lymphoid tissue." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19906191] is_a: CL:0000867 {is_inferred="true"} ! secondary lymphoid organ macrophage intersection_of: CL:0000867 ! secondary lymphoid organ macrophage intersection_of: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue relationship: part_of UBERON:0001961 ! mucosa-associated lymphoid tissue [Term] id: CL:0000885 name: gut-associated lymphoid tissue macrophage def: "A mucosa-associated lymphoid tissue macrophage found in the mucosa-associated lymphoid tissues of the gut." [GO_REF:0000031, GOC:ana, PMID:19906191] is_a: CL:0000884 {is_inferred="true"} ! mucosa-associated lymphoid tissue macrophage intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage intersection_of: capable_of GO:0002387 ! immune response in gut-associated lymphoid tissue intersection_of: part_of UBERON:0001962 ! gut-associated lymphoid tissue relationship: capable_of GO:0002387 ! immune response in gut-associated lymphoid tissue relationship: part_of UBERON:0001962 ! gut-associated lymphoid tissue [Term] id: CL:0000886 name: nasal and broncial associated lymphoid tissue macrophage def: "A mucosa-associated lymphoid tissue macrophage found in the nasal and bronchial mucosa-associated lymphoid tissues." [GO_REF:0000031, GOC:ana, PMID:16048540] is_a: CL:0000884 {is_inferred="true"} ! mucosa-associated lymphoid tissue macrophage intersection_of: CL:0000884 ! mucosa-associated lymphoid tissue macrophage intersection_of: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue intersection_of: part_of UBERON:0001963 ! bronchial-associated lymphoid tissue relationship: capable_of GO:0002395 ! immune response in nasopharyngeal-associated lymphoid tissue relationship: part_of UBERON:0001963 ! bronchial-associated lymphoid tissue [Term] id: CL:0000887 name: lymph node subcapsular sinus macrophage def: "A lymph node macrophage found in the subcapsular sinus of lymph nodes that participates in sensing, clearance, and antigen presentation of lymph-borne particulate antigens. This macrophage is capable of activating invaraint NKT cells and is CD169-positive." [GO_REF:0000031, GOC:tfm, PMID:14668803, PMID:17934446, PMID:20228797] subset: human_reference_atlas is_a: CL:0000868 {is_inferred="true"} ! lymph node macrophage intersection_of: CL:0000868 ! lymph node macrophage intersection_of: adjacent_to UBERON:0002194 ! capsule of lymph node intersection_of: capable_of GO:0032816 ! positive regulation of natural killer cell activation intersection_of: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin relationship: adjacent_to UBERON:0002194 ! capsule of lymph node relationship: capable_of GO:0032816 ! positive regulation of natural killer cell activation relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001931 ! has plasma membrane part sialoadhesin [Term] id: CL:0000888 name: lymph node tingible body macrophage def: "A lymph node macrophage found in the cortex of lymph nodes, in particular in and around the germinal centers, and that participates in phagocytosis of apoptotic B cells from the germinal centers." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:19631584] subset: human_reference_atlas is_a: CL:0000868 {is_inferred="true"} ! lymph node macrophage intersection_of: CL:0000868 ! lymph node macrophage intersection_of: capable_of GO:0002905 ! regulation of mature B cell apoptotic process intersection_of: capable_of GO:0043277 ! apoptotic cell clearance intersection_of: part_of UBERON:0002006 ! cortex of lymph node relationship: capable_of GO:0002905 ! regulation of mature B cell apoptotic process relationship: capable_of GO:0043277 ! apoptotic cell clearance relationship: part_of UBERON:0002006 ! cortex of lymph node relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000889 name: myeloid suppressor cell def: "An immature myeloid leukocyte of heterogeneous phenotype found particularly in cancer and sepsis patients that is capable of suppressing activity of T cells in ex vivo assays. This cell type is CD45-positive, CD11b-positive." [GO_REF:0000031, GOC:add, GOC:ana, PMID:16168663, PMID:17016554, PMID:17016559] comment: Markers: Mouse: CD11b+GR1+CD31+; Human: CD34+ CD33+CD15-CD13+. (According to some reports in humans these cells are iNOS+ARG1+IL13+IFNg+); location: In cancerous tissue; in the blood and lymphoid organs in sepsis. is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000766 {is_inferred="true"} ! myeloid leukocyte intersection_of: CL:0000766 ! myeloid leukocyte intersection_of: bearer_of PATO:0001501 ! immature intersection_of: capable_of GO:0050777 ! negative regulation of immune response intersection_of: RO:0002104 PR:000001006 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C intersection_of: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M relationship: bearer_of PATO:0001501 ! immature relationship: capable_of GO:0050777 ! negative regulation of immune response relationship: RO:0002104 PR:000001006 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C relationship: RO:0002104 PR:000001012 ! has plasma membrane part integrin alpha-M [Term] id: CL:0000890 name: alternatively activated macrophage def: "An elicited macrophage characterized by low production of pro-inflammatory and Th1 polarizing cytokines and high expression of arginase-1, and associated with tissue remodelling." [GO_REF:0000031, GOC:ana, GOC:tfm, PMID:20510870] comment: Role or process: tissue remodeling. synonym: "M2 macrophage" RELATED [PMID:28923980] is_a: CL:0000861 {is_inferred="true"} ! elicited macrophage intersection_of: CL:0000861 ! elicited macrophage intersection_of: capable_of GO:0048771 ! tissue remodeling intersection_of: has_part PR:000001844 ! arginase-1 relationship: capable_of GO:0048771 ! tissue remodeling relationship: has_part PR:000001844 ! arginase-1 [Term] id: CL:0000891 name: foam cell def: "A type of cell containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add] xref: BTO:0003872 xref: FMA:83586 xref: MESH:D005487 is_a: CL:0000003 ! native cell [Term] id: CL:0000892 name: smooth muscle cell derived foam cell def: "A type of foam cell derived from a smooth muscle cell containing lipids in small vacuoles and typically seen in atherolosclerotic lesions, as well as other conditions." [GOC:add, PMID:30664015] is_a: CARO:0000000 ! anatomical entity is_a: CL:0000891 ! foam cell relationship: develops_from CL:0000192 ! smooth muscle cell [Term] id: CL:0000893 name: thymocyte def: "An immature T cell located in the thymus." [GO_REF:0000031, GOC:add, GOC:tfm, PMID:12415312] synonym: "immature T cell" BROAD [] synonym: "immature T lymphocyte" BROAD [] synonym: "immature T-cell" BROAD [] synonym: "immature T-lymphocyte" BROAD [] synonym: "thymic lymphocyte" EXACT [] xref: BTO:0001372 xref: CALOHA:TS-1042 xref: FMA:72202 xref: MESH:D060168 xref: XAO:0003159 is_a: CL:0002420 {is_inferred="true"} ! immature T cell intersection_of: CL:0000084 ! T cell intersection_of: has_not_completed GO:0045058 ! T cell selection intersection_of: part_of UBERON:0002370 ! thymus relationship: part_of UBERON:0002370 ! thymus [Term] id: CL:0000894 name: DN1 thymic pro-T cell def: "A pro-T cell that has the phenotype CD4-negative, CD8-negative, CD44-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:tfm] synonym: "DN1 thymic pro-T lymphocyte" EXACT [] synonym: "DN1 thymic pro-T-cell" EXACT [] synonym: "DN1 thymic pro-T-lymphocyte" EXACT [] synonym: "DN1 thymic progenitor T cell" EXACT [] synonym: "DN1 thymocyte" EXACT [] synonym: "double negative 1" EXACT [] synonym: "preT.DN1.Th" EXACT [] is_a: CARO:0000006 ! material anatomical entity is_a: CL:0000827 {is_inferred="true"} ! pro-T cell intersection_of: CL:0000827 ! pro-T cell intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: part_of UBERON:0002370 ! thymus intersection_of: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule relationship: develops_from CL:0002425 ! early T lineage precursor relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: part_of UBERON:0002370 ! thymus relationship: RO:0002104 PR:000001307 ! has plasma membrane part CD44 molecule [Term] id: CL:0000895 name: naive thymus-derived CD4-positive, alpha-beta T cell def: "An antigen inexperienced CD4-positive, alpha-beta T cell with the phenotype CCR7-positive, CD127-positive and CD62L-positive. This cell type develops in the thymus. This cell type is also described as being CD25-negative, CD62L-high, and CD44-low." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, PMID:19100699, PMID:22343568] comment: These cells have not been exposed to antigen following thymic T-cell selection; found in blood and secondary lymphoid organs. This cell type is compatible with the HIPC Lyoplate markers for 'naive CD4+ T cell', but includes additional markers known to be expressed on naive CD4+ T cells. subset: human_reference_atlas synonym: "naive CD4+ T cell" BROAD [PMID:22343568] synonym: "naive thymus-derived CD4-positive, alpha-beta T lymphocyte" EXACT [] synonym: "naive thymus-derived CD4-positive, alpha-beta T-cell" EXACT [] synonym: "naive thymus-derived CD4-positive, alpha-beta T-lymphocyte" EXACT [] synonym: "T.4Nve.Sp" EXACT [] synonym: "Th0" EXACT [GOC:tfm] is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell is_a: CL:0000898 ! naive T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha intersection_of: RO:0015015 PR:000001318 ! has high plasma membrane amount L-selectin intersection_of: RO:0015016 PR:000001307 ! has low plasma membrane amount CD44 molecule relationship: develops_from CL:0002436 ! mature CD4 single-positive thymocyte relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000896 name: activated CD4-positive, alpha-beta T cell def: "A recently activated CD4-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, and CD25-positive." [GO_REF:0000031, GOC:add, GOC:pam] synonym: "activated CD4-positive, alpha-beta T lymphocyte" EXACT [] synonym: "activated CD4-positive, alpha-beta T-cell" EXACT [] synonym: "activated CD4-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000624 {is_inferred="true"} ! CD4-positive, alpha-beta T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: develops_from CL:0000895 ! naive thymus-derived CD4-positive, alpha-beta T cell relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000897 name: CD4-positive, alpha-beta memory T cell def: "A CD4-positive, alpha-beta T cell that has differentiated into a memory T cell." [GOC:add, http://www.immgen.org/index_content.html, ISBN:0781735149] subset: human_reference_atlas synonym: "CD4-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "CD4-positive, alpha-beta memory T-cell" EXACT [] synonym: "CD4-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "T4.Mem.Sp" RELATED [] is_a: CL:0000624 ! CD4-positive, alpha-beta T cell is_a: CL:0000813 ! memory T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: bearer_of PATO:0001603 ! increased life span intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response intersection_of: has_completed GO:0043379 ! memory T cell differentiation relationship: dc-contributor https://orcid.org/0000-0001-9990-8331 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000898 name: naive T cell def: "Mature T cell not yet exposed to antigen with the phenotype CCR7-positive, CD45RA-positive, and CD127-positive. This cell type is also described as being CD25-negative, CD62L-high and CD44-low." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19100699] synonym: "naive T lymphocyte" EXACT [] synonym: "naive T-cell" EXACT [] synonym: "naive T-lymphocyte" EXACT [] is_a: CL:0002419 {is_inferred="true"} ! mature T cell intersection_of: CL:0002419 ! mature T cell intersection_of: has_completed GO:0045058 ! T cell selection intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha intersection_of: RO:0015015 PR:000001318 ! has high plasma membrane amount L-selectin intersection_of: RO:0015016 PR:000001307 ! has low plasma membrane amount CD44 molecule relationship: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 relationship: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha relationship: RO:0015015 PR:000001318 ! has high plasma membrane amount L-selectin relationship: RO:0015016 PR:000001307 ! has low plasma membrane amount CD44 molecule [Term] id: CL:0000899 name: T-helper 17 cell def: "CD4-positive, alpha-beta T cell with the phenotype RORgamma-t-positive, CXCR3-negative, CCR6-positive, and capable of producing IL-17." [GO_REF:0000031, GOC:add, GOC:pam, PMID:20303875, PMID:20969597, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'Th17 CD4+ T cell', but its logical definition includes additional known characteristics of T-helper 17 T cells. subset: human_reference_atlas synonym: "helper T cell type 17" EXACT [] synonym: "IL-17-producing CD4+ T helper" EXACT [] synonym: "T helper cells type 17" EXACT [] synonym: "T(H)-17 cell" EXACT [] synonym: "Th17 CD4+ T cell" EXACT [PMID:22343568] synonym: "Th17 cell" EXACT [] synonym: "Th17 T cell" EXACT [] synonym: "Th17 T lymphocyte" EXACT [] synonym: "Th17 T-cell" EXACT [] synonym: "Th17 T-lymphocyte" EXACT [] xref: MESH:D058504 is_a: CL:0000492 {is_inferred="true"} ! CD4-positive helper T cell intersection_of: CL:0000492 ! CD4-positive helper T cell intersection_of: capable_of GO:0032620 ! interleukin-17 production intersection_of: has_part PR:000003455 ! nuclear receptor ROR-gamma isoform 2 intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3 intersection_of: RO:0002104 PR:000001202 ! has plasma membrane part C-C chemokine receptor type 6 relationship: capable_of GO:0032620 ! interleukin-17 production relationship: has_part PR:000003455 ! nuclear receptor ROR-gamma isoform 2 relationship: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001202 ! has plasma membrane part C-C chemokine receptor type 6 [Term] id: CL:0000900 name: naive thymus-derived CD8-positive, alpha-beta T cell def: "A CD8-positive, alpha-beta T cell that has not experienced activation via antigen contact and has the phenotype CD45RA-positive, CCR7-positive and CD127-positive. This cell type is also described as being CD25-negative, CD62L-high and CD44-low." [GO_REF:0000031, GOC:add, GOC:tfm, http://www.immgen.org/index_content.html, ISBN:0781735149, PMID:22343568] comment: This cell traffics in secondary lymphoid organs and blood. This cell type is compatible with the HIPC Lyoplate markers for 'naive CD8+ T cell', but includes additional markers known to be expressed on naive CD8+ T cells. subset: human_reference_atlas synonym: "naive CD8+ T cell" BROAD [PMID:22343568] synonym: "naive thymus-dervied CD8-positive, alpha-beta T lymphocyte" EXACT [] synonym: "naive thymus-dervied CD8-positive, alpha-beta T-cell" EXACT [] synonym: "naive thymus-dervied CD8-positive, alpha-beta T-lymphocyte" EXACT [] synonym: "T.8Nve.Sp" NARROW [] is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell is_a: CL:0000898 ! naive T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: RO:0002104 PR:000001015 ! has plasma membrane part receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 intersection_of: RO:0002104 PR:000001869 ! has plasma membrane part interleukin-7 receptor subunit alpha intersection_of: RO:0015015 PR:000001318 ! has high plasma membrane amount L-selectin intersection_of: RO:0015016 PR:000001307 ! has low plasma membrane amount CD44 molecule relationship: develops_from CL:0002437 ! mature CD8 single-positive thymocyte relationship: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000901 name: Tr1 cell def: "CD4-positive alpha-beta T cell with regulatory function that produces IL-10." [GO_REF:0000031, GOC:add, GOC:pam, PMID:16903904] comment: These cells are reportedly induced by IL-10 and are capable of producing IFN-gamma, IL-5, IL-10, and TGF-beta.) synonym: "T-regulatory T cell type 1" EXACT [] synonym: "Tr1 T cell" EXACT [] synonym: "Tr1 T lymphocyte" EXACT [] synonym: "Tr1 T-cell" EXACT [] synonym: "Tr1 T-lymphocyte" EXACT [] is_a: CL:0000492 ! CD4-positive helper T cell is_a: CL:0000815 ! regulatory T cell intersection_of: CL:0000624 ! CD4-positive, alpha-beta T cell intersection_of: capable_of GO:0032613 ! interleukin-10 production intersection_of: capable_of GO:0050777 ! negative regulation of immune response relationship: capable_of GO:0032613 ! interleukin-10 production [Term] id: CL:0000902 name: induced T-regulatory cell def: "CD4-positive alpha-beta T cell with the phenotype CD25-positive, CTLA-4-positive, and FoxP3-positive with regulatory function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19464985] synonym: "adaptive Treg" RELATED [] synonym: "aTreg" RELATED [] synonym: "induced regulatory T cell" EXACT [] synonym: "induced regulatory T lymphocyte" EXACT [] synonym: "induced regulatory T-cell" EXACT [] synonym: "induced regulatory T-lymphocyte" EXACT [] synonym: "induced Treg" EXACT [] synonym: "iTreg" EXACT [] is_a: CL:0000792 {is_inferred="true"} ! CD4-positive, CD25-positive, alpha-beta regulatory T cell intersection_of: CL:0000792 ! CD4-positive, CD25-positive, alpha-beta regulatory T cell intersection_of: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell intersection_of: has_part PR:000001350 ! forkhead box protein P3 intersection_of: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4 relationship: develops_from CL:0000896 ! activated CD4-positive, alpha-beta T cell relationship: has_part PR:000001350 ! forkhead box protein P3 relationship: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4 [Term] id: CL:0000903 name: natural T-regulatory cell def: "CD4-positive alpha-beta T cell with the phenotype FoxP3-positive, CD25-positive, CD62L-positive, and CTLA-4 positive with regulatory function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19464985] synonym: "natural regulatory T cell" EXACT [] synonym: "natural regulatory T lymphocyte" EXACT [] synonym: "natural regulatory T-cell" EXACT [] synonym: "natural regulatory T-lymphocyte" EXACT [] synonym: "natural Treg" EXACT [] synonym: "nTreg" EXACT [] is_a: CL:0000792 {is_inferred="true"} ! CD4-positive, CD25-positive, alpha-beta regulatory T cell intersection_of: CL:0000792 ! CD4-positive, CD25-positive, alpha-beta regulatory T cell intersection_of: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte intersection_of: has_part PR:000001350 ! forkhead box protein P3 intersection_of: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin intersection_of: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4 relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte relationship: has_part PR:000001350 ! forkhead box protein P3 relationship: RO:0002104 PR:000001318 ! has plasma membrane part L-selectin relationship: RO:0002104 PR:000001852 ! has plasma membrane part cytotoxic T-lymphocyte protein 4 [Term] id: CL:0000904 name: central memory CD4-positive, alpha-beta T cell def: "CD4-positive, alpha-beta memory T cell with the phenotype CCR7-positive, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'central memory CD4+ T cell', but includes additional markers known to be expressed on central memory CD4+ T cells. synonym: "central CD4-positive, alpha-beta memory T cell" EXACT [] synonym: "central CD4-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "central CD4-positive, alpha-beta memory T-cell" EXACT [] synonym: "central CD4-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "central memory CD4+ T cell" BROAD [PMID:22343568] synonym: "central memory CD4-positive, alpha-beta T lymphocyte" EXACT [] synonym: "central memory CD4-positive, alpha-beta T-cell" EXACT [] synonym: "central memory CD4-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0001204 {is_inferred="true"} ! CD4-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: CL:0001204 ! CD4-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 [Term] id: CL:0000905 name: effector memory CD4-positive, alpha-beta T cell def: "CD4-positive, alpha-beta memory T cell with the phenotype CCR7-negative, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'effector memory CD4+ T cell', but includes additional markers known to be expressed on effector memory CD4+ T cells. subset: human_reference_atlas synonym: "effector CD4-positive, alpha-beta memory T cell" EXACT [] synonym: "effector CD4-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "effector CD4-positive, alpha-beta memory T-cell" EXACT [] synonym: "effector CD4-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "effector memory CD4+ T cell" BROAD [PMID:22343568] synonym: "effector memory CD4-positive, alpha-beta T lymphocyte" EXACT [] synonym: "effector memory CD4-positive, alpha-beta T-cell" EXACT [] synonym: "effector memory CD4-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0001204 {is_inferred="true"} ! CD4-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: CL:0001204 ! CD4-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000906 name: activated CD8-positive, alpha-beta T cell def: "A CD8-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, CD25-positive, and CCR7-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm] synonym: "activated CD8-positive, alpha-beta T lymphocyte" EXACT [] synonym: "activated CD8-positive, alpha-beta T-cell" EXACT [] synonym: "activated CD8-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: develops_from CL:0000900 ! naive thymus-derived CD8-positive, alpha-beta T cell relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000907 name: central memory CD8-positive, alpha-beta T cell def: "CD8-positive, alpha-beta memory T cell with the phenotype CCR7-positive, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:20146720, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'central memory CD8+ T cell', but includes additional markers known to be expressed on central memory CD8+ T cells. synonym: "central CD8-positive, alpha-beta memory T cell" EXACT [] synonym: "central CD8-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "central CD8-positive, alpha-beta memory T-cell" EXACT [] synonym: "central CD8-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "central memory CD8+ T cell" BROAD [PMID:22343568] synonym: "central memory CD8-positive, alpha-beta T lymphocyte" EXACT [] synonym: "central memory CD8-positive, alpha-beta T-cell" EXACT [] synonym: "central memory CD8-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0001203 {is_inferred="true"} ! CD8-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: CL:0001203 ! CD8-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha intersection_of: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: RO:0002104 PR:000001203 ! has plasma membrane part C-C chemokine receptor type 7 [Term] id: CL:0000908 name: CD8-positive, alpha-beta cytokine secreting effector T cell def: "A CD8-positive, alpha-beta T cell with the phenotype CD69-positive, CD62L-negative, CD127-negative, and CD25-positive, that secretes cytokines." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:20146720] synonym: "CD8-positive, alpha-beta cytokine secreting effector T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta cytokine secreting effector T-cell" EXACT [] synonym: "CD8-positive, alpha-beta cytokine secreting effector T-lymphocyte" EXACT [] is_a: CL:0000625 {is_inferred="true"} ! CD8-positive, alpha-beta T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: capable_of GO:0001816 ! cytokine production intersection_of: has_completed GO:0030217 ! T cell differentiation intersection_of: lacks_plasma_membrane_part PR:000001318 ! L-selectin intersection_of: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: capable_of GO:0001816 ! cytokine production relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell relationship: has_completed GO:0030217 ! T cell differentiation relationship: lacks_plasma_membrane_part PR:000001318 ! L-selectin relationship: lacks_plasma_membrane_part PR:000001869 ! interleukin-7 receptor subunit alpha relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000909 name: CD8-positive, alpha-beta memory T cell def: "A CD8-positive, alpha-beta T cell that has differentiated into a memory T cell." [GOC:add, PMID:20146720] subset: human_reference_atlas synonym: "CD8-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "CD8-positive, alpha-beta memory T-cell" EXACT [] synonym: "CD8-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "T.8Mem.Sp" RELATED [] is_a: CL:0000625 ! CD8-positive, alpha-beta T cell is_a: CL:0000813 ! memory T cell intersection_of: CL:0000625 ! CD8-positive, alpha-beta T cell intersection_of: bearer_of PATO:0001603 ! increased life span intersection_of: has_completed GO:0002286 ! T cell activation involved in immune response intersection_of: has_completed GO:0043379 ! memory T cell differentiation relationship: dc-contributor https://orcid.org/0000-0001-9990-8331 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000910 name: cytotoxic T cell def: "A mature T cell that differentiated and acquired cytotoxic function with the phenotype perforin-positive and granzyme-B positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18395547] subset: human_reference_atlas synonym: "cytotoxic T lymphocyte" EXACT [] synonym: "cytotoxic T-cell" EXACT [] synonym: "cytotoxic T-lymphocyte" EXACT [] xref: BTO:0000289 xref: CALOHA:TS-0190 xref: FMA:70573 is_a: CL:0000911 {is_inferred="true"} ! effector T cell intersection_of: CL:0000911 ! effector T cell intersection_of: capable_of GO:0001913 ! T cell mediated cytotoxicity relationship: capable_of GO:0001913 ! T cell mediated cytotoxicity relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000911 name: effector T cell def: "A differentiated T cell with ability to traffic to peripheral tissues and is capable of mounting a specific immune response." [GOC:PAM-ADD, GOC:tfm, ISBN:0877799148, PMID:18395547] synonym: "effector T lymphocyte" EXACT [] synonym: "effector T-cell" EXACT [] synonym: "effector T-lymphocyte" EXACT [] is_a: CL:0002419 {is_inferred="true"} ! mature T cell intersection_of: CL:0002419 ! mature T cell intersection_of: bearer_of PATO:0045026 ! normal life span intersection_of: has_completed GO:0030217 ! T cell differentiation intersection_of: has_completed GO:0045058 ! T cell selection relationship: bearer_of PATO:0045026 ! normal life span relationship: has_completed GO:0030217 ! T cell differentiation [Term] id: CL:0000912 name: helper T cell def: "A effector T cell that provides help in the form of secreted cytokines to other immune cells." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18395547] synonym: "helper T lymphocyte" EXACT [] synonym: "helper T-cell" EXACT [] synonym: "helper T-lymphocyte" EXACT [] synonym: "T-helper cell" EXACT [] xref: BTO:0002417 xref: MESH:D006377 is_a: CL:0000911 {is_inferred="true"} ! effector T cell intersection_of: CL:0000911 ! effector T cell intersection_of: capable_of GO:0001816 ! cytokine production relationship: capable_of GO:0001816 ! cytokine production [Term] id: CL:0000913 name: effector memory CD8-positive, alpha-beta T cell def: "CD8-positive, alpha-beta memory T cell with the phenotype CCR7-negative, CD127-positive, CD45RA-negative, CD45RO-positive, and CD25-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:20146720, PMID:22343568] comment: This cell type is compatible with the HIPC Lyoplate markers for 'effector memory CD8+ T cell', but includes additional markers known to be expressed on effector memory CD8+ T cells. subset: human_reference_atlas synonym: "effector CD8-positive, alpha-beta memory T cell" EXACT [] synonym: "effector CD8-positive, alpha-beta memory T lymphocyte" EXACT [] synonym: "effector CD8-positive, alpha-beta memory T-cell" EXACT [] synonym: "effector CD8-positive, alpha-beta memory T-lymphocyte" EXACT [] synonym: "effector memory CD8+ T cell" BROAD [PMID:22343568] synonym: "effector memory CD8-positive, alpha-beta T lymphocyte" EXACT [] synonym: "effector memory CD8-positive, alpha-beta T-cell" EXACT [] synonym: "effector memory CD8-positive, alpha-beta T-lymphocyte" EXACT [] is_a: CL:0001203 {is_inferred="true"} ! CD8-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: CL:0001203 ! CD8-positive, alpha-beta memory T cell, CD45RO-positive intersection_of: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA intersection_of: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 intersection_of: lacks_plasma_membrane_part PR:000001380 ! interleukin-2 receptor subunit alpha relationship: lacks_plasma_membrane_part PR:000001015 ! receptor-type tyrosine-protein phosphatase C isoform CD45RA relationship: lacks_plasma_membrane_part PR:000001203 ! C-C chemokine receptor type 7 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000914 name: immature NK T cell def: "An immature alpha-beta T-cell that express Egr2. These cells give rise to T cells expressing NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17589542, PMID:19169262] subset: human_reference_atlas synonym: "immature NK T lymphocyte" EXACT [] synonym: "immature NK T-cell" EXACT [] synonym: "immature NK T-lymphocyte" EXACT [] synonym: "immature NKT cell" EXACT [] is_a: CL:0000790 {is_inferred="true"} ! immature alpha-beta T cell intersection_of: CL:0000790 ! immature alpha-beta T cell intersection_of: has_part PR:000003469 ! early growth response protein 2 relationship: develops_from CL:0000809 ! double-positive, alpha-beta thymocyte relationship: has_part PR:000003469 ! early growth response protein 2 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000915 name: CD8-alpha-alpha-positive, alpha-beta intraepithelial T cell def: "An alpha-beta intraepithelial T cell with the phenotype CD8-alpha-alpha-positive located in the columnar epithelium of the gastrointestinal tract. These cells have a memory phenotype of CD2-negative and CD5-negative." [GO_REF:0000031, GOC:add, GOC:pam, PMID:11685222] subset: human_reference_atlas synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T lymphocyte" EXACT [] synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T-cell" EXACT [] synonym: "CD8-alpha-alpha-positive, alpha-beta intraepithelial T-lymphocyte" EXACT [] is_a: CL:0000797 {is_inferred="true"} ! alpha-beta intraepithelial T cell intersection_of: CL:0000797 ! alpha-beta intraepithelial T cell intersection_of: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule intersection_of: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 intersection_of: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain relationship: develops_from CL:0000811 ! CD8-positive, alpha-beta thymocyte relationship: lacks_plasma_membrane_part PR:000001083 ! CD2 molecule relationship: lacks_plasma_membrane_part PR:000001839 ! T-cell surface glycoprotein CD5 relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens relationship: RO:0002104 PR:000001084 ! has plasma membrane part T-cell surface glycoprotein CD8 alpha chain [Term] id: CL:0000916 name: dendritic epidermal T cell def: "A mature gamma-delta T cell located in the epidermis that regulates wound healing." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:11976459] comment: In mice, DETC have an invariant T cell receptor. synonym: "dendritic epidermal T lymphocyte" EXACT [] synonym: "dendritic epidermal T-cell" EXACT [] synonym: "dendritic epidermal T-lymphocyte" EXACT [] synonym: "DETC" EXACT [] is_a: CL:0000800 {is_inferred="true"} ! mature gamma-delta T cell intersection_of: CL:0000800 ! mature gamma-delta T cell intersection_of: capable_of GO:0060054 ! positive regulation of epithelial cell proliferation involved in wound healing intersection_of: located_in UBERON:0001003 ! skin epidermis relationship: capable_of GO:0060054 ! positive regulation of epithelial cell proliferation involved in wound healing relationship: develops_from CL:0002401 ! mature dendritic epithelial T cell precursor relationship: located_in UBERON:0001003 ! skin epidermis [Term] id: CL:0000917 name: Tc1 cell def: "A CD8-positive, alpha-beta positive T cell that has the phenotype T-bet-positive, eomesodermin-positive, CXCR3-positive, CCR6-negative, and is capable of producing interferon-gamma." [GO_REF:0000031, GOC:add, GOC:pam, PMID:22343568, PMID:9914231] comment: This cell type is compatible with the HIPC Lyoplate markers for 'Tc1 CD8+ T cell', but its logical definition includes additional known characteristics of Tc1 T cells. synonym: "CD8-positive Th1 cell" EXACT [] synonym: "T-cytotoxic T cell type 1" EXACT [] synonym: "Tc1 CD8+ T cell" EXACT [PMID:22343568] synonym: "Tc1 T cell" EXACT [] synonym: "Tc1 T lymphocyte" EXACT [] synonym: "Tc1 T-cell" EXACT [] synonym: "Tc1 T-lymphocyte" EXACT [] synonym: "Th1 CD8-positive T cell" EXACT [] synonym: "Th1 non-TFH CD8-positive T cell" EXACT [] xref: BTO:0004793 xref: BTO:0004888 xref: FMA:84793 is_a: CL:0000908 {is_inferred="true"} ! CD8-positive, alpha-beta cytokine secreting effector T cell intersection_of: CL:0000908 ! CD8-positive, alpha-beta cytokine secreting effector T cell intersection_of: capable_of GO:0032609 ! type II interferon production intersection_of: has_part PR:000001835 ! T-box transcription factor TBX21 intersection_of: has_part PR:000003463 ! eomesodermin intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 intersection_of: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3 relationship: capable_of GO:0032609 ! type II interferon production relationship: has_part PR:000001835 ! T-box transcription factor TBX21 relationship: has_part PR:000003463 ! eomesodermin relationship: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 relationship: RO:0002104 PR:000001207 ! has plasma membrane part C-X-C chemokine receptor type 3 [Term] id: CL:0000918 name: Tc2 cell def: "A CD8-positive, alpha-beta positive T cell expressing GATA-3 and secreting IL-4." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:9914231] comment: This cell type is compatible with the HIPC Lyoplate markers for 'non-Tc1/Tc17 CD8+ T cell' (see CL:0001052), but includes the additional necessary and sufficient conditions to allow classification as a Tc2 T cell. synonym: "CD8-positive Th2 cell" EXACT [] synonym: "T-cytotoxic T cell type 2" EXACT [] synonym: "Tc2 T cell" EXACT [] synonym: "Tc2 T lymphocyte" EXACT [] synonym: "Tc2 T-cell" EXACT [] synonym: "Tc2 T-lymphocyte" EXACT [] synonym: "Th2 CD8-positive T cell" EXACT [] synonym: "Th2 non-TFH CD8-positive T cell" EXACT [] xref: BTO:0004794 xref: FMA:84794 is_a: CL:0000908 {is_inferred="true"} ! CD8-positive, alpha-beta cytokine secreting effector T cell is_a: CL:0001052 ! CD8-positive, CXCR3-negative, CCR6-negative, alpha-beta T cell intersection_of: CL:0000908 ! CD8-positive, alpha-beta cytokine secreting effector T cell intersection_of: capable_of GO:0032633 ! interleukin-4 production intersection_of: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3 intersection_of: lacks_plasma_membrane_part PR:000001202 ! C-C chemokine receptor type 6 intersection_of: lacks_plasma_membrane_part PR:000001207 ! C-X-C chemokine receptor type 3 relationship: capable_of GO:0032633 ! interleukin-4 production relationship: has_part PR:000001941 ! trans-acting T-cell-specific transcription factor GATA-3 [Term] id: CL:0000919 name: CD8-positive, CD25-positive, alpha-beta regulatory T cell def: "A CD8-positive alpha beta-positive T cell with the phenotype FoxP3-positive and having suppressor function." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19118505] synonym: "CD8+CD25+ T cell" EXACT [] synonym: "CD8+CD25+ T lymphocyte" EXACT [] synonym: "CD8+CD25+ T(reg)" EXACT [] synonym: "CD8+CD25+ T-cell" EXACT [] synonym: "CD8+CD25+ T-lymphocyte" EXACT [] synonym: "CD8+CD25+ Treg" EXACT [] synonym: "CD8-positive, CD25-positive Treg" EXACT [] synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T lymphocyte" EXACT [] synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T-cell" EXACT [] synonym: "CD8-positive, CD25-positive, alpha-beta regulatory T-lymphocyte" EXACT [] is_a: CL:0000795 {is_inferred="true"} ! CD8-positive, alpha-beta regulatory T cell intersection_of: CL:0000795 ! CD8-positive, alpha-beta regulatory T cell intersection_of: has_part PR:000001350 ! forkhead box protein P3 intersection_of: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell relationship: has_part PR:000001350 ! forkhead box protein P3 relationship: RO:0002104 PR:000001380 ! has plasma membrane part interleukin-2 receptor subunit alpha [Term] id: CL:0000920 name: CD8-positive, CD28-negative, alpha-beta regulatory T cell def: "CD8-positive, alpha-beta positive regulatory T cell with the phenotype CD28-negative and FoxP3-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:19118505] synonym: "CD8+CD28- T cell" EXACT [] synonym: "CD8+CD28- T lymphocyte" EXACT [] synonym: "CD8+CD28- T(reg)" EXACT [] synonym: "CD8+CD28- T-cell" EXACT [] synonym: "CD8+CD28- T-lymphocyte" EXACT [] synonym: "CD8+CD28- Treg" EXACT [] synonym: "CD8-positive, CD28-negative T(reg)" EXACT [] synonym: "CD8-positive, CD28-negative Treg" EXACT [] synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T lymphocyte" EXACT [] synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T-cell" EXACT [] synonym: "CD8-positive, CD28-negative, alpha-beta regulatory T-lymphocyte" EXACT [] is_a: CL:0000795 {is_inferred="true"} ! CD8-positive, alpha-beta regulatory T cell intersection_of: CL:0000795 ! CD8-positive, alpha-beta regulatory T cell intersection_of: has_part PR:000001350 ! forkhead box protein P3 intersection_of: lacks_plasma_membrane_part PR:000001841 ! T-cell-specific surface glycoprotein CD28 relationship: develops_from CL:0000906 ! activated CD8-positive, alpha-beta T cell relationship: has_part PR:000001350 ! forkhead box protein P3 relationship: lacks_plasma_membrane_part PR:000001841 ! T-cell-specific surface glycoprotein CD28 [Term] id: CL:0000921 name: type I NK T cell def: "An alpha-beta T cell expressing NK cell markers that is CD1d restricted and expresses specific V-alpha chains. NK T cells of this type recognize the glycolipid alpha-galactosylceramide in the context of CD1d." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:15039760] comment: In mouse the canonical TCR is V-alpha-14, and in humans it is V-alpha 24. subset: human_reference_atlas synonym: "classical NK T cell" EXACT [] synonym: "invariant NK T cell" RELATED [] synonym: "type I NK T lymphocyte" EXACT [] synonym: "type I NK T-cell" EXACT [] synonym: "type I NK T-lymphocyte" EXACT [] synonym: "type I NKT cell" EXACT [] is_a: CL:0000814 {is_inferred="true"} ! mature NK T cell intersection_of: CL:0000814 ! mature NK T cell intersection_of: capable_of GO:0043208 ! glycosphingolipid binding relationship: capable_of GO:0043208 ! glycosphingolipid binding relationship: present_in_taxon NCBITaxon:9606 ! Homo sapiens [Term] id: CL:0000922 name: type II NK T cell def: "An alpha-beta T cell expressing NK call markers that is CD1d restricted and expresses a diverse TCR repertoire. Type II NKT cells do not become activated by alpha-galactosylceramide when presented by CD1d." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:15039760] synonym: "type II NK T lymphocyte" EXACT [] synonym: "type II NK T-cell" EXACT [] synonym: "type II NK T-lymphocyte" EXACT [] synonym: "type II NKT cell" EXACT [] is_a: CL:0000814 {is_inferred="true"} ! mature NK T cell intersection_of: CL:0000814 ! mature NK T cell intersection_of: capable_of GO:0002288 ! NK T cell activation involved in immune response relationship: capable_of GO:0002288 ! NK T cell activation involved in immune response [Term] id: CL:0000923 name: CD4-positive type I NK T cell def: "A type I NK T cell that has the phenotype CD4-positive." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398] synonym: "CD4-positive type I NK T lymphocyte" EXACT [] synonym: "CD4-positive type I NK T-cell" EXACT [] synonym: "CD4-positive type I NK T-lymphocyte" EXACT [] synonym: "CD4-positive type I NKT cell" EXACT [] synonym: "NKT.4+.SP" NARROW [] is_a: CL:0000921 {is_inferred="true"} ! type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule relationship: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule [Term] id: CL:0000924 name: CD4-negative, CD8-negative type I NK T cell def: "A type I NK T cell that has the phenotype CD4-negative and CD8-negative." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:18997862] synonym: "CD4-negative, CD8-negative type I NK T lymphocyte" EXACT [] synonym: "CD4-negative, CD8-negative type I NK T-cell" EXACT [] synonym: "CD4-negative, CD8-negative type I NK T-lymphocyte" EXACT [] synonym: "CD4-negative, CD8-negative type I NKT cell" EXACT [] synonym: "NKT.4-.Sp" NARROW [] is_a: CL:0000921 {is_inferred="true"} ! type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain relationship: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule relationship: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain [Term] id: CL:0000925 name: activated CD4-positive type I NK T cell def: "A type I NK T cell that has been recently activated, secretes interferon-gamma and IL-4, and has the phenotype CD4-positive, CD69-positive, and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398] synonym: "activated CD4-positive type I NK T lymphocyte" EXACT [] synonym: "activated CD4-positive type I NK T-cell" EXACT [] synonym: "activated CD4-positive type I NK T-lymphocyte" EXACT [] synonym: "activated CD4-positive type I NKT cell" EXACT [] is_a: CL:0000923 ! CD4-positive type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: capable_of GO:0032609 ! type II interferon production intersection_of: capable_of GO:0032633 ! interleukin-4 production intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: capable_of GO:0032609 ! type II interferon production relationship: capable_of GO:0032633 ! interleukin-4 production relationship: develops_from CL:0000923 ! CD4-positive type I NK T cell relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule [Term] id: CL:0000926 name: CD4-positive type I NK T cell secreting interferon-gamma def: "A mature NK T cell that secretes interferon-gamma and enhances type 1 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398] synonym: "CD4-positive type I NK T cell secreting IFN-gamma" EXACT [] synonym: "CD4-positive type I NK T lymphocyte secreting interferon-gamma" EXACT [] synonym: "CD4-positive type I NK T-cell secreting interferon-gamma" EXACT [] synonym: "CD4-positive type I NK T-lymphocyte secreting interferon-gamma" EXACT [] synonym: "CD4-positive type I NKT cell secreting interferon-gamma" EXACT [] is_a: CL:0000923 ! CD4-positive type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response intersection_of: capable_of GO:0032609 ! type II interferon production intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule relationship: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune response relationship: capable_of GO:0032609 ! type II interferon production relationship: develops_from CL:0000925 ! activated CD4-positive type I NK T cell [Term] id: CL:0000927 name: CD4-positive type I NK T cell secreting interleukin-4 def: "A mature NK T cell that predominantly secretes type 2 cytokines such as interleukin-4 and interleukin-13 and enhances type 2 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm] synonym: "CD4-positive type I NK T cell secreting IL-4" EXACT [] synonym: "CD4-positive type I NK T lymphocyte secreting interleukin-4" EXACT [] synonym: "CD4-positive type I NK T-cell secreting interleukin-4" EXACT [] synonym: "CD4-positive type I NK T-lymphocyte secreting interleukin-4" EXACT [] synonym: "CD4-positive type I NKT cell secreting interleukin-4" EXACT [] is_a: CL:0000923 ! CD4-positive type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: capable_of GO:0002830 ! positive regulation of type 2 immune response intersection_of: capable_of GO:0032616 ! interleukin-13 production intersection_of: capable_of GO:0032633 ! interleukin-4 production intersection_of: RO:0002104 PR:000001004 ! has plasma membrane part CD4 molecule relationship: capable_of GO:0002830 ! positive regulation of type 2 immune response relationship: capable_of GO:0032616 ! interleukin-13 production relationship: capable_of GO:0032633 ! interleukin-4 production relationship: develops_from CL:0000925 ! activated CD4-positive type I NK T cell [Term] id: CL:0000928 name: activated CD4-negative, CD8-negative type I NK T cell def: "A type I NK T cell that has been recently activated, secretes interferon-gamma and interleukin-4, and has phenotype CD4-negative, CD8-negative, CD69-positive, and downregulated NK markers." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398] synonym: "activated CD4-negative, CD8-negative type I NK T lymphocyte" EXACT [] synonym: "activated CD4-negative, CD8-negative type I NK T-cell" EXACT [] synonym: "activated CD4-negative, CD8-negative type I NK T-lymphocyte" EXACT [] synonym: "activated CD4-negative, CD8-negative type I NKT cell" EXACT [] is_a: CL:0000924 ! CD4-negative, CD8-negative type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: capable_of GO:0002369 ! T cell cytokine production intersection_of: lacks_plasma_membrane_part PR:000001004 ! CD4 molecule intersection_of: lacks_plasma_membrane_part PR:000001084 ! T-cell surface glycoprotein CD8 alpha chain intersection_of: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule relationship: capable_of GO:0002369 ! T cell cytokine production relationship: develops_from CL:0000924 ! CD4-negative, CD8-negative type I NK T cell relationship: RO:0002104 PR:000001343 ! has plasma membrane part CD69 molecule [Term] id: CL:0000929 name: CD4-negative, CD8-negative type I NK T cell secreting interferon-gamma def: "A mature NK T cell that secretes interferon-gamma and enhances Th1 immune responses." [GO_REF:0000031, GOC:add, GOC:pam, GOC:tfm, PMID:17303398] synonym: "CD4-negative, CD8-negative type I NK T cell secreting IFN-gamma" EXACT [] synonym: "CD4-negative, CD8-negative type I NK T lymphocyte secreting interferon-gamma" EXACT [] synonym: "CD4-negative, CD8-negative type I NK T-cell secreting interferon-gamma" EXACT [] synonym: "CD4-negative, CD8-negative type I NK T-lymphocyte secreting interferon-gamma" EXACT [] synonym: "CD4-negative, CD8-negative type I NKT cell secreting interferon-gamma" EXACT [] is_a: CL:0000924 ! CD4-negative, CD8-negative type I NK T cell intersection_of: CL:0000921 ! type I NK T cell intersection_of: capable_of GO:0002827 ! positive regulation of T-helper 1 type immune re