# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.2 (Nov 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  /Net/Groups/ccdata/projects/xx
# target sequence database:        /Net/Groups/ccdata/projects/xx.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PTHR11876.orig.30.pir  [M=94]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.15   14.0   3.0       0.18   13.7   3.0    1.2  1  BAONEE_28565  hypothetical protein
          2   10.3  11.4         12    7.8   4.0    2.4  2  BAONEE_39570  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_28565  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.7   3.0   9.7e-06      0.18      42      86 ..      28      77 ..      13      85 .. 0.80

  Alignments for each domain:
  == domain 1  score: 13.7 bits;  conditional E-value: 9.7e-06
  PTHR11876.orig.30.pir 42 vsvsfeedegsalqkas.esrrrltc.ycrrr..scirrerlygtCr.rr 86
                           +s+s +ed +++ +++   srr+  c  crrr  +c +++  +g Cr + 
           BAONEE_28565 28 RSESQQEDDRPNKKAKTwPSRRKPACqTCRRRkvRCDNGQPACGFCRaNE 77
                           5778888888888885569999999999999988999*********9643 PP

>> BAONEE_39570  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.8    0.0016        29      27      62 ..      98     131 ..      87     159 .. 0.65
   2 ?    7.8   4.0   0.00068        12      15      54 ..     351     388 ..     343     413 .. 0.59

  Alignments for each domain:
  == domain 1  score: 6.6 bits;  conditional E-value: 0.0016
  PTHR11876.orig.30.pir  27 deapteeqpgeedqdvsvsfeedegsalqk.asesrr 62 
                            ++ + ee+++eed d ++ +++++    qk ++   r
           BAONEE_39570  98 EDEEDEEEEEEEDDDEDEILGDEKPLGYQKgDR---R 131
                            233455566666666666777777777777332...2 PP

  == domain 2  score: 7.8 bits;  conditional E-value: 0.00068
  PTHR11876.orig.30.pir  15 lqvqAepiqetddeapteeqpgeedqdvsvsfeedegsal 54 
                            ++++Aep  +  +e + ee++geed++ + + e + +++ 
           BAONEE_39570 351 VHANAEPAGD--EEEEEEEEEGEEDEEEDSDTEMQAAPEN 388
                            5777776665..4444555556666665555555555443 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (94 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1654  (0.0452791); expected 730.6 (0.02)
Passed bias filter:                     1273  (0.034849); expected 730.6 (0.02)
Passed Vit filter:                       185  (0.00506447); expected 36.5 (0.001)
Passed Fwd filter:                        28  (0.000766514); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.14u 0.01s 00:00:00.15 Elapsed: 00:00:00.06
# Mc/sec: 7801.37
//
Query:       Bacteriocin_II  [M=35]
Accession:   PF01721.22
Description: Class II bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.041   14.7   0.0      0.062   14.1   0.0    1.3  1  BAONEE_137835  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_137835  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.1   0.0   1.7e-06     0.062      11      32 ..       5      26 ..       4      28 .. 0.87

  Alignments for each domain:
  == domain 1  score: 14.1 bits;  conditional E-value: 1.7e-06
  Bacteriocin_II 11 kkkCwVDWgqaitsivnnvaag 32
                    k+ C+VDW  ++++i + +++g
   BAONEE_137835  5 KYLCSVDWTITAQQIPHLLIEG 26
                    667************9988876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (35 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       672  (0.0183963); expected 730.6 (0.02)
Passed bias filter:                      487  (0.0133319); expected 730.6 (0.02)
Passed Vit filter:                        24  (0.000657012); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 7223.53
//
Query:       FSAP_sig_propep  [M=42]
Accession:   PF03032.19
Description: Frog skin active peptide family signal and propeptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (42 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1004  (0.027485); expected 730.6 (0.02)
Passed bias filter:                      808  (0.0221194); expected 730.6 (0.02)
Passed Vit filter:                        52  (0.00142353); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 9004.28
//
Query:       Cyclotide  [M=30]
Accession:   PF03784.17
Description: Cyclotide family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (30 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1566  (0.04287); expected 730.6 (0.02)
Passed bias filter:                      770  (0.0210791); expected 730.6 (0.02)
Passed Vit filter:                        44  (0.00120452); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6700.31
//
Query:       Lactococcin  [M=48]
Accession:   PF04369.17
Description: Lactococcin-like family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
        1.1   10.4   2.7       0.66   11.1   0.2    2.0  2  BAONEE_85280  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_85280  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.1   0.2   1.8e-05      0.66       1      21 [.      90     108 ..      90     118 .. 0.89
   2 ?   -3.2   0.2      0.52   1.9e+04      22      27 ..     303     308 ..     300     309 .. 0.85

  Alignments for each domain:
  == domain 1  score: 11.1 bits;  conditional E-value: 1.8e-05
   Lactococcin   1 sDsGyWtnmMenqlNfeIlSd 21 
                   s+sGyWt+   +   +e++Sd
  BAONEE_85280  90 SESGYWTDA--SDYGYETVSD 108
                   79*******..*********8 PP

  == domain 2  score: -3.2 bits;  conditional E-value: 0.52
   Lactococcin  22 EeLStv 27 
                   EeL+++
  BAONEE_85280 303 EELTEL 308
                   9***97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (48 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       542  (0.0148375); expected 730.6 (0.02)
Passed bias filter:                      476  (0.0130307); expected 730.6 (0.02)
Passed Vit filter:                        27  (0.000739139); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 10760.31
//
Query:       Delta_lysin  [M=25]
Accession:   PF05372.15
Description: Delta lysin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.23   11.8   0.6        1.8    8.9   0.2    2.2  2  BAONEE_38915   hypothetical protein
       0.38   11.1   0.0       0.56   10.5   0.0    1.3  1  BAONEE_162435  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_38915  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.2   9.9e-05       1.8       9      16 ..     167     174 ..     165     175 .. 0.94
   2 ?    0.5   0.0     0.042   7.7e+02      12      15 ..     254     257 ..     248     260 .. 0.82

  Alignments for each domain:
  == domain 1  score: 8.9 bits;  conditional E-value: 9.9e-05
   Delta_lysin   9 IGDLVKWI 16 
                   IGDL KWI
  BAONEE_38915 167 IGDLTKWI 174
                   9******9 PP

  == domain 2  score: 0.5 bits;  conditional E-value: 0.042
   Delta_lysin  12 LVKW 15 
                   LVKW
  BAONEE_38915 254 LVKW 257
                   9*** PP

>> BAONEE_162435  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.0   3.1e-05      0.56       9      15 ..      11      17 ..       7      20 .. 0.91

  Alignments for each domain:
  == domain 1  score: 10.5 bits;  conditional E-value: 3.1e-05
    Delta_lysin  9 IGDLVKW 15
                   IGD+VKW
  BAONEE_162435 11 IGDMVKW 17
                   9****** PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (25 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       419  (0.0114703); expected 730.6 (0.02)
Passed bias filter:                      364  (0.00996469); expected 730.6 (0.02)
Passed Vit filter:                        33  (0.000903392); expected 36.5 (0.001)
Passed Fwd filter:                         2  (5.4751e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 4991.75
//
Query:       LEAP-2  [M=128]
Accession:   PF07359.15
Description: Liver-expressed antimicrobial peptide 2 precursor (LEAP-2)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.19   13.0   0.0       0.25   12.6   0.0    1.2  1  BAONEE_20275  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_20275  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.6   0.0   6.9e-06      0.25      45      84 ..      30      68 ..       5      69 .. 0.58

  Alignments for each domain:
  == domain 1  score: 12.6 bits;  conditional E-value: 6.9e-06
        LEAP-2 45 allllavlllcllllsqvqsaplpeessalrRqrRmTplW 84
                  a  l+av++++  +++  qs +   ++    R +RmTp W
  BAONEE_20275 30 AAVLIAVAVITR-IVTGFQSRSGAVSDAEEPRSARMTPYW 68
                  222344444444.444444555555566789********* PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (128 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1314  (0.0359714); expected 730.6 (0.02)
Passed bias filter:                      827  (0.0226395); expected 730.6 (0.02)
Passed Vit filter:                        47  (0.00128665); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 24445.14
//
Query:       Antimicrobial_2  [M=28]
Accession:   PF08023.16
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (28 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       447  (0.0122369); expected 730.6 (0.02)
Passed bias filter:                      382  (0.0104574); expected 730.6 (0.02)
Passed Vit filter:                        21  (0.000574886); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 4739.54
//
Query:       Antimicrobial_4  [M=24]
Accession:   PF08024.15
Description: Ant antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (24 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       605  (0.0165622); expected 730.6 (0.02)
Passed bias filter:                      478  (0.0130855); expected 730.6 (0.02)
Passed Vit filter:                        35  (0.000958143); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 3742.62
//
Query:       Antimicrobial_3  [M=37]
Accession:   PF08025.15
Description: Spider antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (37 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       469  (0.0128391); expected 730.6 (0.02)
Passed bias filter:                      413  (0.0113061); expected 730.6 (0.02)
Passed Vit filter:                        33  (0.000903392); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 6074.12
//
Query:       Antimicrobial_5  [M=31]
Accession:   PF08026.15
Description: Bee antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (31 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1350  (0.0369569); expected 730.6 (0.02)
Passed bias filter:                      684  (0.0187248); expected 730.6 (0.02)
Passed Vit filter:                        44  (0.00120452); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 4799.87
//
Query:       Antimicrobial_7  [M=43]
Accession:   PF08102.15
Description: Scorpion antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (43 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       490  (0.013414); expected 730.6 (0.02)
Passed bias filter:                      428  (0.0117167); expected 730.6 (0.02)
Passed Vit filter:                        20  (0.00054751); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 8963.69
//
Query:       Antimicrobial_8  [M=17]
Accession:   PF08103.15
Description: Uperin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.23   12.6   1.0         33    5.8   0.1    2.5  2  BAONEE_17095  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_17095  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.1    0.0015        54       1      12 [.     118     129 ..     118     129 .. 0.91
   2 ?    5.8   0.1   0.00091        33       1       8 [.     260     267 ..     260     268 .. 0.94

  Alignments for each domain:
  == domain 1  score: 5.2 bits;  conditional E-value: 0.0015
  Antimicrobial_8   1 GVGDliRKiVsa 12 
                      G +D+ +KiV++
     BAONEE_17095 118 GMLDVVKKIVTT 129
                      789*******97 PP

  == domain 2  score: 5.8 bits;  conditional E-value: 0.00091
  Antimicrobial_8   1 GVGDliRK 8  
                      GV D++RK
     BAONEE_17095 260 GVMDFFRK 267
                      9******* PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (17 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       499  (0.0136604); expected 730.6 (0.02)
Passed bias filter:                      437  (0.0119631); expected 730.6 (0.02)
Passed Vit filter:                        32  (0.000876016); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 3839.02
//
Query:       Antimicrobial10  [M=50]
Accession:   PF08105.15
Description: Metchnikowin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (50 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1223  (0.0334802); expected 730.6 (0.02)
Passed bias filter:                      840  (0.0229954); expected 730.6 (0.02)
Passed Vit filter:                        48  (0.00131402); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 9258.74
//
Query:       Antimicrobial11  [M=16]
Accession:   PF08106.15
Description: Formaecin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.28   12.3   2.0       0.28   12.3   2.0    2.2  2  BAONEE_23875  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_23875  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.7   2.2      0.89   3.2e+04      10      12 ..      12      14 ..      11      17 .. 0.80
   2 ?   12.3   2.0   7.5e-06      0.28       7      15 ..      33      41 ..      32      42 .. 0.96

  Alignments for each domain:
  == domain 1  score: -3.7 bits;  conditional E-value: 0.89
  Antimicrobial11 10 PTP 12
                     PTP
     BAONEE_23875 12 PTP 14
                     888 PP

  == domain 2  score: 12.3 bits;  conditional E-value: 7.5e-06
  Antimicrobial11  7 NtKPTPyPR 15
                     NtKP P+PR
     BAONEE_23875 33 NTKPQPHPR 41
                     9*******9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (16 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1016  (0.0278135); expected 730.6 (0.02)
Passed bias filter:                      608  (0.0166443); expected 730.6 (0.02)
Passed Vit filter:                        40  (0.00109502); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 2878.69
//
Query:       Antimicrobial13  [M=15]
Accession:   PF08108.15
Description: Halocidin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (15 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       876  (0.0239809); expected 730.6 (0.02)
Passed bias filter:                      607  (0.0166169); expected 730.6 (0.02)
Passed Vit filter:                        17  (0.000465384); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 2755.07
//
Query:       Antimicrobial15  [M=19]
Accession:   PF08110.16
Description: Ocellatin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (19 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       380  (0.0104027); expected 730.6 (0.02)
Passed bias filter:                      330  (0.00903392); expected 730.6 (0.02)
Passed Vit filter:                        19  (0.000520135); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 4144.58
//
Query:       Antimicrobial19  [M=23]
Accession:   PF08225.15
Description: Pseudin antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (23 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       463  (0.0126749); expected 730.6 (0.02)
Passed bias filter:                      410  (0.011224); expected 730.6 (0.02)
Passed Vit filter:                        27  (0.000739139); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 5232.70
//
Query:       Bacteriocin_IId  [M=63]
Accession:   PF09221.14
Description: Bacteriocin class IId cyclical uberolysin-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (63 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1225  (0.033535); expected 730.6 (0.02)
Passed bias filter:                      702  (0.0192176); expected 730.6 (0.02)
Passed Vit filter:                        46  (0.00125927); expected 36.5 (0.001)
Passed Fwd filter:                         3  (8.21265e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 13275.79
//
Query:       Bacteriocin_IId  [M=63]
Accession:   PF09221.14
Description: Bacteriocin class IId cyclical uberolysin-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (63 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1225  (0.033535); expected 730.6 (0.02)
Passed bias filter:                      702  (0.0192176); expected 730.6 (0.02)
Passed Vit filter:                        46  (0.00125927); expected 36.5 (0.001)
Passed Fwd filter:                         3  (8.21265e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 10175.18
//
Query:       Lactococcin_972  [M=77]
Accession:   PF09683.14
Description: Bacteriocin (Lactococcin_972)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.34   12.4   1.1        1.4   10.4   0.3    2.0  2  BAONEE_170700  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_170700  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0     0.054     2e+03       3      13 ..      15      25 ..      13      29 .. 0.77
   2 ?   10.4   0.3   3.8e-05       1.4      17      66 ..      68     122 ..      58     132 .. 0.74

  Alignments for each domain:
  == domain 1  score: 0.3 bits;  conditional E-value: 0.054
  Lactococcin_972  3 egGGtWsyGvg 13
                     e+GG+W + v 
    BAONEE_170700 15 EDGGVWRRAVV 25
                     67****98765 PP

  == domain 2  score: 10.4 bits;  conditional E-value: 3.8e-05
  Lactococcin_972  17 kvySnYyHptktHgssvkngkktdrssa..vaagkwakAs..aakalg.tnkaYy 66 
                       v S++  +++ H+ss++ + +++rss    + gk akA+   +++++   + ++
    BAONEE_170700  68 VVSSEFVVGSRMHWSSCSSAPSCKRSSLicCSDGKDAKARrrRRRSWSvSTRKFW 122
                      48899*************98888888754489*******9754444431344555 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (77 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1062  (0.0290728); expected 730.6 (0.02)
Passed bias filter:                      698  (0.0191081); expected 730.6 (0.02)
Passed Vit filter:                        58  (0.00158778); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 14601.59
//
Query:       Bacteriocin_IIc  [M=74]
Accession:   PF10439.13
Description: Bacteriocin class II with double-glycine leader peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.08   13.7   0.8       0.11   13.3   0.8    1.2  1  BAONEE_116305  hypothetical protein
        1.3    9.8  13.3       0.22   12.4   2.6    2.9  3  BAONEE_83325   hypothetical protein
        4.2    8.2   4.9        2.3    9.1   1.0    2.5  2  BAONEE_116045  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_116305  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.3   0.8   9.1e-06      0.11      51      69 ..      56      74 ..      43      79 .. 0.66

  Alignments for each domain:
  == domain 1  score: 13.3 bits;  conditional E-value: 9.1e-06
  Bacteriocin_IIc 51 pvgaagGaaaGavlGaigg 69
                     +v+ a+G ++Ga++G ++g
    BAONEE_116305 56 VVWIAVGLVVGAIIGVVIG 74
                     5666666666666666543 PP

>> BAONEE_83325  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0    0.0071        86      52      68 ..      43      59 ..      38      64 .. 0.83
   2 ?   -0.9   1.0      0.25     3e+03      33      51 ..      76      95 ..      70     101 .. 0.60
   3 ?   12.4   2.6   1.8e-05      0.22      18      48 ..     104     130 ..     102     134 .. 0.76

  Alignments for each domain:
  == domain 1  score: 4.0 bits;  conditional E-value: 0.0071
  Bacteriocin_IIc 52 vgaagGaaaGavlGaig 68
                     ++ a++ a+G ++G+++
     BAONEE_83325 43 WISAITLALGYFVGGFI 59
                     78899999999999965 PP

  == domain 2  score: -0.9 bits;  conditional E-value: 0.25
  Bacteriocin_IIc 33 ggavggalaGaaaGaa.ggp 51
                     +++++ +++  a G++   +
     BAONEE_83325 76 WSIAVMGVTLLAFGYVkTCI 95
                     55666777777777775444 PP

  == domain 3  score: 12.4 bits;  conditional E-value: 1.8e-05
  Bacteriocin_IIc  18 eeLaeVeGGsakgtvggavggalaGaaaGaa 48 
                      + La V GG        +vgga+aGaa+G +
     BAONEE_83325 104 NVLAGVRGG----VEMCFVGGAAAGAAIGLV 130
                      668999999....555568888888888876 PP

>> BAONEE_116045  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.3   0.2      0.34   4.1e+03      36      54 ..     181     199 ..     177     206 .. 0.50
   2 ?    9.1   1.0   0.00019       2.3      45      64 ..     320     340 ..     315     345 .. 0.83

  Alignments for each domain:
  == domain 1  score: -1.3 bits;  conditional E-value: 0.34
  Bacteriocin_IIc  36 vggalaGaaaGaaggpvga 54 
                       +g+ a++ +G a+gpv+a
    BAONEE_116045 181 MAGFSAMVYVGPALGPVIA 199
                      3444444444444343333 PP

  == domain 2  score: 9.1 bits;  conditional E-value: 0.00019
  Bacteriocin_IIc  45 aGaa.ggpvgaagGaaaGavl 64 
                       G+  ++++g+++Ga++G+v+
    BAONEE_116045 320 SGVGeLPLIGTVVGALIGGVV 340
                      57778999**********985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1821  (0.0498508); expected 730.6 (0.02)
Passed bias filter:                     1049  (0.0287169); expected 730.6 (0.02)
Passed Vit filter:                       109  (0.00298393); expected 36.5 (0.001)
Passed Fwd filter:                        10  (0.000273755); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               3  [number of targets reported over threshold]
# CPU time: 0.08u 0.00s 00:00:00.08 Elapsed: 00:00:00.03
# Mc/sec: 12058.57
//
Query:       Myticin-prepro  [M=97]
Accession:   PF10690.13
Description: Myticin pre-proprotein from the mussel
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (97 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1395  (0.0381888); expected 730.6 (0.02)
Passed bias filter:                      872  (0.0238714); expected 730.6 (0.02)
Passed Vit filter:                        76  (0.00208054); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 14965.40
//
Query:       Tachystatin_A  [M=44]
Accession:   PF11406.12
Description: Antimicrobial peptide tachystatin A
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1227  (0.0335898); expected 730.6 (0.02)
Passed bias filter:                      701  (0.0191902); expected 730.6 (0.02)
Passed Vit filter:                        40  (0.00109502); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 8399.53
//
Query:       Antifungal_pept  [M=33]
Accession:   PF11410.12
Description: Antifungal peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (33 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       944  (0.0258425); expected 730.6 (0.02)
Passed bias filter:                      642  (0.0175751); expected 730.6 (0.02)
Passed Vit filter:                        47  (0.00128665); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 7045.21
//
Query:       Subtilosin_A  [M=34]
Accession:   PF11420.12
Description: Bacteriocin subtilosin A
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (34 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       929  (0.0254318); expected 730.6 (0.02)
Passed bias filter:                      614  (0.0168086); expected 730.6 (0.02)
Passed Vit filter:                        36  (0.000985518); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 6259.23
//
Query:       Tachystatin_B  [M=42]
Accession:   PF11478.12
Description: Antimicrobial chitin binding protein tachystatin B
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (42 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1236  (0.0338361); expected 730.6 (0.02)
Passed bias filter:                      593  (0.0162337); expected 730.6 (0.02)
Passed Vit filter:                        47  (0.00128665); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 7121.79
//
Query:       Stomoxyn  [M=39]
Accession:   PF11585.12
Description: Insect antimicrobial peptide, stomoxyn
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
        5.8    7.9   4.8         12    6.9   4.8    1.5  1  BAONEE_162395  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_162395  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   4.8   0.00032        12      20      39 .]     168     187 ..     166     187 .. 0.95

  Alignments for each domain:
  == domain 1  score: 6.9 bits;  conditional E-value: 0.00032
       Stomoxyn  20 anvakDvAviAgsGAAvgAA 39 
                    a+va+   v Ag GA vgAA
  BAONEE_162395 168 AHVAQGDDVLAGTGAGVGAA 187
                    9******************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (39 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       596  (0.0163158); expected 730.6 (0.02)
Passed bias filter:                      474  (0.012976); expected 730.6 (0.02)
Passed Vit filter:                        33  (0.000903392); expected 36.5 (0.001)
Passed Fwd filter:                         2  (5.4751e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 7969.76
//
Query:       LcnG-beta  [M=60]
Accession:   PF11632.12
Description: Lactococcin G-beta
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.26   12.3   0.1       0.37   11.8   0.1    1.2  1  BAONEE_105410  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_105410  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.1     1e-05      0.37       1      27 [.      25      51 ..      25      57 .. 0.90

  Alignments for each domain:
  == domain 1  score: 11.8 bits;  conditional E-value: 1e-05
      LcnG-beta  1 mknnelnnFetLsevElstveGGGkle 27
                   m  n l  +etL+ +E+  +  G kl+
  BAONEE_105410 25 MLTNALIEYETLTKEEMERILKGEKLD 51
                   66899***************9999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (60 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       470  (0.0128665); expected 730.6 (0.02)
Passed bias filter:                      423  (0.0115798); expected 730.6 (0.02)
Passed Vit filter:                        22  (0.000602261); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 11351.70
//
Query:       Bacteriocin_IIi  [M=50]
Accession:   PF11758.12
Description: Aureocin-like type II bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.15   12.8   0.1       0.23   12.1   0.1    1.4  1  BAONEE_51365  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_51365  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.1   6.3e-06      0.23      17      35 ..       2      21 ..       1      29 [. 0.90

  Alignments for each domain:
  == domain 1  score: 12.1 bits;  conditional E-value: 6.3e-06
  Bacteriocin_IIi 17 vkWawdnkgrvl.nWirnGm 35
                     + W+w+n+ rv+ +++r+G 
     BAONEE_51365  2 ASWVWQNGLRVVtDGLRAGT 21
                     67*********99*****95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (50 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       792  (0.0216814); expected 730.6 (0.02)
Passed bias filter:                      652  (0.0178488); expected 730.6 (0.02)
Passed Vit filter:                        35  (0.000958143); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 10040.02
//
Query:       CAP18_C  [M=28]
Accession:   PF12153.12
Description: LPS binding domain of CAP18 (C terminal)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (28 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       714  (0.0195461); expected 730.6 (0.02)
Passed bias filter:                      561  (0.0153577); expected 730.6 (0.02)
Passed Vit filter:                        42  (0.00114977); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 5976.24
//
Query:       BacteriocIIc_cy  [M=80]
Accession:   PF12173.12
Description: Bacteriocin class IIc cyclic gassericin A-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (80 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       680  (0.0186153); expected 730.6 (0.02)
Passed bias filter:                      502  (0.0137425); expected 730.6 (0.02)
Passed Vit filter:                        28  (0.000766514); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 16907.48
//
Query:       Antimicrobial21  [M=30]
Accession:   PF14861.10
Description: Plant antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (30 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1459  (0.0399409); expected 730.6 (0.02)
Passed bias filter:                      719  (0.019683); expected 730.6 (0.02)
Passed Vit filter:                        32  (0.000876016); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6302.46
//
Query:       Antimicrobial22  [M=21]
Accession:   PF16047.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
        1.3    9.9   0.2        1.3    9.9   0.2    2.0  2  BAONEE_79150  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_79150  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.2   3.6e-05       1.3       7      15 ..      18      26 ..      16      26 .. 0.95
   2 ?   -0.7   0.5     0.074   2.7e+03      14      18 ..      55      59 ..      54      59 .. 0.92

  Alignments for each domain:
  == domain 1  score: 9.9 bits;  conditional E-value: 3.6e-05
  Antimicrobial22  7 LGaGKkivC 15
                     L+aGK+i+C
     BAONEE_79150 18 LKAGKNILC 26
                     89******* PP

  == domain 2  score: -0.7 bits;  conditional E-value: 0.074
  Antimicrobial22 14 vCGLS 18
                     vC LS
     BAONEE_79150 55 VCSLS 59
                     9***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (21 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       805  (0.0220373); expected 730.6 (0.02)
Passed bias filter:                      553  (0.0151387); expected 730.6 (0.02)
Passed Vit filter:                        33  (0.000903392); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 4698.35
//
Query:       Antimicrobial23  [M=17]
Accession:   PF16048.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (17 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1117  (0.0305784); expected 730.6 (0.02)
Passed bias filter:                      694  (0.0189986); expected 730.6 (0.02)
Passed Vit filter:                        48  (0.00131402); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 3805.14
//
Query:       Antimicrobial24  [M=25]
Accession:   PF16049.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.58   11.2   1.4        2.5    9.1   0.3    2.2  2  BAONEE_11685   hypothetical protein
        4.4    8.4   5.9        7.1    7.7   5.9    1.4  1  BAONEE_176645  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_11685  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.3   0.00014       2.5       3      10 ..       1       8 [.       1       8 [. 0.97
   2 ?    0.3   0.0     0.081   1.5e+03      12      25 .]      97     110 ..      96     110 .. 0.83

  Alignments for each domain:
  == domain 1  score: 9.1 bits;  conditional E-value: 0.00014
  Antimicrobial24  3 vSSIGkAL 10
                     +SSIG+AL
     BAONEE_11685  1 MSSIGRAL 8 
                     9******9 PP

  == domain 2  score: 0.3 bits;  conditional E-value: 0.081
  Antimicrobial24  12 GLLvDVlKpKeqpA 25 
                      G L DV+  K  pA
     BAONEE_11685  97 GYLSDVVGGKIIPA 110
                      6799***9998777 PP

>> BAONEE_176645  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   5.9   0.00039       7.1       9      18 ..      21      30 ..      20      35 .. 0.96

  Alignments for each domain:
  == domain 1  score: 7.7 bits;  conditional E-value: 0.00039
  Antimicrobial24  9 ALGGLLvDVl 18
                     ALGGLL DVl
    BAONEE_176645 21 ALGGLLLDVL 30
                     9********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (25 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       611  (0.0167264); expected 730.6 (0.02)
Passed bias filter:                      508  (0.0139068); expected 730.6 (0.02)
Passed Vit filter:                        39  (0.00106764); expected 36.5 (0.001)
Passed Fwd filter:                         2  (5.4751e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 5508.08
//
Query:       Antimicrobial25  [M=53]
Accession:   PF16839.9
Description: Nematode antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (53 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1499  (0.0410359); expected 730.6 (0.02)
Passed bias filter:                      667  (0.0182595); expected 730.6 (0.02)
Passed Vit filter:                        31  (0.000848641); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 11724.46
//
Query:       DEFB136  [M=51]
Accession:   PF17333.6
Description: Beta defensin 136
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
      0.024   15.6   0.1        1.9    9.5   0.0    2.5  3  BAONEE_94075  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_94075  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.8   0.0      0.75   2.7e+04      11      18 ..      94     101 ..      93     105 .. 0.79
   2 ?    9.5   0.0   5.2e-05       1.9      22      39 ..     160     177 ..     158     185 .. 0.89
   3 ?    3.3   0.0    0.0044   1.6e+02      10      24 ..     196     210 ..     194     218 .. 0.82

  Alignments for each domain:
  == domain 1  score: -3.8 bits;  conditional E-value: 0.75
       DEFB136  11 alkglCfF 18 
                   a+ g C F
  BAONEE_94075  94 ARRGKCVF 101
                   57899988 PP

  == domain 2  score: 9.5 bits;  conditional E-value: 5.2e-05
       DEFB136  22 lGwkwvafChnilsCCkk 39 
                   lG++ va  hn++s C+ 
  BAONEE_94075 160 LGFTLVAMLHNVMSKCRT 177
                   69**************86 PP

  == domain 3  score: 3.3 bits;  conditional E-value: 0.0044
       DEFB136  10 TalkglCfFGcklGw 24 
                   T ++++CfF   +G 
  BAONEE_94075 196 TMRQSNCFFTAYPGL 210
                   78999****999985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (51 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1371  (0.0375318); expected 730.6 (0.02)
Passed bias filter:                      790  (0.0216267); expected 730.6 (0.02)
Passed Vit filter:                        65  (0.00177941); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 11612.91
//
Query:       Pilosulin  [M=74]
Accession:   PF17499.6
Description: Ant venom peptides
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       860  (0.0235429); expected 730.6 (0.02)
Passed bias filter:                      772  (0.0211339); expected 730.6 (0.02)
Passed Vit filter:                        58  (0.00158778); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 12459.59
//
Query:       MccV  [M=88]
Accession:   PF17508.6
Description: Microcin V bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.21   13.2   1.4       0.67   11.6   1.1    1.8  2  BAONEE_117390  hypothetical protein
        3.8    9.2   6.1       0.91   11.2   2.0    1.9  2  BAONEE_178580  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_117390  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.6   1.1   3.7e-05      0.67       8      41 ..      63      92 ..      56      98 .. 0.56
   2 ?   -0.9   0.0      0.31   5.6e+03      66      79 ..     172     185 ..     145     187 .. 0.77

  Alignments for each domain:
  == domain 1  score: 11.6 bits;  conditional E-value: 3.7e-05
           MccV  8 lteagggiagaalgrsiggkvggviggvagaiag 41
                    t + gg++g      igg vggv+g v   +ag
  BAONEE_117390 63 STTTTGGLTGPQ----IGGTVGGVVGFVVLVVAG 92
                   344456666555....555555555555555544 PP

  == domain 2  score: -0.9 bits;  conditional E-value: 0.31
           MccV  66 lGlGadrkPvelPa 79 
                    l + a+  Pvel a
  BAONEE_117390 172 LEMDANSGPVELDA 185
                    56779999999965 PP

>> BAONEE_178580  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.7   0.1      0.26   4.7e+03      35      52 ..      52      68 ..      44      77 .. 0.57
   2 ?   11.2   2.0     5e-05      0.91       4      62 ..      84     140 ..      82     153 .. 0.71

  Alignments for each domain:
  == domain 1  score: -0.7 bits;  conditional E-value: 0.26
           MccV 35 vagaiaggvaanelavyt 52
                   v ga+ g va + + v  
  BAONEE_178580 52 VQGAMVGMVA-DAVVVEG 68
                   4455554443.3344444 PP

  == domain 2  score: 11.2 bits;  conditional E-value: 5e-05
           MccV   4 lveklteagggiagaalgrsiggkvggviggvagaiaggvaanelavyteefveeelst 62 
                    lv  l+  + g+ g  +gr  ggk gg ++g  g +   v  + l v  +e v     t
  BAONEE_178580  84 LVPALAGLARGVVGGQVGRECGGKDGGDVAG--GPVGLHVIGEALRVVDDEHVRVVAQT 140
                    555666667799************9986544..33444566667777777777665555 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (88 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1247  (0.0341373); expected 730.6 (0.02)
Passed bias filter:                      935  (0.0255961); expected 730.6 (0.02)
Passed Vit filter:                        68  (0.00186153); expected 36.5 (0.001)
Passed Fwd filter:                         2  (5.4751e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 13811.58
//
Query:       Defensin_int  [M=44]
Accession:   PF17858.5
Description: Platypus intermediate defensin-like peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1434  (0.0392565); expected 730.6 (0.02)
Passed bias filter:                      657  (0.0179857); expected 730.6 (0.02)
Passed Vit filter:                        38  (0.00104027); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 6691.74
//
Query:       Sublancin  [M=57]
Accession:   PF19151.4
Description: Sublancin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (57 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       756  (0.0206959); expected 730.6 (0.02)
Passed bias filter:                      540  (0.0147828); expected 730.6 (0.02)
Passed Vit filter:                        21  (0.000574886); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 11094.48
//
Query:       garvicinKS_A  [M=22]
Accession:   NF038164.1
Description: NCBIFAM: GatA family leaderless bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (22 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       699  (0.0191355); expected 730.6 (0.02)
Passed bias filter:                      471  (0.0128939); expected 730.6 (0.02)
Passed Vit filter:                        25  (0.000684388); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 4543.85
//
Query:       cyan_ocin_like  [M=72]
Accession:   NF038167.1
Description: NCBIFAM: CTB family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.37   11.9   0.3       0.86   10.7   0.3    1.5  1  BAONEE_104695  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_104695  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.7   0.3   2.3e-05      0.86       9      54 ..     525     582 ..     519     590 .. 0.84

  Alignments for each domain:
  == domain 1  score: 10.7 bits;  conditional E-value: 2.3e-05
  cyan_ocin_like   9 veLSeeqlevVAGG............adfelnatnFaqknlvlagatssGPnGssats 54 
                      eLS+ + + +AGG            +d + +++   ++  + +    sGP+Gs+ t 
   BAONEE_104695 525 GELSDSEEDELAGGvtvsskrtvvrsGDLAASSKPGTERGRITNAVILSGPSGSGKTA 582
                     59************999999999988777777777788888899**********8775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (72 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       731  (0.0200115); expected 730.6 (0.02)
Passed bias filter:                      518  (0.0141805); expected 730.6 (0.02)
Passed Vit filter:                        32  (0.000876016); expected 36.5 (0.001)
Passed Fwd filter:                         2  (5.4751e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 13765.91
//
Query:       Bac51  [M=107]
Accession:   NF041453.1
Description: NCBIFAM: bacteriocin 51 precursor BacA
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (107 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       612  (0.0167538); expected 730.6 (0.02)
Passed bias filter:                      538  (0.014728); expected 730.6 (0.02)
Passed Vit filter:                        28  (0.000766514); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.01s 00:00:00.08 Elapsed: 00:00:00.03
# Mc/sec: 16688.87
//
Query:       oc_CLOSPO_01332  [M=59]
Accession:   TIGR04067.1
Description: JCVI: Apre_1838 family putative sactipeptide bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (59 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1216  (0.0332886); expected 730.6 (0.02)
Passed bias filter:                      683  (0.0186975); expected 730.6 (0.02)
Passed Vit filter:                        41  (0.0011224); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 11695.07
//
Query:       bactofencin_A  [M=45]
Accession:   NF038163.1
Description: NCBIFAM: bactofencin A family cationic bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (45 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       592  (0.0162063); expected 730.6 (0.02)
Passed bias filter:                      472  (0.0129212); expected 730.6 (0.02)
Passed Vit filter:                        26  (0.000711763); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 9484.47
//
Query:       ocin_CLI_3235  [M=34]
Accession:   TIGR04065.1
Description: JCVI: CLI_3235 family bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
     0.0039   18.3   0.3     0.0039   18.3   0.3    2.0  2  BAONEE_176740  hypothetical protein
  ------ inclusion threshold ------
       0.14   13.2   0.0       0.19   12.8   0.0    1.2  1  BAONEE_12000   hypothetical protein
        3.4    8.9  11.8        1.3   10.2   1.2    2.6  2  BAONEE_145470  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_176740  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.9   0.6      0.31   3.7e+03      18      24 ..      44      50 ..      36      51 .. 0.73
   2 !   18.3   0.3   3.2e-07    0.0039       6      30 ..      59      83 ..      58      87 .. 0.92

  Alignments for each domain:
  == domain 1  score: -0.9 bits;  conditional E-value: 0.31
  ocin_CLI_3235 18 YsCnCss 24
                   Y+ +C+s
  BAONEE_176740 44 YYVTCDS 50
                   7788887 PP

  == domain 2  score: 18.3 bits;  conditional E-value: 3.2e-07
  ocin_CLI_3235  6 KklelkkeTveAYsCnCssnCsCyc 30
                   K +el  +T  AY++ C+s+C+ yc
  BAONEE_176740 59 KQSELSGNTNAAYLAICDSGCGAYC 83
                   8899999*****************9 PP

>> BAONEE_12000  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.8   0.0   1.6e-05      0.19       7      27 ..      56      76 ..      51      79 .. 0.81

  Alignments for each domain:
  == domain 1  score: 12.8 bits;  conditional E-value: 1.6e-05
  ocin_CLI_3235  7 klelkkeTveAYsCnCssnCs 27
                   kl l    ++A++C+C   Cs
   BAONEE_12000 56 KLDLRLPILMAFLCECREFCS 76
                   666777779*******99997 PP

>> BAONEE_145470  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   3.6     0.022   2.7e+02      20      30 ..     211     224 ..     202     226 .. 0.80
   2 ?   10.2   1.2    0.0001       1.3      18      34 .]     262     276 ..     253     276 .. 0.83

  Alignments for each domain:
  == domain 1  score: 2.8 bits;  conditional E-value: 0.022
  ocin_CLI_3235  20 CnCssnC...sCyc 30 
                    C+C ++C    C+c
  BAONEE_145470 211 CSCTTVCdpkRCMC 224
                    89999997777766 PP

  == domain 2  score: 10.2 bits;  conditional E-value: 0.0001
  ocin_CLI_3235  18 YsCnCssnCsCycrCgg 34 
                    +  +Cs+ C+C  rC++
  BAONEE_145470 262 F--ECSARCGCKGRCWN 276
                    5..8************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (34 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1363  (0.0373128); expected 730.6 (0.02)
Passed bias filter:                      751  (0.020559); expected 730.6 (0.02)
Passed Vit filter:                        45  (0.0012319); expected 36.5 (0.001)
Passed Fwd filter:                         3  (8.21265e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               3  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 5505.76
//
Query:       B_an_ocin  [M=88]
Accession:   TIGR03601.1
Description: JCVI: heterocycloanthracin family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.48   12.0   7.2       0.95   11.0   7.2    1.4  1  BAONEE_35235  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_35235  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.0   7.2   2.6e-05      0.95      28      75 ..      95     142 ..      83     153 .. 0.81

  Alignments for each domain:
  == domain 1  score: 11.0 bits;  conditional E-value: 2.6e-05
     B_an_ocin  28 nqypyyyveddarrcggcgrcggccggrCggcggfrCfgcfgCfgcfa 75 
                   +q+    v++++  c  c ++  +++ rC +cg  +C gc    gc+ 
  BAONEE_35235  95 TQTRFEAVTAHTAICDLCNSRNDTGMSRCLSCGWQSCHGCTLKNGCTR 142
                   455566677778889999999999****************99899883 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (88 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1932  (0.0528895); expected 730.6 (0.02)
Passed bias filter:                      866  (0.0237072); expected 730.6 (0.02)
Passed Vit filter:                        71  (0.00194366); expected 36.5 (0.001)
Passed Fwd filter:                         4  (0.000109502); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 15783.86
//
Query:       lactGbeta_entB  [M=38]
Accession:   NF038034.1
Description: NCBIFAM: lactococcin G-beta/enterocin 1071B family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.12   13.6   0.2       0.26   12.4   0.2    1.5  1  BAONEE_176710  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_176710  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.4   0.2   7.1e-06      0.26      17      31 ..      29      42 ..      26      42 .. 0.84

  Alignments for each domain:
  == domain 1  score: 12.4 bits;  conditional E-value: 7.1e-06
  lactGbeta_entB 17 kwiglidPaYDFgkG 31
                    +++g+idPaY FgkG
   BAONEE_176710 29 TLLGWIDPAY-FGKG 42
                    59********.8887 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (38 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                       666  (0.0182321); expected 730.6 (0.02)
Passed bias filter:                      539  (0.0147554); expected 730.6 (0.02)
Passed Vit filter:                        33  (0.000903392); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 8464.90
//
Query:       Thiopep_pre  [M=36]
Accession:   PF19409.3
Description: Thiopeptide-type bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    0.00048   20.8   0.2     0.0011   19.6   0.2    1.7  1  BAONEE_63555  hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_63555  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.6   0.2   3.1e-08    0.0011       5      27 ..       3      25 ..       3      27 .. 0.92

  Alignments for each domain:
  == domain 1  score: 19.6 bits;  conditional E-value: 3.1e-08
   Thiopep_pre  5 tslrdavALPEtGASsGssscss 27
                  ++++ + A+PE  AS Gsss+ s
  BAONEE_63555  3 EDMDMGFAMPEFNASEGSSSWGS 25
                  5899999**************88 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (36 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      2052  (0.0561745); expected 730.6 (0.02)
Passed bias filter:                      803  (0.0219825); expected 730.6 (0.02)
Passed Vit filter:                        57  (0.0015604); expected 36.5 (0.001)
Passed Fwd filter:                         1  (2.73755e-05); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 6056.43
//
Query:       thiopep_precurs  [M=44]
Accession:   TIGR03892.1
Description: JCVI: thiazolylpeptide-type bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.78   11.0   5.6          1   10.7   0.1    2.5  2  BAONEE_127685  hypothetical protein
        1.2   10.5   0.1        1.2   10.5   0.1    2.4  3  BAONEE_96010   hypothetical protein


Domain annotation for each sequence (and alignments):
>> BAONEE_127685  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   1.5     0.044     8e+02      25      34 ..     100     109 ..      91     113 .. 0.49
   2 ?   10.7   0.1   5.5e-05         1      22      37 ..     129     144 ..     119     145 .. 0.86

  Alignments for each domain:
  == domain 1  score: 1.4 bits;  conditional E-value: 0.044
  thiopep_precurs  25 gatstsssSs 34 
                      +a+s sssSs
    BAONEE_127685 100 SAVSVSSSSS 109
                      2344444444 PP

  == domain 2  score: 10.7 bits;  conditional E-value: 5.5e-05
  thiopep_precurs  22 assgatstsssSsCsT 37 
                      ++++++s +s++sC++
    BAONEE_127685 129 TGAHTVSDISCASCGS 144
                      357***********97 PP

>> BAONEE_96010  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.1   6.5e-05       1.2       1      17 [.       7      23 ..       7      59 .. 0.81
   2 ?   -2.9   2.0      0.99   1.8e+04      17      17 ..     162     162 ..     136     177 .. 0.47
   3 ?   -3.7   0.2       1.7   3.2e+04      28      34 ..     208     214 ..     202     219 .. 0.56

  Alignments for each domain:
  == domain 1  score: 10.5 bits;  conditional E-value: 6.5e-05
  thiopep_precurs  1 lteLDietfEisDyadl 17
                     +teLDi+ +Ei ++ d 
     BAONEE_96010  7 FTELDIDLLEIRELYDI 23
                     79***********9984 PP

  == domain 2  score: -2.9 bits;  conditional E-value: 0.99
  thiopep_precurs  17 l 17 
                      +
     BAONEE_96010 162 E 162
                      1 PP

  == domain 3  score: -3.7 bits;  conditional E-value: 1.7
  thiopep_precurs  28 stsssSs 34 
                       t+ +++
     BAONEE_96010 208 NTTITAT 214
                      4444444 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      2189  (0.059925); expected 730.6 (0.02)
Passed bias filter:                     1092  (0.0298941); expected 730.6 (0.02)
Passed Vit filter:                       106  (0.0029018); expected 36.5 (0.001)
Passed Fwd filter:                         7  (0.000191629); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.08u 0.00s 00:00:00.08 Elapsed: 00:00:00.03
# Mc/sec: 6589.31
//
Query:       Defensin_2  [M=33]
Accession:   PF01097.19
Description: Arthropod defensin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (33 nodes)
Target sequences:                      36529  (5676594 residues searched)
Passed MSV filter:                      1714  (0.0469216); expected 730.6 (0.02)
Passed bias filter:                      804  (0.0220099); expected 730.6 (0.02)
Passed Vit filter:                        48  (0.00131402); expected 36.5 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              36529  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6749.15
//
[ok]
