# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.2 (Nov 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  /Net/Groups/ccdata/projectsxx
# target sequence database:        /Net/Groups/ccdata/projects/xx.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PTHR11876.orig.30.pir  [M=94]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.044   15.8   3.3      0.056   15.4   3.3    1.2  1  LDJJOL_02840   hypothetical protein
       0.31   13.1   2.9       0.37   12.8   2.9    1.1  1  LDJJOL_120330  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_02840  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.4   3.3   2.7e-06     0.056      42      86 ..      28      77 ..      11      85 .. 0.81

  Alignments for each domain:
  == domain 1  score: 15.4 bits;  conditional E-value: 2.7e-06
  PTHR11876.orig.30.pir 42 vsvsfeedegsalqkas.esrrrltc.ycrrr..scirrerlygtCr.rr 86
                           +s+s +ede+++ +++   srr+  c  crrr  +c +++  +g Cr + 
           LDJJOL_02840 28 RSESQQEDERPNKKAKTwPSRRKPACqTCRRRkvRCDNGQPACGFCRaNE 77
                           6789999999999995569999999999999988999*********9643 PP

>> LDJJOL_120330  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.8   2.9   1.8e-05      0.37      44      85 ..      11      57 ..       4      66 .. 0.72

  Alignments for each domain:
  == domain 1  score: 12.8 bits;  conditional E-value: 1.8e-05
  PTHR11876.orig.30.pir 44 vsfeedegsalqkas.esrrrltc.ycrrr..scirrerlygtCr.r 85
                           +s  +d +s+ +++   srr+  c  crrr  +c + +  +g Cr +
          LDJJOL_120330 11 ESQDDDGNSNKKAKTgPSRRKPACqTCRRRkvRCDNAQPACGFCRaN 57
                           4545555555555566788888888888887789999999**99955 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (94 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1697  (0.0420029); expected 808.0 (0.02)
Passed bias filter:                     1320  (0.0326716); expected 808.0 (0.02)
Passed Vit filter:                       152  (0.00376219); expected 40.4 (0.001)
Passed Fwd filter:                        25  (0.000618781); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.10u 0.01s 00:00:00.11 Elapsed: 00:00:00.04
# Mc/sec: 10124.40
//
Query:       Bacteriocin_II  [M=35]
Accession:   PF01721.22
Description: Class II bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
      0.045   14.7   0.0      0.068   14.1   0.0    1.3  1  LDJJOL_20955  hypothetical protein
       0.12   13.4   0.1       0.24   12.4   0.1    1.4  1  LDJJOL_89870  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_20955  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.1   0.0   3.4e-06     0.068      11      32 ..       5      26 ..       4      28 .. 0.87

  Alignments for each domain:
  == domain 1  score: 14.1 bits;  conditional E-value: 3.4e-06
  Bacteriocin_II 11 kkkCwVDWgqaitsivnnvaag 32
                    k+ C+VDW  ++++i + +++g
    LDJJOL_20955  5 KYLCSVDWTITAQQIPHLLIEG 26
                    667************9988876 PP

>> LDJJOL_89870  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.4   0.1   1.2e-05      0.24      10      22 ..       7      19 ..       6      23 .. 0.85

  Alignments for each domain:
  == domain 1  score: 12.4 bits;  conditional E-value: 1.2e-05
  Bacteriocin_II 10 dkkkCwVDWgqai 22
                    +kk C+V+W++ +
    LDJJOL_89870  7 GKKGCSVNWARFT 19
                    6999******866 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (35 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       756  (0.0187119); expected 808.0 (0.02)
Passed bias filter:                      561  (0.0138855); expected 808.0 (0.02)
Passed Vit filter:                        38  (0.000940547); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 5748.10
//
Query:       FSAP_sig_propep  [M=42]
Accession:   PF03032.19
Description: Frog skin active peptide family signal and propeptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (42 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1070  (0.0264838); expected 808.0 (0.02)
Passed bias filter:                      854  (0.0211376); expected 808.0 (0.02)
Passed Vit filter:                        71  (0.00175734); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 8474.04
//
Query:       Cyclotide  [M=30]
Accession:   PF03784.17
Description: Cyclotide family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (30 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1751  (0.0433394); expected 808.0 (0.02)
Passed bias filter:                      844  (0.0208901); expected 808.0 (0.02)
Passed Vit filter:                        51  (0.00126231); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6363.68
//
Query:       Lactococcin  [M=48]
Accession:   PF04369.17
Description: Lactococcin-like family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (48 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       554  (0.0137122); expected 808.0 (0.02)
Passed bias filter:                      477  (0.0118063); expected 808.0 (0.02)
Passed Vit filter:                        32  (0.00079204); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 7683.69
//
Query:       Delta_lysin  [M=25]
Accession:   PF05372.15
Description: Delta lysin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (25 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       458  (0.0113361); expected 808.0 (0.02)
Passed bias filter:                      394  (0.00975199); expected 808.0 (0.02)
Passed Vit filter:                        43  (0.0010643); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 3673.89
//
Query:       LEAP-2  [M=128]
Accession:   PF07359.15
Description: Liver-expressed antimicrobial peptide 2 precursor (LEAP-2)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.018   16.4   0.5      0.026   15.9   0.5    1.2  1  LDJJOL_132245  hypothetical protein
      0.034   15.5   3.4      0.043   15.2   3.4    1.2  1  LDJJOL_67675   hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_132245  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.9   0.5   1.3e-06     0.026      95     113 ..      39      57 ..      37      61 .. 0.93

  Alignments for each domain:
  == domain 1  score: 15.9 bits;  conditional E-value: 1.3e-06
         LEAP-2  95 sCrdnsECiTklCrknrCs 113
                    sC+d+ EC  +lC +++C 
  LDJJOL_132245  39 SCHDDHECEGGLCDEGICI 57 
                    8*****************7 PP

>> LDJJOL_67675  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.2   3.4   2.1e-06     0.043      92     113 ..      37      58 ..      31      64 .. 0.91

  Alignments for each domain:
  == domain 1  score: 15.2 bits;  conditional E-value: 2.1e-06
        LEAP-2  92 vGAsCrdnsECiTklCrknrCs 113
                   +GA C+   EC+ ++C  +rC 
  LDJJOL_67675  37 MGAACKSSTECGDNVCNDGRCE 58 
                   8********************5 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (128 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1542  (0.0381664); expected 808.0 (0.02)
Passed bias filter:                      930  (0.0230187); expected 808.0 (0.02)
Passed Vit filter:                        92  (0.00227711); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 22362.24
//
Query:       Antimicrobial_2  [M=28]
Accession:   PF08023.16
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.19   13.3   0.1         16    7.1   0.1    2.1  2  LDJJOL_191210  hypothetical protein
       0.21   13.1   0.0       0.52   11.9   0.0    1.6  1  LDJJOL_162155  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_191210  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0    0.0056   1.1e+02       9      20 ..       6      17 ..       3      18 .. 0.89
   2 ?    7.1   0.1   0.00081        16       1       8 [.      45      52 ..      45      53 .] 0.91

  Alignments for each domain:
  == domain 1  score: 4.4 bits;  conditional E-value: 0.0056
  Antimicrobial_2  9 gKnvAgklLdki 20
                      Kn+A   +dki
    LDJJOL_191210  6 QKNIADEAIDKI 17
                     59*********8 PP

  == domain 2  score: 7.1 bits;  conditional E-value: 0.00081
  Antimicrobial_2  1 fLstlKnt 8 
                     f+s++Kn+
    LDJJOL_191210 45 FWSVVKNL 52
                     9*****97 PP

>> LDJJOL_162155  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.9   0.0   2.6e-05      0.52       7      22 ..      73      88 ..      73      89 .. 0.91

  Alignments for each domain:
  == domain 1  score: 11.9 bits;  conditional E-value: 2.6e-05
  Antimicrobial_2  7 ntgKnvAgklLdkiKC 22
                     +t K+v+g++Ld i C
    LDJJOL_162155 73 GTRKSVGGNGLDRILC 88
                     588**********998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (28 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       537  (0.0132914); expected 808.0 (0.02)
Passed bias filter:                      451  (0.0111628); expected 808.0 (0.02)
Passed Vit filter:                        23  (0.000569279); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 5900.97
//
Query:       Antimicrobial_4  [M=24]
Accession:   PF08024.15
Description: Ant antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (24 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       621  (0.0153705); expected 808.0 (0.02)
Passed bias filter:                      515  (0.0127469); expected 808.0 (0.02)
Passed Vit filter:                        30  (0.000742537); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 4277.05
//
Query:       Antimicrobial_3  [M=37]
Accession:   PF08025.15
Description: Spider antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (37 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       555  (0.0137369); expected 808.0 (0.02)
Passed bias filter:                      486  (0.0120291); expected 808.0 (0.02)
Passed Vit filter:                        37  (0.000915796); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 7264.61
//
Query:       Antimicrobial_5  [M=31]
Accession:   PF08026.15
Description: Bee antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (31 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1415  (0.035023); expected 808.0 (0.02)
Passed bias filter:                      771  (0.0190832); expected 808.0 (0.02)
Passed Vit filter:                        37  (0.000915796); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6750.10
//
Query:       Antimicrobial_7  [M=43]
Accession:   PF08102.15
Description: Scorpion antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.28   12.6   0.0       0.54   11.6   0.0    1.5  1  LDJJOL_12080  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_12080  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.6   0.0   1.3e-05      0.54      10      37 ..       2      33 ..       1      36 [. 0.84

  Alignments for each domain:
  == domain 1  score: 11.6 bits;  conditional E-value: 1.3e-05
  Antimicrobial_7 10 tAkkvwnSepvkqLKnkal....NAAKNfVAe 37
                     tA+ +w  ++vk LK+ ++       KN+VA 
     LDJJOL_12080  2 TARIIWRFDTVKSLKKAGIlgmsEGVKNYVAT 33
                     7999*************995555568****95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (43 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       562  (0.0139102); expected 808.0 (0.02)
Passed bias filter:                      480  (0.0118806); expected 808.0 (0.02)
Passed Vit filter:                        24  (0.00059403); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 8768.87
//
Query:       Antimicrobial_8  [M=17]
Accession:   PF08103.15
Description: Uperin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.16   13.3   1.0         29    6.2   0.1    2.5  2  LDJJOL_71425  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_71425  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.1    0.0012        48       1      12 [.      70      81 ..      70      81 .. 0.91
   2 ?    6.2   0.1   0.00073        29       1       8 [.     212     219 ..     212     220 .. 0.94

  Alignments for each domain:
  == domain 1  score: 5.5 bits;  conditional E-value: 0.0012
  Antimicrobial_8  1 GVGDliRKiVsa 12
                     G +D+ +KiV++
     LDJJOL_71425 70 GMLDVVKKIVTT 81
                     789*******97 PP

  == domain 2  score: 6.2 bits;  conditional E-value: 0.00073
  Antimicrobial_8   1 GVGDliRK 8  
                      GV D++RK
     LDJJOL_71425 212 GVMDFFRK 219
                      9******* PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (17 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       606  (0.0149993); expected 808.0 (0.02)
Passed bias filter:                      520  (0.0128706); expected 808.0 (0.02)
Passed Vit filter:                        37  (0.000915796); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 3651.24
//
Query:       Antimicrobial10  [M=50]
Accession:   PF08105.15
Description: Metchnikowin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (50 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1388  (0.0343547); expected 808.0 (0.02)
Passed bias filter:                      934  (0.0231177); expected 808.0 (0.02)
Passed Vit filter:                        45  (0.00111381); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 10359.38
//
Query:       Antimicrobial11  [M=16]
Accession:   PF08106.15
Description: Formaecin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (16 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1051  (0.0260136); expected 808.0 (0.02)
Passed bias filter:                      664  (0.0164348); expected 808.0 (0.02)
Passed Vit filter:                        46  (0.00113856); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 2435.11
//
Query:       Antimicrobial13  [M=15]
Accession:   PF08108.15
Description: Halocidin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (15 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       913  (0.0225979); expected 808.0 (0.02)
Passed bias filter:                      632  (0.0156428); expected 808.0 (0.02)
Passed Vit filter:                        25  (0.000618781); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 2170.12
//
Query:       Antimicrobial15  [M=19]
Accession:   PF08110.16
Description: Ocellatin family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (19 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       401  (0.00992525); expected 808.0 (0.02)
Passed bias filter:                      360  (0.00891045); expected 808.0 (0.02)
Passed Vit filter:                        21  (0.000519776); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 3850.84
//
Query:       Antimicrobial19  [M=23]
Accession:   PF08225.15
Description: Pseudin antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (23 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       520  (0.0128706); expected 808.0 (0.02)
Passed bias filter:                      445  (0.0110143); expected 808.0 (0.02)
Passed Vit filter:                        18  (0.000445522); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 4938.09
//
Query:       Bacteriocin_IId  [M=63]
Accession:   PF09221.14
Description: Bacteriocin class IId cyclical uberolysin-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.021   16.0   0.2       0.88   10.8   0.2    2.6  2  LDJJOL_130920  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_130920  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0     0.011   4.4e+02       9      34 ..     142     167 ..     138     183 .. 0.76
   2 ?   10.8   0.2   2.2e-05      0.88       7      29 ..     297     319 ..     294     323 .. 0.90

  Alignments for each domain:
  == domain 1  score: 2.2 bits;  conditional E-value: 0.011
  Bacteriocin_IId   9 aaAkkivdaidagstvatiisiigai 34 
                       aA+k++d i+a +    ++     i
    LDJJOL_130920 142 DAAQKVLDSIKATGQHPEAVHYASLI 167
                      69**********99877666655555 PP

  == domain 2  score: 10.8 bits;  conditional E-value: 2.2e-05
  Bacteriocin_IId   7 staaAkkivdaidagstvatiis 29 
                      ++a+A+ki+d++da++++at+ +
    LDJJOL_130920 297 PAAVANKILDLVDAATATATATA 319
                      689****************9976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (63 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1294  (0.0320281); expected 808.0 (0.02)
Passed bias filter:                      694  (0.0171774); expected 808.0 (0.02)
Passed Vit filter:                        38  (0.000940547); expected 40.4 (0.001)
Passed Fwd filter:                         3  (7.42537e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 10617.40
//
Query:       Bacteriocin_IId  [M=63]
Accession:   PF09221.14
Description: Bacteriocin class IId cyclical uberolysin-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.021   16.0   0.2       0.88   10.8   0.2    2.6  2  LDJJOL_130920  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_130920  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0     0.011   4.4e+02       9      34 ..     142     167 ..     138     183 .. 0.76
   2 ?   10.8   0.2   2.2e-05      0.88       7      29 ..     297     319 ..     294     323 .. 0.90

  Alignments for each domain:
  == domain 1  score: 2.2 bits;  conditional E-value: 0.011
  Bacteriocin_IId   9 aaAkkivdaidagstvatiisiigai 34 
                       aA+k++d i+a +    ++     i
    LDJJOL_130920 142 DAAQKVLDSIKATGQHPEAVHYASLI 167
                      69**********99877666655555 PP

  == domain 2  score: 10.8 bits;  conditional E-value: 2.2e-05
  Bacteriocin_IId   7 staaAkkivdaidagstvatiis 29 
                      ++a+A+ki+d++da++++at+ +
    LDJJOL_130920 297 PAAVANKILDLVDAATATATATA 319
                      689****************9976 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (63 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1294  (0.0320281); expected 808.0 (0.02)
Passed bias filter:                      694  (0.0171774); expected 808.0 (0.02)
Passed Vit filter:                        38  (0.000940547); expected 40.4 (0.001)
Passed Fwd filter:                         3  (7.42537e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 11177.41
//
Query:       Lactococcin_972  [M=77]
Accession:   PF09683.14
Description: Bacteriocin (Lactococcin_972)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.47   12.1   0.0       0.89   11.2   0.0    1.4  1  LDJJOL_126310  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_126310  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.0   2.2e-05      0.89      17      52 ..     144     177 ..     136     187 .. 0.76

  Alignments for each domain:
  == domain 1  score: 11.2 bits;  conditional E-value: 2.2e-05
  Lactococcin_972  17 kvySnYyHptktHgssvkngkktdrssavaagkwak 52 
                       v+S+Y  p  +H ss+k g ++   ++    ++ak
    LDJJOL_126310 144 SVWSKYLRPYFSHLSSIK-GLSWLIVGC-VGEVYAK 177
                      6****************9.887777777.6666665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (77 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1131  (0.0279937); expected 808.0 (0.02)
Passed bias filter:                      735  (0.0181922); expected 808.0 (0.02)
Passed Vit filter:                        53  (0.00131182); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 13910.96
//
Query:       Bacteriocin_IIc  [M=74]
Accession:   PF10439.13
Description: Bacteriocin class II with double-glycine leader peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.088   13.8   1.0       0.13   13.2   1.0    1.2  1  LDJJOL_142205  hypothetical protein
       0.26   12.2  12.6       0.39   11.7  12.6    1.3  1  LDJJOL_110905  hypothetical protein
        1.3   10.0  14.5       0.16   12.9   2.6    2.9  3  LDJJOL_150690  hypothetical protein
        4.6    8.2   4.9        2.6    9.1   1.0    2.5  2  LDJJOL_00035   hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_142205  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.2   1.0   1.3e-05      0.13      23      64 ..      58     107 ..      56     113 .. 0.81

  Alignments for each domain:
  == domain 1  score: 13.2 bits;  conditional E-value: 1.3e-05
  Bacteriocin_IIc  23 VeGG......sakgtvggavggalaGaaaGaa..ggpvgaagGaaaGavl 64 
                      V+G       ++  ++  +v +al+G+aaG++  + p++ + G+ +G v+
    LDJJOL_142205  58 VQGDsdwlrrCVWCIGYTVVRSALVGVAAGVVyyWYPYMSLRGGGLGYVG 107
                      555566666566777778899*************9******999999873 PP

>> LDJJOL_110905  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.7  12.6   3.8e-05      0.39      33      64 ..      68     104 ..      56     110 .. 0.73

  Alignments for each domain:
  == domain 1  score: 11.7 bits;  conditional E-value: 3.8e-05
  Bacteriocin_IIc  33 ggavggalaGaaaGaa.....ggpvgaagGaaaGavl 64 
                      +g++ ++++Gaa+G+a     gg +++agGa++Gav+
    LDJJOL_110905  68 KGLGSTVAGGAAGGYAahnmgGGKLATAGGAVLGAVG 104
                      4455555666666666766699999999999999983 PP

>> LDJJOL_150690  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1    0.0068        69      52      68 ..      14      30 ..      10      35 .. 0.83
   2 ?   -0.4   1.0      0.22   2.3e+03      33      52 ..      47      67 ..      41      72 .. 0.61
   3 ?   12.9   2.6   1.6e-05      0.16      18      48 ..      75     101 ..      73     105 .. 0.76

  Alignments for each domain:
  == domain 1  score: 4.5 bits;  conditional E-value: 0.0068
  Bacteriocin_IIc 52 vgaagGaaaGavlGaig 68
                     ++ a++ a+G ++G+++
    LDJJOL_150690 14 WISAITLALGYFVGGFI 30
                     78899999999999965 PP

  == domain 2  score: -0.4 bits;  conditional E-value: 0.22
  Bacteriocin_IIc 33 ggavggalaGaaaGaa.ggpv 52
                     +++++ +++  a G++   +v
    LDJJOL_150690 47 WSIAVMGVTLLAFGYVkTCIV 67
                     566677777777777754444 PP

  == domain 3  score: 12.9 bits;  conditional E-value: 1.6e-05
  Bacteriocin_IIc  18 eeLaeVeGGsakgtvggavggalaGaaaGaa 48 
                      + La V GG        +vgga+aGaa+G +
    LDJJOL_150690  75 NVLAGVRGG----VEMCFVGGAAAGAAIGLV 101
                      668999999....555568888888888877 PP

>> LDJJOL_00035  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.3   0.2      0.45   4.6e+03      36      54 ..     181     199 ..     177     206 .. 0.50
   2 ?    9.1   1.0   0.00026       2.6      45      64 ..     320     340 ..     315     345 .. 0.83

  Alignments for each domain:
  == domain 1  score: -1.3 bits;  conditional E-value: 0.45
  Bacteriocin_IIc  36 vggalaGaaaGaaggpvga 54 
                       +g+ a++ +G a+gpv+a
     LDJJOL_00035 181 MAGFSAMVYVGPALGPVIA 199
                      3444444444444343333 PP

  == domain 2  score: 9.1 bits;  conditional E-value: 0.00026
  Bacteriocin_IIc  45 aGaa.ggpvgaagGaaaGavl 64 
                       G+  ++++g+++Ga++G+v+
     LDJJOL_00035 320 SGVGeLPLIGTVVGALIGGVV 340
                      57778999**********985 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1905  (0.0471511); expected 808.0 (0.02)
Passed bias filter:                     1069  (0.0264591); expected 808.0 (0.02)
Passed Vit filter:                       111  (0.00274739); expected 40.4 (0.001)
Passed Fwd filter:                        12  (0.000297015); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               4  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 9596.17
//
Query:       Myticin-prepro  [M=97]
Accession:   PF10690.13
Description: Myticin pre-proprotein from the mussel
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.36   12.2   3.2       0.45   11.9   3.2    1.1  1  LDJJOL_192015  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_192015  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.9   3.2   1.1e-05      0.45      11      80 ..      26      94 ..      19      99 .. 0.80

  Alignments for each domain:
  == domain 1  score: 11.9 bits;  conditional E-value: 1.1e-05
  Myticin-prepro 11 lavllavqeadasCasrCkakC.rsrgckayvaaqlgerclCkClrCareesplalsmkaksvneqeldms 80
                    + v + v++ad +C+  C+ +  r + c +y   ++ +++  +   C+  e p+  + k+ +v e  ld+ 
   LDJJOL_192015 26 VSVSVFVTDADCNCRGGCSHHQsRKAACWMY-PDRYDSQKTFRGHSCWISE-PFWGARKFVQVVELILDVH 94
                    6788999***********9875145556665.57899999********999.9999999989888766665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (97 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1586  (0.0392555); expected 808.0 (0.02)
Passed bias filter:                      962  (0.0238107); expected 808.0 (0.02)
Passed Vit filter:                        82  (0.0020296); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.07u 0.01s 00:00:00.08 Elapsed: 00:00:00.03
# Mc/sec: 13644.83
//
Query:       Tachystatin_A  [M=44]
Accession:   PF11406.12
Description: Antimicrobial peptide tachystatin A
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.15   13.3   3.0       0.27   12.5   2.9    1.6  1  LDJJOL_34745   hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_34745  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.5   2.9   6.6e-06      0.27      21      31 ..       4      14 ..       1      26 [. 0.85

  Alignments for each domain:
  == domain 1  score: 12.5 bits;  conditional E-value: 6.6e-06
  Tachystatin_A 21 iPCCrGltCrs 31
                   i CC GltC+s
   LDJJOL_34745  4 IACCTGLTCKS 14
                   99********9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1304  (0.0322756); expected 808.0 (0.02)
Passed bias filter:                      718  (0.0177714); expected 808.0 (0.02)
Passed Vit filter:                        54  (0.00133657); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 7182.20
//
Query:       Antifungal_pept  [M=33]
Accession:   PF11410.12
Description: Antifungal peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (33 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1051  (0.0260136); expected 808.0 (0.02)
Passed bias filter:                      713  (0.0176476); expected 808.0 (0.02)
Passed Vit filter:                        65  (0.00160883); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 4985.12
//
Query:       Subtilosin_A  [M=34]
Accession:   PF11420.12
Description: Bacteriocin subtilosin A
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (34 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1085  (0.0268551); expected 808.0 (0.02)
Passed bias filter:                      689  (0.0170536); expected 808.0 (0.02)
Passed Vit filter:                        41  (0.0010148); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 6732.21
//
Query:       Tachystatin_B  [M=42]
Accession:   PF11478.12
Description: Antimicrobial chitin binding protein tachystatin B
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.24   12.5   0.2        0.4   11.8   0.2    1.4  1  LDJJOL_150825  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_150825  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.2     1e-05       0.4      26      40 ..      34      48 ..      29      50 .. 0.90

  Alignments for each domain:
  == domain 1  score: 11.8 bits;  conditional E-value: 1e-05
  Tachystatin_B 26 rrdfPGsifGtCsrr 40
                   +rd+  s f tCsrr
  LDJJOL_150825 34 KRDMFASWFNTCSRR 48
                   79************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (42 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1414  (0.0349983); expected 808.0 (0.02)
Passed bias filter:                      627  (0.015519); expected 808.0 (0.02)
Passed Vit filter:                        34  (0.000841542); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 7384.31
//
Query:       Stomoxyn  [M=39]
Accession:   PF11585.12
Description: Insect antimicrobial peptide, stomoxyn
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (39 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       662  (0.0163853); expected 808.0 (0.02)
Passed bias filter:                      525  (0.0129944); expected 808.0 (0.02)
Passed Vit filter:                        29  (0.000717786); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 6681.08
//
Query:       LcnG-beta  [M=60]
Accession:   PF11632.12
Description: Lactococcin G-beta
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.14   13.3   0.2       0.21   12.7   0.2    1.3  1  LDJJOL_41595  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_41595  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.7   0.2   5.3e-06      0.21      14      57 ..      16      56 ..      12      57 .] 0.88

  Alignments for each domain:
  == domain 1  score: 12.7 bits;  conditional E-value: 5.3e-06
     LcnG-beta 14 evElstveGGGkleaavikliePAYeFiKGvakGFveagnkdnw 57
                  ++E+  veG G++e ++  + +   + +K ++ GF   g  d+w
  LDJJOL_41595 16 DEEVHRVEGKGRIE-TLLYFTN--GDVGKSLGFGFRRQGRVDDW 56
                  99************.8566655..699***************99 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (60 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       478  (0.0118311); expected 808.0 (0.02)
Passed bias filter:                      423  (0.0104698); expected 808.0 (0.02)
Passed Vit filter:                        21  (0.000519776); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 9634.25
//
Query:       Bacteriocin_IIi  [M=50]
Accession:   PF11758.12
Description: Aureocin-like type II bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
        0.3   11.9   0.2        0.5   11.2   0.2    1.3  1  LDJJOL_139830  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_139830  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.2   0.2   1.2e-05       0.5      17      37 ..      64      85 ..      63      89 .. 0.89

  Alignments for each domain:
  == domain 1  score: 11.2 bits;  conditional E-value: 1.2e-05
  Bacteriocin_IIi 17 vkWawdnkgrvl.nWirnGmav 37
                     + W+w+n+ rv+ +++r+G  v
    LDJJOL_139830 64 ASWVWQNGLRVVtDGLRAGTIV 85
                     57*********99******765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (50 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       861  (0.0213108); expected 808.0 (0.02)
Passed bias filter:                      677  (0.0167566); expected 808.0 (0.02)
Passed Vit filter:                        41  (0.0010148); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 7141.89
//
Query:       CAP18_C  [M=28]
Accession:   PF12153.12
Description: LPS binding domain of CAP18 (C terminal)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (28 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       812  (0.020098); expected 808.0 (0.02)
Passed bias filter:                      630  (0.0155933); expected 808.0 (0.02)
Passed Vit filter:                        42  (0.00103955); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 4123.42
//
Query:       BacteriocIIc_cy  [M=80]
Accession:   PF12173.12
Description: Bacteriocin class IIc cyclic gassericin A-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (80 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       761  (0.0188357); expected 808.0 (0.02)
Passed bias filter:                      564  (0.0139597); expected 808.0 (0.02)
Passed Vit filter:                        35  (0.000866294); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 12018.47
//
Query:       Antimicrobial21  [M=30]
Accession:   PF14861.10
Description: Plant antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (30 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1698  (0.0420276); expected 808.0 (0.02)
Passed bias filter:                      779  (0.0192812); expected 808.0 (0.02)
Passed Vit filter:                        31  (0.000767289); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 4561.70
//
Query:       Antimicrobial22  [M=21]
Accession:   PF16047.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (21 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       808  (0.019999); expected 808.0 (0.02)
Passed bias filter:                      571  (0.014133); expected 808.0 (0.02)
Passed Vit filter:                        37  (0.000915796); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 3443.45
//
Query:       Antimicrobial23  [M=17]
Accession:   PF16048.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
        1.9    9.4   0.3        1.9    9.4   0.3    2.1  2  LDJJOL_151095  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_151095  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.7   0.9     0.024   9.8e+02       9      12 ..      35      38 ..      34      38 .. 0.94
   2 ?    9.4   0.3   4.7e-05       1.9       3       8 ..      49      54 ..      49      56 .. 0.81

  Alignments for each domain:
  == domain 1  score: 0.7 bits;  conditional E-value: 0.024
  Antimicrobial23  9 KSYP 12
                     KSYP
    LDJJOL_151095 35 KSYP 38
                     9**9 PP

  == domain 2  score: 9.4 bits;  conditional E-value: 4.7e-05
  Antimicrobial23  3 lRGCWT 8 
                     + GCWT
    LDJJOL_151095 49 FQGCWT 54
                     68**** PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (17 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1220  (0.0301965); expected 808.0 (0.02)
Passed bias filter:                      782  (0.0193555); expected 808.0 (0.02)
Passed Vit filter:                        51  (0.00126231); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.02
# Mc/sec: 3251.40
//
Query:       Antimicrobial24  [M=25]
Accession:   PF16049.9
Description: Frog antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.096   13.8   0.3       0.18   12.9   0.3    1.4  1  LDJJOL_132170  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_132170  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.9   0.3   4.6e-06      0.18       2      10 ..      39      47 ..      39      48 .. 0.96

  Alignments for each domain:
  == domain 1  score: 12.9 bits;  conditional E-value: 4.6e-06
  Antimicrobial24  2 LvSSIGkAL 10
                     L+SSIG+AL
    LDJJOL_132170 39 LISSIGRAL 47
                     9*******9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (25 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       691  (0.0171031); expected 808.0 (0.02)
Passed bias filter:                      580  (0.0143557); expected 808.0 (0.02)
Passed Vit filter:                        38  (0.000940547); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 3902.78
//
Query:       Antimicrobial25  [M=53]
Accession:   PF16839.9
Description: Nematode antimicrobial peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.67   11.1   3.0        1.2   10.3   3.0    1.4  1  LDJJOL_121200  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_121200  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.3   3.0     3e-05       1.2      26      51 ..     155     180 ..     153     183 .. 0.92

  Alignments for each domain:
  == domain 1  score: 10.3 bits;  conditional E-value: 3e-05
  Antimicrobial25  26 nCgtgyCekrggrktCvCsrCanggg 51 
                       C++g+C+  + +    CsrC+n+ +
    LDJJOL_121200 155 TCSSGNCTWNSFQSAGWCSRCENATS 180
                      5**********************876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (53 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1767  (0.0437355); expected 808.0 (0.02)
Passed bias filter:                      712  (0.0176229); expected 808.0 (0.02)
Passed Vit filter:                        43  (0.0010643); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 9768.36
//
Query:       DEFB136  [M=51]
Accession:   PF17333.6
Description: Beta defensin 136
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (51 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1500  (0.0371269); expected 808.0 (0.02)
Passed bias filter:                      858  (0.0212366); expected 808.0 (0.02)
Passed Vit filter:                        80  (0.0019801); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 8285.50
//
Query:       Pilosulin  [M=74]
Accession:   PF17499.6
Description: Ant venom peptides
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
        1.1   10.6   2.6        1.6   10.1   2.6    1.2  1  LDJJOL_193430  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_193430  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.1   2.6   3.9e-05       1.6      21      64 ..      40      84 ..      38      89 .. 0.89

  Alignments for each domain:
  == domain 1  score: 10.1 bits;  conditional E-value: 3.9e-05
      Pilosulin 21 aPnveakaLaDPesdavGf.adavGeaDpfaiakldvkklskaic 64
                   aP  e+ a a Pe+ a  + a+a G+a p+++  +    ++k+++
  LDJJOL_193430 40 APAAETAAEAAPEAPAPPEgAEATGDAAPVDESSVSPDDIKKITA 84
                   89999***********87659*************99999999875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       918  (0.0227216); expected 808.0 (0.02)
Passed bias filter:                      827  (0.0204693); expected 808.0 (0.02)
Passed Vit filter:                        54  (0.00133657); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 12018.56
//
Query:       MccV  [M=88]
Accession:   PF17508.6
Description: Microcin V bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (88 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1307  (0.0323499); expected 808.0 (0.02)
Passed bias filter:                      972  (0.0240582); expected 808.0 (0.02)
Passed Vit filter:                        59  (0.00146032); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 14245.98
//
Query:       Defensin_int  [M=44]
Accession:   PF17858.5
Description: Platypus intermediate defensin-like peptide
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
        1.2   10.4   3.9        2.9    9.2   0.1    2.9  3  LDJJOL_00335  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_00335  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.2   0.1   7.1e-05       2.9      16      27 ..      22      33 ..      15      42 .. 0.86
   2 ?    1.3   0.1     0.021   8.6e+02      23      41 ..      51      68 ..      46      70 .. 0.70
   3 ?   -2.0   0.0      0.22     9e+03      14      16 ..     105     107 ..     102     119 .. 0.61

  Alignments for each domain:
  == domain 1  score: 9.2 bits;  conditional E-value: 7.1e-05
  Defensin_int 16 CqPrgsPCLrlr 27
                  CqP +sP Lrl+
  LDJJOL_00335 22 CQPASSPDLRLQ 33
                  **********96 PP

  == domain 2  score: 1.3 bits;  conditional E-value: 0.021
  Defensin_int 23 CLrlrgacprgsrccmptv 41
                  C  +rg     src m  v
  LDJJOL_00335 51 CTVVRGN-DEASRCLMKYV 68
                  5556664.46799999876 PP

  == domain 3  score: -2.0 bits;  conditional E-value: 0.22
  Defensin_int  14 GqC 16 
                   GqC
  LDJJOL_00335 105 GQC 107
                   665 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1646  (0.0407406); expected 808.0 (0.02)
Passed bias filter:                      719  (0.0177961); expected 808.0 (0.02)
Passed Vit filter:                        38  (0.000940547); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.00s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 6908.88
//
Query:       Sublancin  [M=57]
Accession:   PF19151.4
Description: Sublancin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (57 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       849  (0.0210138); expected 808.0 (0.02)
Passed bias filter:                      602  (0.0149003); expected 808.0 (0.02)
Passed Vit filter:                        21  (0.000519776); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.04u 0.00s 00:00:00.04 Elapsed: 00:00:00.02
# Mc/sec: 11300.24
//
Query:       garvicinKS_A  [M=22]
Accession:   NF038164.1
Description: NCBIFAM: GatA family leaderless bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (22 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       846  (0.0209396); expected 808.0 (0.02)
Passed bias filter:                      564  (0.0139597); expected 808.0 (0.02)
Passed Vit filter:                        36  (0.000891045); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 3959.14
//
Query:       cyan_ocin_like  [M=72]
Accession:   NF038167.1
Description: NCBIFAM: CTB family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (72 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       715  (0.0176971); expected 808.0 (0.02)
Passed bias filter:                      531  (0.0131429); expected 808.0 (0.02)
Passed Vit filter:                        25  (0.000618781); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.02
# Mc/sec: 13428.06
//
Query:       Bac51  [M=107]
Accession:   NF041453.1
Description: NCBIFAM: bacteriocin 51 precursor BacA
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
       0.16   13.5   0.0       0.18   13.3   0.0    1.0  1  LDJJOL_42220  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_42220  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.3   0.0   4.5e-06      0.18       4      65 ..      10      71 ..       7      77 .. 0.92

  Alignments for each domain:
  == domain 1  score: 13.3 bits;  conditional E-value: 4.5e-06
         Bac51  4 stkykhnhagytcYkisyyvspkkvkklkkqtkklktvsaianfiglggltagvvslaFgsa 65
                  s +++h  ++y++   +y +s++++k+      ++k  s++   i  ++l++ v  + F s 
  LDJJOL_42220 10 SLRFSHAMHAYRTLSSQYEISNAECKESGITPVQVKWDSQLNTKINHANLNTLVFKIFFNSP 71
                  7799**************************************************99999886 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (107 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       640  (0.0158408); expected 808.0 (0.02)
Passed bias filter:                      550  (0.0136132); expected 808.0 (0.02)
Passed Vit filter:                        24  (0.00059403); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 16679.95
//
Query:       oc_CLOSPO_01332  [M=59]
Accession:   TIGR04067.1
Description: JCVI: Apre_1838 family putative sactipeptide bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (59 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1266  (0.0313351); expected 808.0 (0.02)
Passed bias filter:                      699  (0.0173011); expected 808.0 (0.02)
Passed Vit filter:                        42  (0.00103955); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 8781.89
//
Query:       bactofencin_A  [M=45]
Accession:   NF038163.1
Description: NCBIFAM: bactofencin A family cationic bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (45 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       644  (0.0159398); expected 808.0 (0.02)
Passed bias filter:                      509  (0.0125984); expected 808.0 (0.02)
Passed Vit filter:                        29  (0.000717786); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 6649.23
//
Query:       ocin_CLI_3235  [M=34]
Accession:   TIGR04065.1
Description: JCVI: CLI_3235 family bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.16   13.2   0.0       0.22   12.8   0.0    1.2  1  LDJJOL_59710   hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_59710  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.8   0.0   5.3e-06      0.22       7      27 ..      56      76 ..      51      79 .. 0.81

  Alignments for each domain:
  == domain 1  score: 12.8 bits;  conditional E-value: 5.3e-06
  ocin_CLI_3235  7 klelkkeTveAYsCnCssnCs 27
                   kl l    ++A++C+C   Cs
   LDJJOL_59710 56 KLDLRLPILMAFLCECREFCS 76
                   666777779*******99997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (34 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1539  (0.0380922); expected 808.0 (0.02)
Passed bias filter:                      866  (0.0214346); expected 808.0 (0.02)
Passed Vit filter:                        59  (0.00146032); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 5557.90
//
Query:       B_an_ocin  [M=88]
Accession:   TIGR03601.1
Description: JCVI: heterocycloanthracin family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (88 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      2172  (0.0537597); expected 808.0 (0.02)
Passed bias filter:                      942  (0.0233157); expected 808.0 (0.02)
Passed Vit filter:                        76  (0.00188109); expected 40.4 (0.001)
Passed Fwd filter:                         1  (2.47512e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 13514.79
//
Query:       lactGbeta_entB  [M=38]
Accession:   NF038034.1
Description: NCBIFAM: lactococcin G-beta/enterocin 1071B family bacteriocin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------

   [No hits detected that satisfy reporting thresholds]


Domain annotation for each sequence (and alignments):

   [No targets detected that satisfy reporting thresholds]


Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (38 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                       739  (0.0182912); expected 808.0 (0.02)
Passed bias filter:                      583  (0.01443); expected 808.0 (0.02)
Passed Vit filter:                        40  (0.00099005); expected 40.4 (0.001)
Passed Fwd filter:                         0  (0); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 5944.33
//
Query:       Thiopep_pre  [M=36]
Accession:   PF19409.3
Description: Thiopeptide-type bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
      0.067   14.1   0.2      0.099   13.5   0.2    1.3  1  LDJJOL_197875  hypothetical protein
       0.94   10.4   0.0       0.94   10.4   0.0    3.1  3  LDJJOL_148125  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_197875  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.5   0.2   4.9e-06     0.099       9      23 ..      18      32 ..      15      36 .. 0.80

  Alignments for each domain:
  == domain 1  score: 13.5 bits;  conditional E-value: 4.9e-06
    Thiopep_pre  9 davALPEtGASsGss 23
                    +v++PEt AS  ss
  LDJJOL_197875 18 SSVGMPETSASLASS 32
                   58*********8543 PP

>> LDJJOL_148125  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   1.9      0.35     7e+03      24      33 ..      39      48 ..      37      48 .. 0.81
   2 ?   10.4   0.0   4.7e-05      0.94       2      14 ..      67      79 ..      66      80 .. 0.92
   3 ?   -2.3   2.7      0.43   8.8e+03      27      35 ..      93      98 ..      91     100 .. 0.48

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.35
    Thiopep_pre 24 scsscsccgs 33
                   s ++ sc g+
  LDJJOL_148125 39 SRCAESCNGC 48
                   6788999988 PP

  == domain 2  score: 10.4 bits;  conditional E-value: 4.7e-05
    Thiopep_pre  2 leVtslrdavALP 14
                   ++++s+r++++LP
  LDJJOL_148125 67 ITIISMREGMGLP 79
                   89*********** PP

  == domain 3  score: -2.3 bits;  conditional E-value: 0.43
    Thiopep_pre 27 scsccgsSS 35
                   +c c+   S
  LDJJOL_148125 93 ACLCS---S 98
                   34443...3 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (36 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      2311  (0.0572001); expected 808.0 (0.02)
Passed bias filter:                      878  (0.0217316); expected 808.0 (0.02)
Passed Vit filter:                        63  (0.00155933); expected 40.4 (0.001)
Passed Fwd filter:                         3  (7.42537e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 5825.25
//
Query:       thiopep_precurs  [M=44]
Accession:   TIGR03892.1
Description: JCVI: thiazolylpeptide-type bacteriocin precursor
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
  ------ inclusion threshold ------
       0.53   11.7   0.1       0.53   11.7   0.1    2.3  2  LDJJOL_141235  hypothetical protein
       0.58   11.6   5.0        1.2   10.6   0.2    2.5  2  LDJJOL_83790   hypothetical protein
        1.3   10.5   0.1        1.3   10.5   0.1    2.5  3  LDJJOL_82080   hypothetical protein
        8.2    7.9   8.3          4    8.9   5.9    1.8  2  LDJJOL_60660   hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_141235  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   4.0      0.95   9.6e+03      30      38 ..       2      10 ..       1      11 [. 0.61
   2 ?   11.7   0.1   5.3e-05      0.53      22      37 ..      26      41 ..      16      42 .. 0.86

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.95
  thiopep_precurs 30 sssSsCsTc 38
                     ss+Ss +T+
    LDJJOL_141235  2 SSTSSPTTS 10
                     666666664 PP

  == domain 2  score: 11.7 bits;  conditional E-value: 5.3e-05
  thiopep_precurs 22 assgatstsssSsCsT 37
                     ++++++s +s++sC++
    LDJJOL_141235 26 TGAHTVSDISCASCGS 41
                     357***********97 PP

>> LDJJOL_83790  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   1.0     0.059   5.9e+02      25      34 ..     100     109 ..      91     114 .. 0.51
   2 ?   10.6   0.2   0.00012       1.2      23      37 ..     130     144 ..     121     145 .. 0.86

  Alignments for each domain:
  == domain 1  score: 2.0 bits;  conditional E-value: 0.059
  thiopep_precurs  25 gatstsssSs 34 
                      +a+s sssSs
     LDJJOL_83790 100 SAVSVSSSSS 109
                      2344444444 PP

  == domain 2  score: 10.6 bits;  conditional E-value: 0.00012
  thiopep_precurs  23 ssgatstsssSsCsT 37 
                      +++++s +s++sC++
     LDJJOL_83790 130 GAHTVSDISCASCGS 144
                      57***********97 PP

>> LDJJOL_82080  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.1   0.00013       1.3       1      17 [.       7      23 ..       7      59 .. 0.81
   2 ?   -3.0   2.1       2.2   2.2e+04      17      17 ..     162     162 ..     136     177 .. 0.47
   3 ?   -2.4   0.2       1.4   1.4e+04      29      40 ..     209     218 ..     200     221 .. 0.51

  Alignments for each domain:
  == domain 1  score: 10.5 bits;  conditional E-value: 0.00013
  thiopep_precurs  1 lteLDietfEisDyadl 17
                     +teLDi+ +Ei ++ d 
     LDJJOL_82080  7 FTELDIDLLEIRELYDI 23
                     79***********9984 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 2.2
  thiopep_precurs  17 l 17 
                      +
     LDJJOL_82080 162 E 162
                      1 PP

  == domain 3  score: -2.4 bits;  conditional E-value: 1.4
  thiopep_precurs  29 tsssSsCsTcsc 40 
                      t+ ++  +T ++
     LDJJOL_82080 209 TTITA--TTPIT 218
                      33333..44444 PP

>> LDJJOL_60660  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   5.9   0.00039         4      18      42 ..      30      52 ..      24      54 .. 0.82
   2 ?   -3.8   0.0       3.6   3.6e+04       6      12 ..     204     210 ..     204     213 .. 0.71

  Alignments for each domain:
  == domain 1  score: 8.9 bits;  conditional E-value: 0.00039
  thiopep_precurs 18 aevgassgatstsssSsCsTcscts 42
                     +e+    g++s  ++++C++++ t+
     LDJJOL_60660 30 TETVL--GTVSYMMTATCTSTTGTT 52
                     56666..899***********9987 PP

  == domain 2  score: -3.8 bits;  conditional E-value: 3.6
  thiopep_precurs   6 ietfEis 12 
                      +et+E+s
     LDJJOL_60660 204 VETLELS 210
                      5788875 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (44 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      2387  (0.0590812); expected 808.0 (0.02)
Passed bias filter:                     1130  (0.0279689); expected 808.0 (0.02)
Passed Vit filter:                       121  (0.0029949); expected 40.4 (0.001)
Passed Fwd filter:                         7  (0.000173259); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               4  [number of targets reported over threshold]
# CPU time: 0.07u 0.00s 00:00:00.07 Elapsed: 00:00:00.03
# Mc/sec: 6081.92
//
Query:       Defensin_2  [M=33]
Accession:   PF01097.19
Description: Arthropod defensin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
  ------ inclusion threshold ------
      0.025   16.1   1.0        1.6   10.3   0.1    2.3  2  LDJJOL_91815  hypothetical protein
        0.3   12.6   2.0       0.46   12.0   2.0    1.2  1  LDJJOL_58230  hypothetical protein


Domain annotation for each sequence (and alignments):
>> LDJJOL_91815  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1    0.0056   1.1e+02      18      26 ..      24      32 ..      20      35 .. 0.76
   2 ?   10.3   0.1   7.7e-05       1.6      11      30 ..      39      57 ..      37      58 .. 0.85

  Alignments for each domain:
  == domain 1  score: 4.4 bits;  conditional E-value: 0.0056
    Defensin_2 18 GyrGGyCng 26
                  G  +GyC+ 
  LDJJOL_91815 24 GSNRGYCTH 32
                  8899***84 PP

  == domain 2  score: 10.3 bits;  conditional E-value: 7.7e-05
    Defensin_2 11 aaHClsiGyrGGyCngkgvC 30
                  + +Cls+G++G   +  ++C
  LDJJOL_91815 39 HKNCLSKGKKGAFFT-ISTC 57
                  889********9888.7777 PP

>> LDJJOL_58230  hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   2.0   2.3e-05      0.46       4      17 ..      45      58 ..      43      62 .. 0.89

  Alignments for each domain:
  == domain 1  score: 12.0 bits;  conditional E-value: 2.3e-05
    Defensin_2  4 pvnhsaCaaHClsi 17
                  p n+ aC+ HC+ +
  LDJJOL_58230 45 PYNNHACQSHCIHQ 58
                  89*********987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (33 nodes)
Target sequences:                      40402  (5083634 residues searched)
Passed MSV filter:                      1967  (0.0486857); expected 808.0 (0.02)
Passed bias filter:                      899  (0.0222514); expected 808.0 (0.02)
Passed Vit filter:                        54  (0.00133657); expected 40.4 (0.001)
Passed Fwd filter:                         2  (4.95025e-05); expected 0.4 (1e-05)
Initial search space (Z):              40402  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.03
# Mc/sec: 4570.65
//
[ok]
